########################################################################################################################################################################################################################## Database Name: UND_NIDA_Brain_Proteome_protein-level_log2z+8_Aug22 GeneNetwork Accession Number: GN1053 For more information regarding this data set please visit: http://www.genenetwork.org/webqtl/main.py?FormID=sharinginfo&GN_AccessionId=1053 Z-Score. In general, the array data that we enter in GeneNetwork have been log transformed and then z-score normalized, but instead of leaving the mean at 0 and the standard deviation of 1 unit, the data is rescaled to a mean of 8 units with a standard deviation of 2 units (what we call 2Z + 8 normalized data). Usage Conditions and Limitations: Data sets that have been incorporated in the GeneNetwork belong to individuals, groups, and companies listed in the Status and Contacts page. Many data sets are still being generated and analyzed, and the data contributors have often agreed to remove protection and let other investigators view, share, and analyze data. We request that those of you analyzing these data and preparing publications do your best of acknowledge the original data sources. Please contact Robert W. Williams at rwilliams@uthsc.edu or by telephone at (901) 448-7050 if you have questions regarding the status of data and what group to acknowledge. If your work relies heavily on the GeneNetwork please consider acknowledging the grants that provide substantial support for this project (see bottom of all web pages). Please review the annotated References for relevant citations. For further details on use and citation of data in papers please read the section below on Academic, educational, and not-for-profit institutional use. The Standard Disclaimers of Warranties. The University of Tennessee (UT), its trustees, directors, officers, employees, and affiliates make no representation and extend no warranties of any kind, either express or implied, including warranties of correctness, accuracy, fitness for a particular purpose, merchantability, validity of patent rights claims (issued or pending), the absence of latent or other defects, whether or not discoverable. In no event shall UT or its trustees, directors, officers, employees, or affiliates be liable for incidental or consequential damages of any kind, including economic damage or injury to property and lost profits, regardless of whether UT, its trustees, directors, officers, employees, and affiliates shall be advised, shall have other reason to know, or in fact shall know of the possibility of the foregoing. Disclaimer. The data providers make no guarantees or warranties as to the accuracy or completeness of or results to be obtained from accessing and using information from The GeneNetwork. We will not be liable to any user or anyone else for any inaccuracy, error or omission, regardless of cause, in the data contained in The GeneNetwork databases or any resulting damages. In addition, the data providers do not warrant that the databases will meet your requirements, be uninterrupted, or error-free. Data providers expressly exclude and disclaim all expressed and implied warranties of merchantability and fitness for a particular purpose. Data providers shall not be responsible for any damage or loss of any kind arising out of or related to your use of the databases,including without limitation data loss or corruption, regardless of whether such liability is based in tort, contract, or otherwise. ########################################################################################################################################################################################################################## ProbeSet Gene Symbol Chr Mb Gene Id Strand Gene Blat Mb Start Blat Mb End Description Aliases Blat Sequence UniGeneId OMIM HomoloGeneID SHR/OlaIpcv BN-Lx/Cub HXB1 HXB2 HXB3 HXB4 HXB5 HXB7 HXB10 HXB13 HXB15 HXB17 HXB18 HXB20 HXB21 HXB22 HXB23 HXB24 HXB25 HXB27 HXB29 HXB31 BXH3 BXH5 BXH6 BXH8 BXH9 BXH10 BXH11 BXH12 BXH13 P22062 Pcmt1 1 2.113171 25604 - 2.113171 2.143954 protein-l-isoaspartate(d-aspartate) o-methyltransferase None PAGGNQMLEQYDKLQDGSVK None 176851 55895 21.18 22.48 19.56 21.37 21.46 20.34 21.8 21.2 19.83 20.55 20.38 20.41 20.24 20.8 19.23 21.01 21.14 20.68 20.41 22.04 19.22 20.14 20.19 19.75 21.24 22.29 19.77 20.38 21.81 20.39 20.0 B0BNB5 Nup43 1 2.1480441 683983 + 2.1480441 2.158424 loc683983 protein None AVRTIDNADSSTLHAVTFLR None None None 16.11 14.71 16.79 15.65 16.16 15.62 15.3 15.45 15.47 15.21 15.63 15.91 16.21 16.26 16.08 15.94 15.87 16.83 14.54 16.03 16.86 15.44 16.29 16.73 17.35 15.81 16.39 14.51 16.89 16.57 16.98 Q6E0V2 Katna1 1 2.2022041 292464 + 2.2022041 2.244133 katanin p60 atpase-containing subunit a1 None AAQHELPSSEGEVWSLPVPVER None 606696 56014 18.46 19.37 18.39 19.01 17.87 18.52 18.87 18.09 17.31 17.72 19.14 18.01 18.04 17.17 18.04 19.22 18.68 17.58 19.06 17.94 17.54 18.49 17.61 17.5 18.65 18.21 17.91 19.34 17.29 17.49 17.09 D4AEG3 Ppil4 1 2.2736261 361449 + 2.2736261 2.305664 peptidyl-prolyl cis-trans isomerase None VKKINETFVDKDFVPYQDIR None 607609 12126 16.12 14.81 16.63 15.9 15.88 16.62 15.82 15.67 17.48 14.75 16.01 17.09 16.87 16.86 16.63 15.99 14.94 16.72 16.71 16.95 18.16 16.77 16.89 15.93 16.96 16.24 16.24 16.42 17.7 16.86 17.36 F1LU97 Sash1 1 3.1198751 365037 - 3.1198751 3.182164 sam and sh3 domain-containing 1 None PLKKASPASPVSPSDCPSPR None None None 17.95 15.32 17.7 17.73 16.91 17.51 16.81 16.51 17.22 17.05 17.78 15.41 16.8 16.97 15.4 17.84 17.59 18.03 17.42 16.75 16.4 16.95 17.81 18.72 17.73 17.1 16.73 15.88 17.48 17.85 16.39 Q9WU70 Stxbp5 1 4.1824861 81022 - 4.1824861 4.335101 syntaxin-binding protein 5 None HPSTSSSSSDGLRDNVPCLK None 604586 16402 20.01 19.92 18.42 19.09 17.55 20.14 19.64 18.17 19.84 19.88 19.0 19.91 18.61 19.06 18.77 20.12 19.31 19.86 18.96 19.35 19.83 20.43 19.4 19.32 17.67 19.21 18.41 19.44 19.79 18.73 18.45 P23385 Grm1 1 5.0582931 24414 - 5.0582931 5.682317 metabotropic glutamate receptor 1 None GLCDAMKPIDGRKLLDFLIK None 604473 649 17.21 17.45 18.22 17.84 18.35 17.84 17.71 18.08 18.88 18.0 17.33 18.77 19.09 18.79 19.27 17.82 17.6 17.92 19.3 17.72 19.44 18.29 18.48 17.96 18.31 18.38 19.12 19.52 17.55 18.45 19.23 Q5XI67 Fbxo30 1 5.6555761 308283 + 5.6555761 5.671453 f-box only protein 30 None TVETTRSLAAALDILNSATR None 609101 12959 15.32 12.85 15.27 15.72 15.85 13.74 15.61 15.92 14.09 15.3 14.34 15.19 15.54 14.88 16.07 14.27 15.33 14.04 14.04 15.08 15.0 15.07 15.55 14.82 14.7 16.47 15.47 14.79 14.55 15.62 15.27 Q91XQ2 Epm2a 1 5.7271121 114005 + 5.7271121 5.845103 laforin None AVAGTRLELLLAGSRPELGR None None None 15.93 16.38 15.04 16.65 15.54 15.8 16.34 15.28 16.44 14.92 14.87 13.76 13.91 14.47 14.11 16.63 14.58 16.35 16.57 14.75 14.29 14.7 14.74 16.09 15.41 16.14 13.94 14.34 15.81 15.32 14.97 A0A0G2JW60 Utrn 1 6.7208561 25600 - 6.7208561 7.224313 utrophin None WLVLIDQMLKSNIVTVGDVK None 128240 21398 18.65 16.63 18.25 17.27 18.3 16.99 17.5 18.54 17.2 17.48 19.91 17.13 17.64 18.1 18.27 16.93 18.38 17.29 17.62 16.85 17.9 17.73 17.91 18.19 17.7 17.06 18.74 17.6 16.61 17.72 18.07 G3V7L1 Utrn 1 6.7208561 25600 - 6.7208561 7.224313 utrophin None YQAVQKALEEYQQQLENELK None 128240 21398 18.62 16.53 18.24 17.27 18.3 16.98 17.5 18.54 17.2 17.46 19.92 17.17 17.63 18.1 18.27 16.93 18.38 17.29 17.62 16.85 17.9 17.73 17.96 18.19 17.7 17.06 18.74 17.6 16.61 17.75 18.06 D4A5T1 Sf3b5 1 7.3570411 680891 + 7.3570411 7.357751 splicing factor 3b subunit 5 None SQLEHLQSKYIGTGHADTTK None None 41825 16.83 18.68 17.33 16.8 17.21 16.02 15.72 17.56 17.46 15.9 15.82 17.14 16.4 16.6 17.64 16.62 17.32 17.26 16.39 16.28 17.66 16.7 16.15 17.82 17.54 17.62 17.37 15.95 17.77 16.31 17.39 P62025 Phactr2 1 7.5979271 308291 - 7.5979271 7.860289 phosphatase and actin regulator 2 None AGPQLLTPGQMGDSLESFSAPEDEAPR None None None 16.32 15.0 17.16 16.44 17.26 15.79 16.56 16.99 16.51 16.34 16.36 15.93 17.26 16.75 15.97 17.28 16.14 17.3 15.65 18.16 16.92 16.16 16.1 16.15 17.02 17.0 17.84 16.9 15.75 17.08 17.99 Q6AYS4 Fuca2 1 7.8859581 292485 + 7.8859581 7.900797 plasma alpha-l-fucosidase None NAVDEGPKRDIVKELEVAVR None 136820 119 16.47 14.75 15.23 17.08 15.01 17.04 16.72 15.22 15.72 14.56 16.13 15.2 15.06 15.16 14.4 16.54 15.0 16.76 16.77 15.07 14.76 15.1 16.41 15.94 16.77 15.96 14.26 14.61 16.37 16.65 14.1 Q9JJK4 Pex3 1 7.9126381 83519 - 7.9126381 7.954511 peroxisomal biogenesis factor 3 None ELVTVIKQAVQRILGSISLK None 603164 2691 15.72 16.81 15.29 14.06 15.55 15.53 15.62 16.62 15.45 17.74 15.2 15.11 15.22 15.48 15.11 15.89 16.88 15.34 15.41 15.12 15.93 15.92 14.48 15.79 15.07 15.48 16.35 15.57 14.95 15.08 15.99 A0A096MKH2 Vta1 1 9.0328711 292640 - 9.0328711 9.080708 similar to riken cdna 1110059p08 None TPECRKFLSKLMDQLEALKK None 610902 6473 17.27 18.5 18.03 18.64 18.4 17.79 18.61 19.68 19.02 19.58 17.31 18.43 19.05 17.74 18.92 18.73 17.82 18.88 18.8 19.25 17.99 18.49 19.33 19.03 17.89 19.25 17.98 18.02 19.01 17.92 18.32 D3ZSL2 Abracl 1 12.6549411 685045 - 12.6549411 12.665246 abra c-terminal-like None VLFQDDRCANLFEALVGTLK None None None 15.57 17.52 16.59 17.15 17.81 17.33 18.51 16.98 17.4 17.96 16.4 18.45 18.01 16.49 17.89 17.99 16.23 17.19 17.75 17.18 17.95 17.61 18.08 16.77 16.24 17.09 16.47 18.19 16.62 16.89 16.67 A0A0G2JZY3 Reps1 1 12.6986911 292944 + 12.6986911 12.775561 ralbp1-associated eps domain-containing 1 None FCAAFHLVVARKNGYDLPEK None None 7515 18.28 16.22 17.63 19.64 17.28 18.83 17.65 16.85 17.33 17.72 16.82 17.65 18.28 17.15 15.96 18.15 18.2 18.38 18.37 18.61 17.29 18.42 18.31 19.06 18.56 19.46 18.57 17.28 17.05 18.41 18.24 Q498D0 Ccdc28a 1 12.8576721 361454 - 12.8576721 12.872706 coiled-coil domain-containing 28a None ELEELPEDKRKAVSDANLDR None None 56705 17.13 15.82 16.13 16.54 17.28 16.15 17.03 16.08 15.94 16.11 17.76 16.15 16.15 14.83 16.5 16.61 17.03 15.12 16.62 14.79 16.16 15.42 16.72 16.52 16.06 14.74 15.76 15.15 15.92 14.83 16.17 A0A0G2JZL4 Nhsl1 1 13.0803011 308631 + 13.0803011 13.187228 nhs-like 1 None LYHCRSNLAFPAHPPDVDGK None None None 16.18 14.76 16.54 16.48 15.29 15.84 15.98 16.76 16.21 14.55 16.42 16.38 16.91 16.76 14.76 16.6 16.33 16.95 16.82 15.82 16.07 15.17 16.41 15.76 17.03 16.13 15.75 16.2 17.54 16.45 16.46 D3ZHC4 Hebp2 1 13.1962511 308632 - 13.1962511 13.201636 heme binding protein 2, isoform cra_b None GFSSGQKNQEQLLTLANILR None None 8634 18.11 16.26 16.75 16.84 17.97 16.42 17.33 17.48 15.81 16.83 18.6 16.54 17.44 16.28 17.04 17.75 16.66 17.53 15.68 17.95 16.03 16.18 16.8 15.62 16.88 17.32 17.83 17.57 16.43 17.24 17.01 D3ZF86 Arfgef3 1 13.2459471 292947 - 13.2459471 13.324655 arfgef family member 3 None HLIDQGQMRHSFSAGPELLR None None None 19.26 17.66 16.81 19.14 17.04 18.89 18.1 17.53 19.13 18.56 17.51 17.98 17.58 18.45 17.71 16.99 19.03 18.03 18.95 16.49 17.42 18.89 18.64 18.4 18.42 18.09 17.69 17.93 18.03 18.55 17.2 M0R7V5 Tnfaip3 1 13.7110221 683206 - 13.7110221 13.720795 ubiquitinyl hydrolase 1 None SQRIASLAHRGEPTPEEPPK None None None 15.22 13.89 15.49 16.31 15.89 15.53 16.27 16.16 14.91 14.83 15.72 14.7 16.28 14.91 15.42 15.59 15.21 15.97 14.08 16.31 14.1 15.34 15.34 16.08 16.11 16.74 14.5 15.44 14.77 15.06 16.63 D3ZZH6 Map3k5 1 14.6863591 365057 + 14.6863591 14.903633 mitogen-activated protein kinase kinase kinase None VDFWMDFLVEATKTDVTVVR None None None 16.85 17.45 17.5 16.68 17.35 17.2 16.71 17.56 18.22 17.23 16.66 18.47 18.29 17.97 18.66 17.65 17.69 18.07 17.68 15.87 18.64 17.28 17.1 17.85 17.13 17.65 17.52 18.09 18.13 17.55 19.14 A0A0G2KB52 Map7 1 14.9105441 293016 + 14.9105441 15.037574 microtubule-associated protein 7 None SVGVIPKTSAGTTDPEEATR None 604108 20851 19.81 18.24 19.89 19.76 19.2 20.22 19.4 19.95 19.07 18.58 20.04 18.08 19.62 18.95 19.2 19.64 19.94 19.84 18.63 18.66 18.97 18.81 19.5 19.76 19.95 20.44 18.81 18.14 20.65 19.6 18.71 A0A0G2K1G0 Bclaf1 1 15.0708951 293017 + 15.0708951 15.148832 mitochondrial fission regulator 2 Aa2-041 None None None None 18.42 17.31 19.19 18.53 18.35 18.38 17.35 18.12 19.62 17.79 18.01 18.91 18.95 19.25 19.46 17.87 18.62 19.1 17.83 18.47 20.57 18.82 19.04 19.0 19.24 18.57 19.77 18.48 19.17 19.29 19.73 A0A0G2K2S3 Bclaf1 1 15.0708951 293017 + 15.0708951 15.148832 mitochondrial fission regulator 2 None TLVHSVKKEQEFRSIFDHIK None 612588 8832 18.42 17.31 19.19 18.53 18.35 18.38 17.35 18.12 19.62 17.79 18.01 18.91 18.95 19.25 19.46 17.87 18.62 19.1 17.83 18.47 20.57 18.82 19.04 19.0 19.24 18.57 19.77 18.48 19.17 19.29 19.73 B1WC16 Bclaf1 1 15.0708951 293017 + 15.0708951 15.148832 bcl2-associated transcription factor 1, isoform cra_a None HHIPSRRSPAKTITPQNAPR None 612588 8832 18.29 17.35 19.08 18.45 18.4 18.42 17.35 18.17 19.64 17.69 18.05 19.01 18.86 19.25 19.55 17.86 18.94 18.97 17.64 18.46 20.55 18.84 19.03 19.0 19.31 18.56 19.82 18.46 19.11 19.27 19.82 Q6DTM3 Ahi1 1 15.7624621 308923 + 15.7624621 15.891041 jouberin None LDWSKDDRYLVTSSSDGTAR None 608894 9762 17.8 17.31 18.17 17.96 16.9 17.53 18.22 17.69 16.47 18.07 17.81 16.6 17.73 17.28 17.71 17.37 18.13 16.68 17.17 18.08 16.74 18.17 16.92 17.72 17.41 18.13 17.94 16.45 17.23 18.34 16.96 Q6AXM7 Hbs1l 1 16.0926081 293408 + 16.0926081 16.170067 hbs1-like protein None GQPSKVISRSSQSESEIVPK None 612450 68525 18.03 17.39 18.82 17.96 18.72 17.44 18.1 19.43 17.68 16.71 18.84 17.13 18.23 17.89 18.24 18.21 18.83 17.87 18.38 17.05 17.62 16.7 17.43 18.09 18.45 18.74 18.04 17.89 18.59 18.35 19.45 D3ZN59 Rgd1559962 1 19.409541 498988 - 19.409541 19.410168 similar to high mobility group protein 2 (hmg-2) None None None None 17.5 17.43 18.6 17.29 17.7 18.12 17.59 16.9 17.89 17.28 17.14 18.28 16.58 18.47 17.63 17.04 17.21 17.69 18.31 18.74 19.52 18.09 17.2 17.92 18.0 17.23 18.65 17.05 17.41 18.27 19.15 D3ZAY7 Epb41l2 1 19.8751861 309557 - 19.8751861 19.943888 erythrocyte membrane protein band 4.1-like 2 None QFLENAKRLSMYGVDLHHAK None None 37478 23.12 20.79 21.94 22.44 22.91 22.54 22.61 22.49 21.23 21.54 23.28 21.47 22.63 21.97 21.62 22.76 23.09 21.93 22.1 21.91 20.99 21.74 22.28 22.89 23.11 22.2 23.06 21.09 21.17 22.91 21.62 D3ZDT1 Epb41l2 1 19.8751861 309557 - 19.8751861 19.943888 erythrocyte membrane protein band 4.1-like 2 None RAKGQALFDRVCEHLNLLEK None None 37478 23.11 20.8 22.03 22.48 22.88 22.53 22.66 22.5 21.33 21.52 23.27 21.48 22.63 21.97 21.71 22.76 23.08 21.88 22.15 21.84 21.01 21.74 22.28 22.81 23.05 22.11 23.13 21.12 21.1 22.92 21.59 D3ZM69 Epb41l2 1 19.8751861 309557 - 19.8751861 19.943888 erythrocyte membrane protein band 4.1-like 2 None RVSRSLDGAPIGVVDQSLMK None None 37478 23.08 20.78 22.03 22.49 22.89 22.54 22.67 22.5 21.34 21.5 23.26 21.49 22.65 21.96 21.71 22.77 23.08 21.88 22.15 21.84 21.01 21.73 22.31 22.81 23.06 22.09 23.11 21.14 21.07 22.88 21.67 Q6JP77 Akap7 1 20.0963611 361458 + 20.0963611 20.215963 a-kinase anchor protein 7 isoforms delta and gamma None QQYLEETQNKKQPGEGNSVK None None 49463 18.7 16.94 17.65 18.73 17.33 18.4 17.24 17.19 19.2 19.46 17.96 18.5 18.97 19.14 18.61 18.16 19.04 18.2 17.88 18.8 19.16 18.92 19.03 19.05 17.35 18.88 19.0 18.71 18.33 18.76 18.68 Q924C3 Enpp1 1 20.6987961 85496 + 20.6987961 20.763907 ectonucleotide pyrophosphatase/phosphodiesterase family member 1 None SGPVFDFDYDGRYDSSEILK None 173335 38151 16.01 14.64 16.37 16.15 15.8 14.05 15.59 16.6 16.0 15.61 15.96 14.33 15.37 15.52 16.77 15.27 14.33 15.98 15.41 16.39 16.27 15.36 15.29 14.9 16.36 16.21 16.61 15.12 16.61 16.17 16.66 O70257 Stx7 1 21.1970821 60466 - 21.1970821 21.237213 syntaxin-7 None VARVRASSRVSGGFPEDSSK None 603217 37823 19.03 17.77 19.98 18.61 17.53 18.59 18.68 18.57 18.59 19.49 17.7 18.53 19.36 19.19 18.1 18.44 18.87 19.11 18.07 19.69 19.67 19.84 19.16 18.49 18.6 18.94 18.44 19.06 19.56 19.16 19.15 P63324 Rps12 1 21.6808531 65139 + 21.6808531 21.68301 40s ribosomal protein s12 None VVKDYGKESQAKDVIEEYFK None 603660 6848 18.02 19.53 19.29 18.83 19.12 20.05 18.43 19.13 20.23 20.43 19.3 20.31 20.37 20.31 21.11 18.98 20.21 18.95 19.26 19.25 21.31 19.82 20.24 20.88 18.18 19.23 19.81 18.83 20.2 19.13 19.26 M0R930 Stx7 1 21.1981261 100910446 - 21.1981261 21.21094 syntaxin-7-like None KIQKDRLVAEFTTALTNFQK None None None 18.87 17.68 19.88 18.3 17.43 18.52 18.68 18.37 18.53 19.29 17.6 18.36 19.19 19.14 17.73 18.29 18.67 19.05 18.05 19.56 19.51 19.66 19.01 18.24 18.41 18.72 18.3 18.7 19.42 18.98 19.02 P05504 Atp6 1 23.4046241 26197 + 23.4046241 23.4053 atp synthase subunit a None FQHWLIKLIIKQMMLIHTPK None None None 16.92 14.56 17.06 16.04 16.78 16.39 16.63 15.42 17.64 18.05 15.44 16.21 16.9 16.63 17.99 17.33 16.24 15.99 16.87 15.45 16.52 17.96 16.94 16.76 16.14 15.65 16.9 16.83 16.37 16.56 17.34 A6JUQ6 Clvs2 1 23.7354261 + 23.7354261 23.84268 clavesin-2 None KQALKDGFPGGLANLDHYGR None None None 18.91 18.66 18.21 18.79 17.4 17.52 18.78 16.93 18.02 17.82 18.5 17.67 17.22 18.46 18.06 18.35 18.82 17.66 18.86 16.46 18.91 18.25 17.88 18.15 18.94 18.08 17.35 17.97 17.53 16.8 17.85 A0A0G2K8M7 Tpd52l1 1 26.1720861 689256 + 26.1720861 26.290703 tpd52-like 1 None EKDELKAELVQLEEEITTLR None None 2468 18.3 16.23 17.55 17.75 18.11 17.77 18.72 18.28 18.58 18.29 16.99 18.17 18.65 18.38 17.34 17.75 17.92 19.57 18.03 17.98 17.95 18.45 18.23 17.22 17.66 18.34 17.58 17.78 18.34 18.78 18.61 D3ZKT8 Hddc2 1 26.2941411 361462 - 26.2941411 26.314406 5'-deoxynucleotidase hddc2 None RKELYELWEEYETQSSEEAR None None 5431 17.82 15.1 16.81 16.35 17.45 18.08 18.37 16.07 16.62 15.8 17.94 17.17 17.53 17.88 16.01 17.76 16.9 17.04 17.31 18.75 17.42 17.58 17.67 17.13 18.5 16.71 16.34 17.81 16.44 17.93 17.4 F1LWN1 Ncoa7 1 26.8566851 498995 + 26.8566851 27.015507 nuclear receptor coactivator 7 None VSPSSSDAEYDKLPDADLAR None 609752 65245 18.37 16.21 19.33 19.06 18.23 17.42 18.72 16.65 18.12 16.7 18.69 16.48 17.94 17.21 16.88 19.14 17.46 17.0 19.48 18.08 16.66 17.98 19.05 19.03 18.31 17.58 16.56 17.63 16.97 17.92 17.56 Q8K3P7 Hint3 1 27.0358771 246769 + 27.0358771 27.045858 histidine triad nucleotide-binding protein 3 None VSSPGTSESRDYDSNCVFCR None 609998 12046 17.48 16.88 19.32 18.1 18.74 19.17 18.97 18.62 17.81 17.52 19.04 17.0 19.14 18.48 17.85 18.24 18.23 18.23 18.13 18.86 17.67 17.77 19.35 18.67 19.54 17.97 17.7 17.24 18.67 18.46 18.08 Q5XIK5 Rnf146 1 28.4651661 308051 + 28.4651661 28.475752 e3 ubiquitin-protein ligase rnf146 None NGWWQYDERTSRELEDAFSK None 612137 12227 16.82 15.06 17.81 16.02 16.91 18.3 16.37 17.0 16.18 16.24 17.73 15.43 17.52 17.52 15.73 16.01 16.83 17.81 17.09 15.66 16.19 16.85 17.28 17.49 16.41 16.76 17.59 15.78 16.21 16.88 16.31 Q6AYG5 Echdc1 1 28.4763631 361465 - 28.4763631 28.506718 ethylmalonyl-coa decarboxylase None EEEVKKILEQFPGGSIDLQK None 612136 23106 19.51 16.97 18.4 19.85 19.3 18.51 20.12 19.34 18.21 18.24 18.97 18.25 18.85 18.71 18.64 19.43 18.18 19.25 19.58 19.33 18.05 18.36 19.06 18.95 20.39 19.54 18.08 19.33 18.21 19.52 19.98 D4A0A1 Soga3 1 28.6416551 108349256 - 28.6416551 28.698313 soga family member 3 None RQQLIEVEIAKQALQNELEK None None None 19.92 17.79 18.79 19.06 18.27 21.08 18.9 19.17 19.38 21.0 18.81 19.35 20.14 19.82 19.99 19.7 20.2 20.22 18.92 18.61 19.43 20.41 20.26 19.07 18.74 20.74 19.04 19.62 21.24 20.12 19.7 D3ZCZ9 Ndufs6 1 29.9688671 100912599 + 29.9688671 29.977419 nadh dehydrogenase [ubiquinone] iron-sulfur protein 6 None EVDHRIIACDGGGGALGHPK None None None 20.4 22.72 20.84 20.0 21.52 20.0 20.41 19.97 19.82 20.16 20.99 19.96 19.68 20.48 20.13 21.65 20.86 20.15 21.13 20.39 20.39 20.35 20.3 21.14 22.23 21.22 20.99 20.34 20.19 20.6 19.94 Q6PEB9 Ccdc127 1 28.9295481 308060 - 28.9295481 28.935893 coiled-coil domain-containing protein 127 None TSADPVAADLEMATGLSDIFK None None 11482 17.48 18.72 17.84 17.25 15.91 17.64 16.42 17.69 16.73 18.88 16.35 18.52 17.07 18.64 17.73 17.25 17.81 17.4 16.61 18.5 18.14 17.57 16.46 17.01 16.43 17.53 18.64 18.6 16.98 17.43 18.28 Q920L2 Sdha 1 28.9359661 157074 + 28.9359661 28.960936 succinate dehydrogenase [ubiquinone] flavoprotein subunit None AGLPCQDLEFVQFHPTGIYGAGCLITEGCR None 600857 3073 19.44 21.82 20.57 21.72 21.35 19.67 21.2 21.34 21.33 21.29 19.86 19.97 21.35 21.91 21.46 20.63 20.78 20.76 20.67 21.45 21.14 19.91 21.35 21.25 22.23 22.27 19.64 21.62 21.06 20.82 20.5 G3V7W1 Pdcd6 1 28.9665191 308061 + 28.9665191 28.982185 programmed cell death protein 6 None TDWQNVFRTYDRDNSGMIDK None None 7880 18.64 16.24 18.69 17.52 18.89 18.59 16.6 17.46 18.91 17.49 18.26 18.2 18.05 16.65 18.41 18.7 18.03 18.08 16.66 18.11 17.74 18.29 18.34 17.79 17.0 17.08 18.45 17.87 19.15 18.03 18.73 Q62825 Exoc3 1 29.0912991 252881 + 29.0912991 29.122162 exocyst complex component 3 None EIVRETQDLIEQGALLQAHR None None 38296 19.13 18.75 18.34 19.27 17.31 19.02 18.54 19.38 18.02 18.2 18.57 18.39 19.28 18.41 19.46 19.04 18.76 18.35 18.97 16.88 17.88 18.09 18.61 18.76 18.79 19.4 18.96 18.66 17.81 17.56 17.78 D3ZQL7 Tppp 1 29.2612561 361466 - 29.2612561 29.281134 tubulin polymerization-promoting protein None VREVHRLIEGRAPVISGVTK None None None 22.25 24.51 21.34 21.67 21.15 23.74 22.71 22.56 21.8 23.55 23.02 22.5 21.91 22.95 20.66 22.23 22.74 23.12 22.26 22.6 22.25 22.84 22.09 20.79 21.3 22.43 22.11 23.1 22.63 22.16 21.45 Q5RK27 Slc12a7 1 29.4726931 308069 - 29.4726931 29.526972 solute carrier family 12 member 7 None GLNRVLLVRGGGREVITIYS None 604879 21312 19.42 20.31 20.64 18.28 18.67 19.98 19.64 19.04 19.89 19.96 20.66 18.14 19.35 20.35 20.4 19.0 19.34 18.82 20.76 18.3 21.05 20.01 19.22 19.76 18.23 19.19 19.21 20.16 19.18 18.98 18.77 D4A416 Clptm1l 1 29.6675461 316916 - 29.6675461 29.68353 cleft lip and palate transmembrane protein 1-like protein None DLMVINRSTTELPLTVSYDK None 612585 12767 15.37 13.19 15.75 15.53 14.43 14.92 15.72 14.26 14.88 14.84 15.67 14.4 15.61 14.75 15.82 14.88 14.39 14.64 16.01 13.71 16.36 14.69 15.29 15.16 15.31 13.53 14.07 14.73 14.55 15.48 15.23 P23977 Slc6a3 1 29.7080131 24898 - 29.7080131 29.750413 sodium-dependent dopamine transporter None FYMELALGQFNREGAAGVWK None 126455 55547 18.73 18.38 17.41 18.19 18.19 18.07 17.27 17.55 18.71 18.07 17.76 17.44 17.33 18.09 17.78 17.92 18.31 16.66 18.17 18.59 17.52 18.68 18.62 17.65 17.75 17.54 17.53 17.66 19.31 18.11 17.41 Q1HAQ0 Lpcat1 1 29.7660721 361467 - 29.7660721 29.816401 lysophosphatidylcholine acyltransferase 1 None LLEFARLVRGLGLKPENLEK None 612040 9871 16.92 18.39 16.78 17.38 16.18 15.69 15.79 16.63 16.37 17.9 15.74 15.86 16.33 15.41 17.81 17.23 16.18 17.13 17.58 15.68 17.05 18.06 15.51 17.39 17.25 17.78 17.19 17.52 16.23 16.1 17.07 D3ZK16 Ice1 1 32.6405991 306665 + 32.6405991 32.679079 interactor of little elongation complex ell subunit 1 None STTNKHLGEYLLRSILSELK None None 18902 18.41 20.32 17.56 18.71 18.97 17.48 17.82 19.56 18.03 18.1 17.8 18.62 18.15 17.55 18.63 19.93 17.17 19.42 19.31 18.09 17.38 18.11 17.85 19.85 19.46 19.93 18.91 17.72 18.22 18.02 18.61 D4A3S8 Nsun2 1 33.662141 361191 - 33.662141 33.685932 nol1/nop2/sun domain family member 2 None TENTESNEKKDGVCGPPPSK None 610916 9817 17.64 15.43 16.94 16.96 16.6 16.53 17.53 15.84 16.5 17.4 16.77 16.68 17.34 17.33 17.6 15.82 16.85 16.47 17.71 16.39 18.7 17.27 16.74 16.38 17.57 17.18 17.36 17.54 15.74 17.34 17.99 P26769 Adcy2 1 34.5887531 81636 + 34.5887531 34.822236 adenylate cyclase type 2 None VMFASIPDFKEFYTESDVNK None 103071 75133 17.6 15.91 17.2 17.36 16.12 16.72 16.44 15.85 16.9 16.91 17.28 17.45 17.17 17.68 16.31 16.73 17.85 16.86 17.57 15.82 18.03 17.44 17.49 17.38 16.88 17.1 17.07 17.62 16.42 16.42 16.33 B2GUZ3 Mthfd1l 1 40.4439621 361472 + 40.4439621 40.63307 formyltetrahydrofolate synthetase None IEIYGKSKAKVRLSLLERLK None None 56706 19.52 19.69 19.99 19.97 20.68 19.43 20.9 19.96 20.28 19.33 19.05 20.59 20.42 20.4 21.04 19.45 18.79 19.89 21.05 19.73 20.43 19.6 19.36 19.55 20.22 20.21 20.7 20.53 18.9 20.2 21.65 Q5QD51 Akap12 1 40.7301011 83425 + 40.7301011 40.819862 a-kinase anchor protein 12 None QMLDKNESCQDETPSAAAQR None None 3740 20.25 18.01 20.12 19.54 20.89 19.75 20.73 20.52 20.14 18.88 19.57 20.26 20.14 19.68 18.91 18.92 19.92 20.0 19.51 21.05 19.98 19.39 20.09 18.85 20.14 19.65 20.15 19.97 19.38 20.81 20.55 E9PU34 Rmnd1 1 40.8598341 292268 - 40.8598341 40.884029 rcg41110 None HHSSVSNEALVPKQDLPQIK None None 5675 18.3 15.84 17.22 17.52 17.52 18.44 16.68 16.85 18.03 18.81 18.0 16.59 17.83 17.39 17.92 18.52 18.14 17.39 17.66 16.54 17.91 17.73 18.33 16.82 17.14 17.2 17.97 17.65 18.39 17.83 17.83 Q6AYT5 Armt1 1 40.8945791 292267 + 40.8945791 40.918302 damage-control phosphatase armt1 None LSKLRNELQTDKPIIPLVDK None None 41557 19.73 16.86 18.03 17.5 18.66 19.86 19.52 18.22 19.01 18.9 17.36 18.66 18.96 18.74 18.66 18.17 18.51 18.65 19.02 17.28 19.27 18.04 18.73 18.13 17.71 18.93 18.8 19.41 16.84 19.08 18.61 Q4V7E5 Mtrf1l 1 42.2105841 361473 - 42.2105841 42.220894 peptide chain release factor 1-like None KERELRDTESLLHDENEDLK None None 5905 14.68 13.86 15.16 15.4 13.28 15.55 14.9 14.99 15.08 14.89 17.34 14.91 16.11 15.81 15.29 15.6 16.03 15.21 15.66 15.03 16.71 15.87 14.64 13.81 15.49 14.87 15.94 16.47 15.89 16.59 16.14 F1M0G0 Rgs17 1 42.2276211 308118 - 42.2276211 42.324609 regulator of g-protein signaling 17, isoform cra_a None IYTLMHRDSFPRFLNSQIYK None None 8242 16.87 15.73 16.67 16.7 15.95 16.53 16.94 15.8 16.16 17.81 16.13 16.15 16.45 15.86 16.64 16.54 17.05 15.67 16.08 17.19 16.52 17.07 17.09 16.74 15.31 17.36 16.64 16.92 14.82 16.45 16.31 A0A0G2JUG1 Krt5 7 132.7583661 - 132.7583661 132.761511 cytoskeletal intermediate filament protein None EIHVKKQIATCKAIAEAEQR None None None 18.04 16.13 17.04 17.55 17.34 16.74 17.82 18.78 18.03 17.23 16.4 17.57 18.01 16.92 17.49 16.37 18.18 18.04 16.76 16.84 17.6 18.01 16.91 16.68 17.89 18.65 16.6 17.36 18.9 16.9 18.65 Q4FZU2 Krt6a 1 132.7584021 683313 + 132.7584021 132.761511 keratin, type ii cytoskeletal 6a None AEAESWYQTKYEELQITAGR None None None 17.88 17.07 16.06 17.76 18.2 17.73 17.69 18.58 16.35 17.87 17.58 17.81 17.21 16.44 17.3 17.1 18.05 18.07 16.61 16.73 16.35 16.89 17.39 16.4 18.03 17.46 17.17 17.11 18.44 17.95 16.44 A0A0G2K5R1 Ddb 1 42.690581 + 42.690581 42.798353 reverse transcriptase domain-containing protein None None None None 17.26 15.28 15.92 15.79 17.58 16.61 16.79 17.94 15.15 17.52 16.28 15.77 16.31 15.77 17.2 16.3 16.21 16.92 16.04 17.2 15.89 16.72 17.66 16.79 17.67 17.46 14.86 17.17 17.19 16.92 16.96 Q80VL0 Ipcef1 1 43.2733191 361474 - 43.2733191 43.346804 interactor protein for cytohesin exchange factors 1 None ADCQGWLYKKKEKGTFLSNK None None None 17.88 18.16 17.47 18.59 17.61 18.13 17.2 17.87 18.78 18.67 18.12 18.91 18.49 18.67 17.38 17.95 18.54 19.16 18.64 17.64 19.54 18.23 18.8 18.04 18.29 18.06 18.41 19.26 18.53 18.14 19.0 Q5SGD7 Cnksr3 1 43.4980161 308113 - 43.4980161 43.59163 connector enhancer of kinase suppressor of ras 3 None LQPYVHKFEREKIDGEQLLK None None 18192 15.64 13.36 15.47 15.12 14.99 16.6 15.53 14.23 15.84 14.56 15.25 16.28 16.06 15.98 14.51 15.83 16.33 14.84 16.46 14.73 16.51 15.82 15.91 15.62 15.16 15.49 15.97 15.86 14.61 16.01 16.16 F1LPT8 Scaf8 1 43.7277951 245926 + 43.7277951 43.810972 sr-related and ctd-associated factor 8 None QQQNLEQLRQQLLEQQQPQK None None None 16.28 14.89 16.93 16.58 16.65 16.03 16.17 16.13 16.66 15.04 15.76 17.31 16.86 17.01 14.94 15.84 17.19 16.27 16.41 17.44 18.18 16.3 16.63 15.75 17.81 16.52 17.16 15.71 18.07 17.01 17.74 Q63623 Scaf8 1 43.7277951 245926 + 43.7277951 43.810972 sr-related and ctd-associated factor 8 None VKTFNSELYSLNDYKPPISK None None None 15.77 16.06 16.82 16.47 16.54 15.92 16.05 16.01 16.55 14.93 15.65 17.19 16.03 16.9 14.9 15.73 17.21 15.92 16.37 17.32 18.06 16.19 16.09 15.64 17.69 16.41 17.04 15.6 17.95 16.2 17.82 D3ZMS5 Tiam2 1 43.9959791 100362710 + 43.9959791 44.119242 tiam rac1-associated gef 2 None PENGFHYVGRESGESHITSR None None None 18.64 17.83 18.57 19.05 18.05 18.56 18.24 18.38 19.16 18.9 18.56 18.36 18.59 18.69 19.08 18.54 18.48 18.88 18.86 17.33 19.56 18.7 19.28 18.98 18.72 18.66 19.27 19.1 17.76 17.9 18.94 F1LNP1 Arid1b 1 45.6112391 282546 + 45.6112391 45.924993 at-rich interaction domain 1b None QAPPYPGMNRTDDMMVPDQR None None 32344 15.99 14.97 16.79 16.49 16.28 15.74 16.1 15.18 17.51 15.15 15.76 16.22 16.4 16.39 16.73 15.74 16.51 15.48 17.18 15.14 17.9 16.48 16.3 16.53 17.06 16.21 15.73 17.38 15.54 16.64 17.71 M0R9L3 Snx9 1 46.4620121 683687 + 46.4620121 46.508617 sorting nexin None KMYGLKSYIEYQLTPTNTNR None 605952 49454 17.64 15.2 18.09 16.63 17.76 16.7 16.41 18.38 17.03 17.36 17.95 16.37 17.5 17.38 18.46 16.93 16.15 17.5 17.36 16.86 17.31 17.04 17.79 17.49 17.49 16.53 18.35 16.9 16.92 17.79 17.87 O55207 Synj2 1 46.5187591 84018 + 46.5187591 46.616012 synaptojanin-2 None SGKIFKDFHEGTINFGPTYK None 609410 117703 16.06 14.38 16.12 16.15 15.62 15.94 15.43 15.54 15.12 14.72 17.02 14.74 15.77 15.77 15.72 15.14 15.3 14.97 15.63 16.68 15.67 15.67 15.72 15.74 17.07 15.51 14.57 15.8 16.52 15.68 14.92 D4ACP8 Serac1 1 46.6221551 499015 - 46.6221551 46.656741 serine active site-containing 1 None RSKESDLRFFLPPPPLPSLK None None None 15.71 16.66 16.83 16.62 16.41 15.15 15.43 16.97 16.72 15.95 15.13 15.43 15.17 16.0 16.15 16.51 15.67 16.02 16.77 14.94 14.77 15.11 15.22 15.81 16.09 16.53 16.77 16.06 16.17 16.4 17.23 B4F7D5 Tmem181 1 46.8425181 502228 + 46.8425181 46.882673 rgd1566403 protein None LNYTQYRVTVGFEHLNQPIK None None None 16.69 16.26 17.07 16.78 16.24 14.61 15.43 16.88 15.32 16.63 15.89 15.65 16.2 15.27 17.52 16.8 16.27 15.91 15.27 15.25 15.09 15.98 15.41 16.66 16.24 16.92 16.8 17.17 14.91 15.74 17.26 Q9Z336 Dynlt1 1 46.887021 83462 - 46.887021 46.893873 dynein light chain tctex-type 1 None NIVKEAIESAIGGNAYQHSK None None 4754 16.73 15.0 17.55 16.28 16.52 16.38 16.08 16.17 16.18 15.3 15.97 15.06 16.27 16.06 16.69 15.31 16.66 16.07 16.37 15.35 17.03 15.6 16.16 16.56 17.05 16.43 17.17 15.38 15.66 16.83 16.8 P31977 Ezr 1 46.9679641 54319 - 46.9679641 47.011505 ezrin None QARDENKRTHNDIIHNENMR None None 55740 20.58 22.93 19.77 20.69 20.28 21.37 21.06 20.06 20.3 20.26 22.36 21.53 19.81 21.1 19.92 21.69 19.97 22.02 21.09 20.65 20.86 20.48 21.13 21.14 20.48 21.14 21.83 19.9 19.65 20.12 20.14 P07895 Sod2 1 47.6383211 24787 - 47.6383211 47.645163 superoxide dismutase [mn] None TNLSPKGGGEPKGELLEAIK None 147460 530 23.65 24.11 23.54 23.57 24.34 22.17 23.01 23.62 22.1 23.58 23.38 22.1 22.37 22.96 22.19 23.23 22.56 23.14 22.45 24.91 21.68 22.27 22.23 22.63 23.55 23.5 23.14 22.71 23.7 23.31 23.01 Q5XI22 Acat2 1 47.6957881 308100 + 47.6957881 47.752821 acetyl-coa acetyltransferase, cytosolic None HPLGASGCRILVTLLHTLER None 100678 6 20.27 18.47 18.87 19.97 20.63 19.29 19.65 20.81 18.17 19.47 20.36 19.28 20.69 19.53 18.72 20.35 19.81 20.06 19.45 21.04 18.26 19.13 20.35 19.96 21.1 20.74 20.01 19.05 19.78 19.18 19.15 P28480 Tcp1 1 47.8290621 24818 - 47.8290621 47.836797 t-complex protein 1 subunit alpha None ILATGANVILTTGGIDDMCLK None 186980 5656 21.92 20.78 20.99 21.33 21.78 20.92 21.66 22.13 20.58 21.57 20.02 20.89 21.74 20.41 20.74 21.2 21.02 20.75 21.25 22.18 20.34 21.25 21.03 20.54 22.18 22.31 20.45 20.82 22.61 21.41 22.34 B2RZ57 Mrpl18 1 47.837171 292244 + 47.837171 47.841987 mitochondrial ribosomal protein l18 None VQPDVETKENEAVAPEFINR None 611831 8566 16.12 18.48 16.07 16.63 15.56 16.98 16.38 15.96 15.92 16.39 15.95 16.65 15.97 17.38 16.01 17.31 17.12 16.79 16.7 15.75 15.87 16.6 16.72 16.04 18.8 17.2 15.95 17.34 17.85 15.95 16.49 G3V824 Igf2r 1 47.9791211 25151 + 47.9791211 48.067496 insulin-like growth factor 2 receptor None IGRPEVFSEDRGCEVTFEWK None 147280 676 17.43 17.9 17.91 18.17 18.23 18.67 18.48 19.48 19.26 19.08 18.59 19.74 19.6 18.99 18.47 19.27 18.47 19.21 17.82 19.29 19.33 18.09 19.39 18.0 17.3 18.47 18.38 18.98 19.68 18.52 18.05 Q01177 Plg 1 48.3251291 85253 - 48.3251291 48.36766 plasminogen None CLKGRGENYRGTVSVTASGK None 173350 55452 17.65 17.41 18.18 19.66 18.83 18.88 19.78 18.81 18.82 18.83 18.78 19.27 19.28 18.15 19.13 18.27 18.54 18.54 17.73 19.09 19.35 17.22 19.33 19.08 17.28 18.5 17.79 18.18 17.98 18.25 18.13 A0A0G2K3R1 Map3k4 1 48.4318741 308106 + 48.4318741 48.519358 mitogen-activated protein kinase kinase kinase 4 None QSPHKDLGKGVEAVEEYSYK None 602425 31346 16.81 16.81 17.7 17.1 16.09 16.39 16.47 15.86 17.39 16.92 17.12 16.35 17.29 16.12 16.72 17.46 17.36 16.42 16.56 15.1 16.36 16.16 15.36 17.12 16.34 15.61 17.37 16.09 15.58 16.6 15.65 Q924S1 Agpat4 1 48.5273241 170919 - 48.5273241 48.633209 1-acyl-sn-glycerol-3-phosphate acyltransferase delta None HADCYVRRIPMEDIPEDEDK None 614795 69293 19.02 15.73 18.75 17.77 18.55 18.79 18.0 18.5 17.07 17.83 18.07 16.73 18.12 17.31 19.03 18.25 18.13 17.46 18.21 16.5 16.98 17.53 18.36 17.73 19.06 17.44 17.46 17.53 18.75 18.51 17.5 A0A0G2JXZ5 Qk 1 1.0 499022 + 1.0 1.0 protein quaking None EISRVRKDMYNDTLNGSTEK None None 11059 20.07 17.6 18.82 18.61 19.41 19.27 18.29 18.79 17.7 17.64 19.62 17.88 17.93 18.24 17.1 18.49 18.89 18.37 18.8 18.44 17.72 18.24 18.7 19.24 19.79 17.79 18.87 16.97 19.08 19.27 18.27 Q91XU1 Qki 1 50.3881391 - 50.3881391 50.495971 protein quaking None None None None 20.07 17.6 18.82 18.61 19.41 19.27 18.29 18.79 17.7 17.64 19.62 17.88 17.93 18.24 16.99 18.49 18.9 18.48 18.82 18.37 17.72 18.24 18.7 19.2 19.79 17.79 18.8 16.86 19.23 19.27 18.27 B5DF80 Pabpc6 1 51.0452651 292295 + 51.0452651 51.048331 polyadenylate-binding protein None DEMNGKDLNGKQIYVGRAQK None None None 18.37 19.46 19.51 19.58 19.49 18.63 18.15 19.81 19.62 20.14 18.63 18.64 20.16 19.86 19.98 19.92 20.16 19.5 18.75 20.41 19.68 18.92 19.89 20.47 19.95 20.75 20.19 18.64 20.35 19.06 19.84 Q9QYJ6 Pde10a 1 51.7701331 63885 - 51.7701331 51.953616 camp and camp-inhibited cgmp 3',5'-cyclic phosphodiesterase 10a None EDILGDERFPRGTGLESGTR None None 4852 19.59 18.67 19.0 18.89 19.24 19.6 18.91 18.86 19.76 18.59 19.12 18.29 18.41 19.08 18.74 18.35 19.52 17.41 19.17 19.16 17.86 20.03 19.23 19.52 18.45 18.48 18.69 19.04 18.17 19.8 18.53 P63031 Mpc1 1 52.4377481 171087 - 52.4377481 52.449369 mitochondrial pyruvate carrier 1 None TNEVAQLIQGGRLINYEMSK None None 9384 18.24 20.51 17.8 18.44 19.33 17.83 17.69 19.51 17.66 19.21 17.76 17.53 17.8 17.37 19.58 19.02 18.25 17.77 18.57 17.19 17.63 17.23 17.77 18.9 18.63 19.65 19.12 18.09 18.26 17.9 17.89 F1M7N7 Rps6ka2 1 52.7712611 117269 + 52.7712611 52.906739 ribosomal protein s6 kinase None SYSVCKRCVHKATDAEYAVK None None None 18.7 18.51 19.17 18.09 19.04 17.77 19.25 18.74 18.25 18.58 18.67 17.2 18.91 18.49 19.14 17.96 19.13 18.64 18.25 17.7 18.54 19.21 16.91 17.92 18.21 19.07 19.55 18.87 17.1 19.12 19.1 F1LT10 Afdn 1 53.9439771 26955 - 53.9439771 54.032395 afadin None ANQPPSPGGKSPYTSGTAAK None 159559 3397 18.91 17.92 19.26 18.6 17.43 18.51 18.74 17.91 18.96 19.12 18.86 18.39 19.08 19.97 18.28 18.67 20.2 19.15 18.67 17.51 19.65 19.17 18.67 18.71 18.34 18.8 19.45 19.32 17.37 18.75 19.24 O35889 Afdn 1 53.9439771 26955 - 53.9439771 54.032395 afadin None AYPIPTQTYTREYFTFPASK None 159559 3397 19.01 17.9 19.23 18.56 17.59 18.61 18.71 18.08 18.9 18.98 18.8 18.27 19.16 20.06 18.17 18.62 20.08 19.27 18.82 17.56 19.87 18.89 18.73 18.74 18.68 19.11 19.44 19.37 17.62 18.77 19.27 M0RCJ9 Mal2 1 85.9006091 100911027 - 85.9006091 85.9294 protein mal2-like None PAVSFPAPRITLPAGPDILR None None None 17.16 19.0 16.63 17.58 16.75 16.7 16.24 17.07 17.41 18.28 16.05 17.8 17.58 17.53 16.85 17.69 18.4 18.33 16.9 16.0 16.87 17.73 16.89 17.55 17.58 17.84 17.16 17.07 18.8 16.11 17.69 D4AE88 Fam120b 1 56.3390241 308218 + 56.3390241 56.385063 family with sequence similarity 120b None YTAESWVCGGQWREYYSALR None 612266 13033 17.67 19.34 18.29 18.15 17.13 16.91 17.42 18.19 16.75 17.79 17.63 16.43 17.56 16.77 19.03 17.75 18.05 17.08 17.51 17.22 17.24 18.03 16.82 18.39 17.98 18.97 18.64 17.63 16.27 17.21 18.11 P18421 Psmb1 1 56.4424351 94198 - 56.4424351 56.461702 proteasome subunit beta type-1 None ALRICIVTKEGIREETVPLR None 602017 2087 20.62 18.62 20.42 20.89 20.47 19.17 20.14 21.18 19.27 18.95 19.76 19.8 20.39 19.42 20.37 19.97 19.03 20.18 20.11 21.31 19.74 18.92 19.52 20.49 21.3 21.12 20.33 18.8 20.45 20.25 21.12 Q6PDW4 Psmb1 1 56.4424351 94198 - 56.4424351 56.461702 proteasome subunit beta None None None None 20.62 18.62 20.42 20.89 20.47 19.17 20.14 21.18 19.27 18.95 19.76 19.8 20.39 19.42 20.37 19.97 19.03 20.18 20.11 21.31 19.74 18.92 19.52 20.49 21.3 21.12 20.33 18.8 20.45 20.25 21.12 D4AAG9 Chd1 1 56.6640631 308215 + 56.6640631 56.726848 dna helicase None RRLEEEERQKELEEIYMLPR None 602118 37462 15.5 14.59 16.47 16.78 16.14 16.7 17.15 16.38 16.04 15.25 16.35 16.24 15.71 15.22 15.87 15.45 16.8 15.17 16.25 16.23 16.41 16.0 15.97 14.31 16.46 15.67 15.75 16.46 16.49 16.14 16.99 Q5XI34 Ppp2r1a 1 60.5402241 117281 + 60.5402241 60.559447 protein phosphatase 2 (formerly 2a), regulatory subunit a (pr 65), alpha isoform, isoform cra_a None RAAASKLGEFAKVLELDNVK None 605983 68559 22.39 23.99 22.13 20.87 21.39 22.23 23.06 22.14 21.78 22.93 20.98 21.65 21.95 22.87 20.3 21.51 22.17 22.51 22.33 22.64 22.75 22.99 21.99 21.66 22.14 22.87 20.68 22.56 22.13 21.78 21.67 P29314 Rps9 1 65.4806131 103689992 - 65.4806131 65.548862 40s ribosomal protein s9 None LLTLDEKDPRRLFEGNALLR None None None 19.64 22.08 21.18 20.65 18.83 20.29 19.06 20.43 21.17 21.4 21.24 19.84 19.89 20.3 21.69 20.24 20.48 20.27 20.1 19.86 21.79 20.85 20.04 21.36 19.23 20.43 21.05 19.33 21.16 19.64 21.09 G3V7N6 Mboat7l1 1 65.5252591 103689982 + 65.5252591 65.539536 membrane-bound o-acyltransferase domain-containing 7-like 1 None AGGGPTLQCPPPSSPEIAASLEYDYEAIR None None None 17.27 14.08 16.54 15.59 15.36 16.08 16.5 16.47 15.75 17.0 15.78 15.26 16.84 16.52 16.57 15.57 16.66 16.23 16.6 15.67 17.44 17.46 16.73 15.92 17.31 17.36 16.24 16.41 17.09 16.51 16.43 D3ZUV9 Cnot3 1 65.556011 308311 - 65.556011 65.572352 ccr4-not transcription complex, subunit 3 None KKLQRLRDQIKTWVASNEIK None None None 17.14 15.48 17.89 17.55 17.22 16.29 16.0 16.7 17.2 16.13 16.73 17.37 17.05 17.1 18.33 16.52 16.71 16.87 17.38 16.59 17.85 17.29 16.84 17.21 18.45 16.59 16.86 18.21 17.19 17.5 18.44 D3ZI68 Prpf31 1 65.5758881 292536 - 65.5758881 65.587561 pre-mrna-processing factor 31 None RISKTLQRTLQKQSVVYGGK None None None 17.51 16.94 18.26 17.37 17.41 16.88 16.84 17.0 17.57 16.4 17.47 17.05 17.45 17.37 18.13 16.98 17.31 17.18 18.32 16.44 18.95 17.71 17.11 18.08 17.88 17.97 18.42 16.97 17.22 17.6 19.05 Q8VHW5 Cacng8 1 65.7553351 140729 - 65.7553351 65.775567 voltage-dependent calcium channel gamma-8 subunit None GSGSSEKKDPGGLTHSGLWR None 606900 12894 18.46 17.8 17.44 17.16 17.51 18.48 16.43 17.44 17.14 17.87 17.26 17.89 17.65 17.47 17.68 19.15 17.7 17.9 18.07 16.79 16.96 17.19 18.14 18.27 17.7 18.68 17.87 17.66 18.24 16.79 16.97 P63319 Prkcg 1 65.8328681 24681 - 65.8328681 65.859351 protein kinase c gamma type None LTKHPGKRLGSGPDGEPTIR None 176980 20602 19.89 21.44 21.46 20.48 21.44 22.55 22.15 21.25 22.27 21.58 20.36 22.45 22.3 21.8 21.57 22.11 22.46 21.2 22.03 20.38 22.49 21.31 22.01 20.86 20.43 21.44 21.11 22.33 21.35 21.11 21.65 Q6VBQ5 Myadm 1 65.864191 369016 - 65.864191 65.872535 myeloid-associated differentiation marker None TRARPGEITGYMATVPGLLK None 609959 9668 17.13 14.65 16.82 16.37 16.07 15.77 15.63 16.69 16.99 17.69 17.1 16.23 17.2 17.69 16.19 15.55 17.64 17.2 16.28 15.43 16.38 16.97 17.18 16.69 16.66 16.62 16.49 16.13 18.4 17.24 16.9 D3ZNQ6 Ube2m 1 73.6625761 361509 + 73.6625761 73.666112 ubiquitin-conjugating enzyme e2m None KASAAQLRIQKDINELNLPK None 610893 6382 20.72 18.11 19.62 19.19 19.54 20.52 20.82 19.37 18.92 20.05 19.86 18.89 20.52 19.91 18.89 19.79 20.5 19.96 19.53 21.43 20.96 20.87 20.25 20.3 20.3 21.66 19.59 20.65 18.76 20.68 20.18 B2RZB5 Chmp2a 1 73.6600461 365191 + 73.6600461 73.66243 charged multivesicular body protein 2a None KKAEATASALADADADLEER None 610893 6382 18.64 16.32 18.13 19.37 18.56 18.04 17.42 19.11 16.78 16.68 17.79 17.99 18.4 18.47 16.98 17.49 19.16 18.74 17.31 18.28 16.45 17.57 18.27 18.31 19.22 19.21 18.53 16.84 19.48 18.57 18.73 O08629 Trim28 1 73.6527091 116698 - 73.6527091 73.659379 transcription intermediary factor 1-beta None LLPCLHSACSACLGPATPAAANNSGDGGSAGDGAMVDCPVCK None None 21175 18.67 18.91 20.19 19.65 19.24 18.51 18.57 19.31 20.26 19.09 18.48 19.57 19.95 19.9 20.42 19.06 18.72 19.63 20.49 19.48 21.31 19.82 19.63 19.35 20.29 20.04 20.89 19.85 19.71 19.8 20.91 B0BN81 Rps5 1 73.5387761 25538 - 73.5387761 73.543072 40s ribosomal protein s5 None TRIGRAGTVRRQAVDVSPLR None 603630 783 17.0 19.29 18.47 17.8 17.58 19.36 17.08 18.45 19.38 19.49 18.7 19.15 18.44 19.38 18.5 17.62 19.14 18.78 17.61 18.42 20.11 18.95 19.19 19.31 16.75 17.88 19.14 17.63 19.24 17.93 18.03 P24050 Rps5 1 73.5387761 25538 - 73.5387761 73.543072 40s ribosomal protein s5 None TRIGRAGTVRRQAVDVSPLR None 603630 783 17.94 20.03 18.46 17.14 17.02 17.5 16.41 17.98 18.68 19.61 17.77 17.95 17.11 18.49 18.08 17.62 18.58 18.08 17.02 17.91 19.34 18.61 17.44 18.69 16.57 17.92 18.65 17.16 18.83 17.41 17.9 A0A0G2JUW8 Lnpep 1 58.2665451 108348118 + 58.2665451 58.31838 leucyl-cystinyl aminopeptidase None KSSVPTEEGLIQDEFSESVK None None None 18.26 16.54 18.89 18.49 18.61 16.87 17.6 18.03 19.16 17.58 17.15 18.2 17.9 17.86 18.74 16.9 16.66 18.42 18.5 17.82 19.39 17.53 17.99 17.79 18.49 17.27 17.72 17.72 19.64 18.75 19.13 M0R904 Zfp773-ps1 1 66.7643561 + 66.7643561 66.768482 zinc finger protein 773, pseudogene 1 None KHSRSLVGHQRLHTGEKPYK None None None 19.11 16.4 17.43 18.79 18.07 18.91 17.15 17.92 18.38 18.68 17.76 18.63 18.68 17.44 19.4 18.04 18.61 17.61 18.39 17.37 18.44 19.78 19.02 18.84 18.38 18.2 18.95 18.08 18.41 18.26 18.82 D4AB33 Peg3 1 67.1100281 103691034 + 67.1100281 67.124685 paternally-expressed 3 None GESRESKQDVTFSVPSSSVR None None None 16.61 14.65 16.62 17.22 16.79 15.01 17.04 17.11 15.81 15.96 16.6 15.9 16.62 16.22 16.11 16.74 16.43 16.91 15.35 17.45 14.39 16.7 16.23 16.03 17.03 17.22 16.21 15.28 17.13 17.6 16.78 O88339 Epn1 1 68.7428011 117277 - 68.7428011 68.760507 epsin-1 None EERIRRGDDLRLQMAIEESK None 607262 32172 20.24 19.11 20.25 19.46 18.96 18.94 19.8 19.02 20.61 20.33 19.57 19.7 20.37 20.88 19.0 19.78 19.37 20.14 20.41 20.69 21.1 20.06 20.32 19.98 19.1 20.2 19.27 19.67 20.3 20.23 20.08 F2Z3T9 U2af2 1 68.7613861 308335 - 68.7613861 68.778506 u2 snrnp auxiliary factor large subunit None PNYLNDDQVKELLTSFGPLK None None None 19.51 17.72 20.08 19.35 19.34 18.87 17.94 18.7 20.13 18.35 18.71 19.33 19.72 19.96 18.72 18.7 19.63 19.27 19.25 20.03 21.07 19.1 19.75 20.0 20.13 19.09 20.17 18.47 20.3 19.84 20.28 D3ZI74 Nat14 1 68.9106021 361500 - 68.9106021 68.912688 n-acetyltransferase 14 None GSGDVCGVLALAPGANLGDGAR None None 10689 14.1 14.5 14.9 15.96 14.33 16.49 15.81 15.06 16.05 15.92 14.97 15.69 16.08 14.72 16.17 14.77 15.55 15.48 15.22 14.22 16.41 15.57 16.21 14.49 14.17 14.85 15.78 15.98 15.15 15.08 14.86 M0RAK2 Isoc2b 1 68.9402911 684270 - 68.9402911 68.957195 rcg22622 None STSESLILQLVRDAAHPQFK None None 86122 15.55 17.09 16.21 17.46 17.92 18.15 17.2 16.94 17.34 16.84 16.71 18.04 17.81 17.09 16.6 15.5 16.24 18.21 16.86 18.44 16.75 17.6 17.44 16.63 16.41 16.96 17.52 16.77 18.1 17.0 17.27 Q5U3Z3 Isoc2b 1 68.9729881 361501 + 68.9729881 68.993758 isochorismatase domain-containing protein 2 None STSEALTLQLIKDAAHPQFK None None 85975 16.98 17.02 16.5 17.4 18.1 18.3 17.58 16.93 17.23 15.96 17.17 17.89 17.58 17.4 18.66 15.87 16.26 17.07 16.75 18.09 17.3 17.98 16.65 16.41 18.11 17.47 16.79 17.2 18.58 17.32 19.42 D3ZPJ0 Shisa7 1 68.9940261 691429 + 68.9940261 69.012943 shisa family member 7 None RMDGWGGPEELGLAPAPNPR None None None 17.63 18.01 16.64 17.16 17.3 17.24 16.69 17.49 17.18 16.7 17.23 17.68 16.91 17.27 17.46 18.16 17.11 17.31 18.11 15.61 16.78 16.63 17.15 17.77 16.9 17.43 17.47 17.12 16.74 16.12 16.24 D3ZJD3 Rpl28 1 69.0521491 - 69.0521491 69.054385 60s ribosomal protein l28 None None None None 20.25 21.6 20.4 20.93 19.93 20.05 18.97 20.12 20.68 20.67 20.58 20.82 19.52 20.46 21.59 20.32 20.85 20.08 19.64 19.43 20.45 21.18 19.6 21.35 19.65 20.89 21.15 19.3 20.63 19.61 19.93 P17702 Rpl28 1 69.0521491 64638 - 69.0521491 69.054385 60s ribosomal protein l28 None MAAIRRASAILRSQKPVVVK None 603638 768 19.98 21.32 19.95 20.98 19.77 19.41 18.57 19.96 20.35 20.32 20.03 20.35 19.23 19.78 21.05 19.84 20.11 20.19 19.46 19.22 19.58 20.58 19.13 20.96 19.36 20.35 20.8 18.91 20.18 19.29 19.54 Q642E2 Rpl28 1 69.0521491 64638 - 69.0521491 69.054385 60s ribosomal protein l28 None NCSSFLIKRNKQTYSTEPNN None 603638 768 20.25 21.6 20.4 20.93 19.93 20.05 18.97 20.12 20.68 20.67 20.58 20.82 19.52 20.46 21.59 20.32 20.85 20.08 19.64 19.43 20.45 21.18 19.6 21.35 19.65 20.89 21.15 19.3 20.63 19.61 19.93 B2DD29 Brsk1 1 69.1344961 499073 - 69.1344961 69.159998 serine/threonine-protein kinase brsk1 None LRGMIEVEPEKRLSLEQIQK None 609235 57169 19.94 17.79 18.5 19.91 18.59 19.22 19.04 19.88 19.54 19.86 18.27 19.61 19.91 18.8 18.94 20.39 19.26 19.93 20.32 18.08 18.54 19.53 19.92 19.68 19.13 20.74 19.21 19.44 19.72 19.63 19.37 Q6IMX7 Hspbp1 1 69.1656431 246146 + 69.1656431 69.189057 hsp70-binding protein 1 None VLSQATPPTAGEAELATDQQER None 612939 40827 17.48 14.75 18.22 16.42 16.62 18.19 17.59 16.41 16.49 16.75 18.15 16.76 17.17 17.26 16.42 15.67 17.84 17.5 17.0 16.29 17.58 18.14 17.62 17.19 16.74 16.2 15.55 17.27 16.94 17.41 17.12 A0A0G2JTK4 Ppp6r1 1 69.1897851 361502 + 69.1897851 69.217588 protein phosphatase 6, regulatory subunit 1 None VAEPLAPCQALVSVADVQATLHGMR None 610875 None 17.84 15.11 16.92 16.4 16.44 17.67 16.13 16.91 18.57 17.05 18.04 17.21 17.57 17.78 16.37 16.51 16.71 18.28 17.93 16.21 18.31 18.05 17.82 16.86 16.91 16.34 17.54 17.56 18.12 17.67 17.62 P47861 Syt5 1 69.2773521 54309 + 69.2773521 69.285067 synaptotagmin-5 None VQPEIEELDPSPSMPGQQVLDK None 600782 55722 22.07 20.83 21.79 21.34 20.84 21.63 21.81 21.37 22.76 22.78 20.78 21.55 22.01 21.68 21.97 21.87 22.18 21.09 21.28 21.65 22.16 21.82 21.71 21.37 20.28 21.42 21.62 22.14 21.09 21.09 21.58 A0A0G2K4R1 Ppp1r12c 1 69.320351 499076 + 69.320351 69.3432 protein phosphatase 1 regulatory subunit None DPSRRPRVPGVENAEGPAQR None 613245 75071 18.82 15.71 18.39 16.78 18.42 18.11 17.56 18.36 17.67 17.19 18.41 16.92 18.67 18.68 16.36 18.4 17.99 19.28 18.27 18.17 17.38 17.84 18.13 19.48 19.39 19.16 17.31 17.33 18.66 18.52 18.29 D3ZFR9 Rdh13 1 69.3731231 361504 + 69.3731231 69.401447 retinol dehydrogenase 13 None KATIPGRTVIVTGANTGIGK None None 121782 16.03 17.03 16.79 17.08 15.86 15.91 16.41 16.24 15.15 15.3 15.94 15.89 16.44 15.87 17.34 15.68 16.82 15.89 16.39 14.75 15.64 16.23 15.32 16.41 16.26 16.9 16.33 15.05 16.7 16.12 17.48 P0C5X8 Ttyh1 1 70.0533251 292597 - 70.0533251 70.07184 protein tweety homolog 1 None AWALFPPSDDYDDTDDDDPFNPQESK None 605784 10779 20.59 20.59 20.07 19.57 19.62 20.08 20.27 18.55 19.4 20.04 19.01 20.86 19.74 20.82 20.19 19.31 21.19 19.39 19.58 19.63 21.13 19.9 18.97 19.31 19.51 20.01 18.93 19.97 21.09 19.69 20.78 A0A0G2JY20 Selenow 1 76.5994431 25545 - 76.5994431 76.604481 selenoprotein w None RGDGYVDTESKFRKLVTAIK None 603235 2263 18.58 16.91 18.57 17.22 18.79 19.11 18.4 18.22 18.51 19.47 18.3 17.76 18.85 18.16 18.19 17.94 17.02 18.04 18.53 18.66 18.14 17.87 18.77 16.43 16.48 17.02 19.4 18.02 18.05 18.27 17.24 Q4V8H8 Ehd2 1 76.640481 361512 - 76.640481 76.658747 eh domain-containing protein 2 None SLKPKLLEALDEMLTHDIAK None 605890 22825 19.59 18.22 20.4 18.83 19.5 18.98 20.62 21.54 20.07 19.84 21.09 18.3 19.27 20.49 19.75 19.24 20.06 19.71 20.4 18.93 19.75 19.27 20.68 19.99 20.07 19.78 19.84 20.41 18.02 20.06 20.73 P54921 Napa 1 76.7872251 140673 + 76.7872251 76.805868 alpha-soluble nsf attachment protein None KDYFFKAALCHFCIDMLNAK None 603215 2839 21.17 23.22 20.73 19.77 20.57 22.09 20.8 20.39 20.79 21.84 20.4 21.31 20.41 21.85 21.12 21.71 20.99 20.9 20.66 21.87 21.61 20.86 20.38 20.52 20.9 21.11 20.14 22.01 21.84 21.03 21.25 B2RYG4 Kptn 1 76.8087461 + 76.8087461 76.816699 kaptin None KHQQGLGDKAGPRPEEPPAS None None None 15.37 13.48 14.53 15.03 15.78 15.8 14.47 15.05 14.97 14.77 15.78 14.7 16.03 14.7 14.15 16.39 16.47 15.52 14.79 16.3 14.47 15.81 15.32 15.2 16.33 15.92 15.44 16.83 14.64 15.57 16.47 P48768 Slc8a2 1 76.8190181 140447 + 76.8190181 76.853081 sodium/calcium exchanger 2 None LVAPLLATVTILDDDHAGIFSFQDR None 601901 27358 20.77 19.26 20.35 20.12 20.75 21.27 21.23 20.16 21.41 20.59 20.36 22.33 21.7 21.52 19.79 21.33 21.21 20.98 21.87 20.26 21.58 20.74 21.44 19.85 19.99 21.26 19.98 22.09 21.41 21.21 21.42 M0RA86 Ccdc9 1 76.9791661 684934 - 76.9791661 76.989569 coiled-coil domain-containing 9 None RAGVGRASRGWEDGAGEQLR None None None 16.96 15.53 17.24 16.71 17.25 17.62 16.6 16.47 18.16 16.4 16.98 17.02 17.1 17.63 16.8 16.31 17.39 17.13 16.03 18.02 18.45 17.01 17.47 16.7 16.54 17.22 16.11 17.64 18.45 17.47 17.94 Q6AXQ0 Sae1 1 77.0309531 308384 - 77.0309531 77.086977 sumo-activating enzyme subunit 1 None FFTGDVFGYHGYTFANLGEHEFVEEK None 613294 4019 18.74 18.32 19.06 19.16 19.13 19.01 20.03 18.83 19.79 18.17 18.41 20.08 19.29 19.57 19.02 18.34 17.9 19.79 20.06 19.65 20.91 19.29 19.13 18.39 19.67 19.28 19.39 20.02 18.35 19.69 20.69 D3ZVW3 Zc3h4 1 77.1078051 678741 + 77.1078051 77.143828 zinc finger ccch-type-containing 4 None EYEGDEEEDMGKEDYDDFTK None None None 15.79 14.29 16.48 15.88 16.17 16.08 14.51 15.35 17.04 15.15 15.33 16.5 16.38 16.09 15.38 15.29 15.54 15.95 15.73 16.55 17.61 16.18 16.2 16.22 16.09 15.14 16.5 15.37 17.22 16.3 17.09 P81128 Arhgap35 1 77.2024371 306400 - 77.2024371 77.319298 rho gtpase-activating protein 35 None KQQSQQIATAKDKYEWLVSR None None None 19.16 17.12 18.34 18.3 17.06 17.75 18.61 17.9 18.07 18.04 18.68 17.69 18.97 19.4 18.92 18.88 19.51 17.99 18.95 16.89 18.89 19.24 18.65 18.41 18.72 20.18 19.02 18.94 17.31 18.64 18.56 P63219 Gng5 1 77.2920511 108349548 + 77.2920511 77.292256 guanine nucleotide-binding protein g(i)/g(s)/g(o) subunit gamma-5 None LRLEAGLNRVKVSQAAADLK None None None 17.69 19.92 16.76 18.76 18.53 17.41 18.08 18.93 17.45 18.2 16.7 18.57 17.42 16.9 17.34 18.66 19.48 17.26 18.33 17.43 16.97 16.99 17.18 19.5 18.07 19.16 16.83 17.31 18.05 17.37 18.21 P62744 Ap2s1 1 77.417381 65046 + 77.417381 77.428927 ap-2 complex subunit sigma None FDDDEKQKLIEEVHAVVTVR None 602242 3001 19.41 20.92 19.26 18.8 18.21 20.28 19.38 18.84 19.5 20.59 18.64 19.91 19.49 19.82 17.65 19.68 19.88 19.68 19.68 19.95 20.14 20.41 19.69 18.3 18.22 20.06 19.35 19.89 20.77 18.36 19.03 F1M6V8 Strn4 1 77.4818451 308392 + 77.4818451 77.511858 striatin 4 None QERAKYHKLKFGTDLNQGEK None None 8378 18.54 17.38 18.13 18.13 17.05 18.72 16.73 17.17 18.16 18.47 18.37 18.3 18.4 18.83 17.36 18.67 18.78 18.16 17.82 18.73 19.07 18.53 18.82 18.96 18.26 18.36 18.78 17.81 19.06 17.62 18.19 P63077 Gng8 1 77.5645521 245986 + 77.5645521 77.568371 guanine nucleotide-binding protein g(i)/g(s)/g(o) subunit gamma-8 None THAKDDPLVTPVPAAENPFR None None 7740 16.94 15.15 17.56 17.55 17.03 16.4 16.36 16.61 17.19 17.34 16.47 16.54 16.41 15.42 17.62 16.18 15.83 16.35 16.41 17.63 17.76 17.26 17.23 17.28 16.44 16.27 17.42 16.49 16.01 17.07 17.5 D3ZQN3 Pnma8b 1 77.6223571 308393 + 77.6223571 77.62493 pnma family member 8b None RVLRQMRRLLLDERPMDDFR None None 35491 18.3 16.56 18.98 18.85 17.44 16.9 18.46 17.45 18.32 17.03 17.68 16.97 18.07 18.12 17.11 17.36 16.69 18.42 19.07 18.32 18.51 18.1 18.1 16.97 17.88 18.86 17.52 17.56 19.02 17.95 18.76 P53042 Ppp5c 1 77.690191 65179 - 77.690191 77.714478 serine/threonine-protein phosphatase 5 None ELKTQANDYFKAKDYENAIK None 600658 4550 21.69 18.97 20.49 19.18 20.61 20.43 21.21 20.86 19.6 21.38 20.35 20.01 20.77 20.05 19.35 21.05 20.32 21.1 20.41 22.11 21.08 21.0 21.23 19.69 20.81 22.23 20.98 20.52 20.53 20.95 20.68 F1M4H5 Nova2 1 78.5726791 292681 + 78.5726791 78.607021 nova alternative-splicing regulator 2 None AVMEQSGAWVQLSQKPEGINLQER None None 21296 18.5 20.79 18.72 19.53 18.22 17.58 18.43 18.13 18.82 18.49 17.87 18.01 18.14 19.44 17.99 17.55 18.27 19.01 20.03 18.76 20.18 18.78 18.07 19.54 19.65 20.01 19.58 17.46 18.47 18.15 18.88 D4AAZ8 Irf2bp1 1 78.6527371 308404 + 78.6527371 78.655437 interferon regulatory factor 2 binding protein 1 None CRERLEDTHFVQCPSVPGHK None None 32276 15.06 16.34 15.31 15.61 15.98 15.37 14.91 16.98 16.2 15.56 14.76 16.64 15.74 16.57 15.21 15.14 14.59 16.63 17.11 15.96 16.95 14.82 15.41 15.96 15.16 16.76 16.48 16.58 15.73 16.18 16.08 A0A0G2K1E5 Sympk 1 78.6723791 292683 + 78.6723791 78.700684 symplekin None ARLIMKQVWKYPKVWEGFIK None None 37969 16.75 14.78 16.91 16.02 17.04 17.02 16.11 15.89 16.89 15.54 16.1 16.87 16.97 17.66 16.59 16.1 16.57 17.16 17.57 15.49 18.04 16.58 17.01 16.54 17.84 16.86 17.1 16.41 17.33 17.35 17.69 F1M3D2 Dmwd 1 78.7225831 680252 + 78.7225831 78.728789 dm1 locus, wd repeat-containing None GKAFTDEETETQAGEASWPR None None None 16.19 17.21 18.15 17.69 16.61 17.71 17.31 16.76 17.74 18.04 16.61 18.37 18.29 17.72 17.61 17.41 17.65 18.0 17.64 16.5 18.7 19.03 18.07 18.32 16.42 17.91 16.97 18.4 17.3 16.87 17.08 B5DES0 Snrpd2 1 78.7979931 680309 + 78.7979931 78.801233 small nuclear ribonucleoprotein sm d2 None SEMTPEELQKREEEEFNTGP None None None 19.43 17.83 20.16 19.22 19.29 19.04 17.9 18.59 19.51 18.11 18.75 19.39 19.53 19.84 20.42 18.28 18.64 18.91 19.18 19.56 20.92 19.37 19.49 19.91 20.29 19.2 19.96 18.38 20.28 19.97 20.33 Q6P6T4 Eml2 1 78.8281791 192360 + 78.8281791 78.859341 echinoderm microtubule-associated protein-like 2 None SFGTGKTKEVIFSMEEGSVK None None 8125 20.43 19.12 19.52 19.25 18.92 18.79 18.46 19.56 18.5 19.81 19.96 18.42 18.66 18.58 18.68 19.16 18.9 19.16 17.99 20.58 18.4 19.29 18.5 18.64 18.94 18.31 19.87 18.7 19.03 19.41 18.47 A0A0G2K9C0 Vasp 1 78.9100211 361517 - 78.9100211 78.92494 vasodilator-stimulated phosphoprotein None ENSRGTGGGLMEEMNAMLAR None 601703 7592 17.23 15.14 16.1 16.48 17.24 16.2 17.23 16.76 17.12 16.19 16.73 16.67 16.15 15.28 17.15 17.52 16.39 16.86 15.58 16.89 16.07 16.52 16.18 16.09 15.35 16.03 16.81 16.58 14.79 16.18 17.49 D3ZAQ9 Ercc1 1 78.9967371 292673 + 78.9967371 79.007963 ercc excision repair 1, endonuclease non-catalytic subunit None GLGPQKARRLFEVLHEPFLK None 126380 1501 15.41 17.38 15.44 14.96 15.35 15.41 15.53 17.03 15.61 16.9 14.79 15.86 15.08 14.8 16.39 15.49 15.17 15.43 16.48 14.3 16.3 15.21 14.87 16.48 14.25 15.85 15.24 15.37 15.16 14.62 15.77 D3ZEG9 Ercc2 1 79.0333351 308415 + 79.0333351 79.047112 general transcription and dna repair factor iih helicase subunit xpd None ETDAHLANPVLPDEVLQEAVPGSIR None None None 14.75 15.17 15.75 15.11 16.09 15.41 15.28 15.1 15.06 15.04 14.19 16.12 14.67 14.11 15.94 16.63 15.36 15.02 15.34 13.68 14.94 15.2 14.93 14.17 15.28 13.85 15.93 15.08 15.63 14.8 15.74 Q68G30 Klc3 1 79.0458711 171549 - 79.0458711 79.055411 kinesin light chain 3 None LAVLYGKRGRYREAEPLCQR None 601334 14899 15.09 16.0 16.08 16.09 16.85 16.82 15.73 17.13 16.28 16.83 15.75 16.43 16.65 15.48 15.73 15.61 15.33 17.14 15.78 16.67 16.78 15.77 16.93 17.4 15.51 15.8 17.19 15.91 15.14 15.61 15.78 A0A0G2JSP8 Ckm 1 79.0614641 24265 + 79.0614641 79.071721 creatine kinase None MEKGGNMKEVFRRFCVGLQK None 123310 20432 22.03 20.61 20.72 20.7 20.46 20.45 20.54 21.89 20.11 19.72 21.16 20.29 19.58 19.72 21.92 20.51 20.18 20.19 20.2 19.98 20.66 19.75 20.84 19.68 22.1 19.99 20.17 19.97 21.98 19.98 19.48 P00564 Ckm 1 79.0614641 24265 + 79.0614641 79.071721 creatine kinase m-type None ADRLGSSEVEQVQLVVDGVK None 123310 20432 21.99 20.61 20.71 20.7 20.47 20.44 20.56 21.9 20.11 19.73 21.16 20.3 19.58 19.71 21.92 20.5 20.17 20.2 20.19 19.99 20.66 19.75 20.87 19.67 22.1 19.99 20.15 19.99 21.99 19.98 19.47 A0A0G2JTD8 Mark4 1 79.0754091 680407 - 79.0754091 79.108571 microtubule affinity-regulating kinase 4 None VMVGMGYTREEIKEALTNQK None 606495 57146 16.16 18.77 17.37 17.89 16.57 18.68 17.42 18.0 17.22 18.3 16.85 18.01 18.67 17.91 18.62 18.09 18.56 17.66 18.14 16.14 17.94 17.65 17.42 18.62 17.29 19.13 17.88 17.3 17.9 16.92 18.73 D4A6T9 Mark4 1 79.0754091 680407 - 79.0754091 79.108571 non-specific serine/threonine protein kinase None KLDTFCGSPPYAAPELFQGK None 606495 57146 16.16 18.77 17.49 18.18 16.6 18.52 17.4 18.12 17.32 18.17 17.08 17.99 18.67 17.18 18.59 18.63 18.56 17.66 18.19 16.14 17.27 17.99 17.42 18.68 16.88 19.23 17.86 17.39 17.88 16.92 18.73 B2RYF1 Ppp1r37 1 79.1807951 308398 - 79.1807951 79.212612 protein phosphatase 1 regulatory subunit 37 None TKLTCEGAVAVAEFIAESPR None None 17851 15.48 14.32 15.51 16.02 15.75 16.03 15.71 15.2 16.53 16.39 15.43 16.96 16.55 16.12 16.25 15.4 16.55 15.97 16.68 14.04 17.06 15.86 16.9 14.91 14.58 15.28 15.98 16.85 16.06 15.23 15.44 B2RYF6 Clptm1 1 79.2894711 292696 - 79.2894711 79.321076 clptm1 regulator of gaba type a receptor forward-trafficking None VHSVFEFLAFKNDIQFWNSR None None 37464 17.69 15.56 17.69 17.28 17.03 16.29 17.68 16.97 16.49 17.41 17.78 16.56 17.37 16.68 18.15 15.91 16.68 16.86 17.56 15.59 17.48 18.01 17.45 17.45 17.64 16.27 17.18 16.98 15.54 17.53 17.16 P19939 Newgene_2134 1 79.3470581 108348160 - 79.3470581 79.35034 apolipoprotein c-i None LKEFGNTLEDKARAAIEHIK None None None 18.3 15.34 16.24 18.49 16.59 16.26 17.94 17.63 16.12 16.5 18.15 16.71 17.2 16.34 16.12 16.06 15.99 17.71 16.71 17.46 16.72 16.38 17.23 17.13 16.94 17.33 17.05 15.91 16.19 16.69 17.08 P02650 Apoe 1 79.3539261 25728 - 79.3539261 79.358089 apolipoprotein e None VKAYKKELEEQLGPVAEETR None 107741 30951 20.89 22.54 21.83 23.19 21.32 20.44 21.22 20.93 21.04 20.41 21.19 21.71 21.4 20.27 20.24 21.74 21.49 21.96 20.08 22.24 20.69 21.27 21.29 22.68 21.38 21.82 21.26 20.35 21.16 21.01 21.55 G3V8F5 Tomm40 1 79.3591871 308416 - 79.3591871 79.370712 mitochondrial import receptor subunit tom40 homolog None IHQLSPGLRSKMAIQTQQSK None 608061 101105 18.31 16.62 17.13 18.21 18.49 17.1 17.93 18.27 16.93 18.11 16.83 18.29 17.87 18.17 17.53 18.85 17.7 17.88 19.1 17.25 17.1 17.56 18.15 17.22 19.2 18.78 17.42 18.09 19.02 18.45 19.09 Q75Q40 Tomm40 1 79.3591871 308416 - 79.3591871 79.370712 mitochondrial import receptor subunit tom40 homolog None MAIQTQQSKFVNWQVDGEYR None 608061 101105 18.25 16.33 16.93 18.07 18.38 16.54 17.78 18.19 17.07 17.27 17.03 18.18 18.01 18.0 17.33 18.62 17.52 17.79 18.96 17.11 16.89 17.35 17.92 17.08 19.34 18.56 17.27 17.94 18.87 17.94 19.2 Q5FVC5 Nectin2 1 79.3721251 308417 - 79.3721251 79.40735 nectin cell adhesion molecule 2 None ICTATNAVGTGRAEQVILVR None 600798 86092 16.36 14.77 16.82 16.92 14.56 14.72 16.2 15.95 15.28 15.93 17.16 15.57 16.32 15.88 15.31 15.61 16.74 15.52 14.7 17.1 16.69 16.06 15.86 16.05 16.15 15.37 15.71 17.02 14.67 16.36 16.39 Q9ESS6 Bcam 1 79.4149981 78958 - 79.4149981 79.429452 basal cell adhesion molecule None NSSGTVVNCSARGLPAPIVR None 612773 21149 18.36 15.61 17.65 17.31 17.51 16.38 18.54 18.4 16.92 16.53 18.64 15.89 17.48 16.97 16.46 17.21 15.84 18.02 17.34 18.27 16.37 16.92 18.07 17.55 17.29 17.89 16.28 17.06 16.09 17.65 16.19 Q5PQS6 Smg9 1 79.9889181 365215 + 79.9889181 80.011256 protein smg9 None MKERGGNQTSGIDFFITQER None None None 15.74 16.8 16.1 16.3 16.47 15.05 15.22 16.27 15.61 14.93 15.8 16.57 15.02 15.71 15.64 15.58 15.34 16.04 16.45 14.45 15.53 14.51 14.95 15.01 16.44 14.55 15.31 16.08 16.66 15.39 16.35 Q1WIM1 Cadm4 1 80.0918081 365216 + 80.0918081 80.096723 cell adhesion molecule 4 None ITCRLHQYDGSIVVIQNPAR None None 17063 17.7 19.06 18.23 18.02 19.68 18.84 19.75 19.27 19.33 19.6 18.65 19.67 19.58 19.72 17.81 18.47 19.03 18.27 18.75 20.39 18.92 18.09 18.88 18.32 17.55 18.48 19.41 17.5 19.24 19.21 18.74 D4A7Q6 Zfp428 1 80.0994421 361519 + 80.0994421 80.10887 uncharacterized protein rgd1564862_predicted None APRATQPAGPPAQPCQLCGR None None 18789 13.86 14.3 14.9 16.1 14.88 15.44 15.78 14.66 16.04 16.02 15.1 16.05 16.1 15.35 14.58 14.61 15.38 14.83 16.07 15.94 17.13 15.48 16.2 15.56 13.96 15.08 15.25 15.37 15.14 15.4 15.57 A0A0G2K1U9 Irgq 1 80.1238451 292708 + 80.1238451 80.127681 immunity-related gtpase q None AAHGVLLQALDEMLADAEAVLGPPEHNQ None None 17696 20.22 18.5 17.93 19.3 19.26 19.79 19.94 20.08 17.9 18.97 18.69 19.69 19.94 19.12 18.33 19.41 19.96 19.08 18.42 20.03 16.99 19.54 19.45 19.05 20.44 19.95 18.19 19.84 18.38 19.22 18.75 Q9ESZ0 Xrcc1 1 80.1412741 84495 + 80.1412741 80.168703 dna repair protein xrcc1 None SKLQEPPKGKRKLDLGLEDK None 194360 31368 16.69 17.55 17.21 17.32 17.64 16.06 18.3 17.29 17.18 15.32 15.89 16.36 15.95 16.29 16.25 16.08 16.15 16.72 17.63 15.87 16.75 15.95 16.13 16.32 18.24 16.58 15.99 17.12 16.02 16.25 16.86 B0BNJ4 Ethe1 1 80.1840141 292710 + 80.1840141 80.199128 ethe1, persulfide dioxygenase None VEEERTLNPRLTLSCEEFIK None 608451 8622 17.4 18.46 17.08 17.46 17.43 17.13 18.17 16.74 18.11 18.43 17.17 18.93 17.78 18.22 17.08 18.47 17.62 17.21 17.28 19.53 18.3 17.94 17.39 17.02 16.34 17.44 17.72 18.37 17.48 18.43 17.15 Q9Z1I6 Arhgef1 1 80.5036291 60323 + 80.5036291 80.520953 rho guanine nucleotide exchange factor 1 None TVGTPGQDNPGVSLHPLSVDSLDSR None 601855 3454 16.85 14.4 16.64 16.94 15.67 16.68 16.59 16.64 15.58 15.58 18.0 15.75 15.54 16.32 16.71 16.13 16.39 16.26 16.6 14.92 15.71 16.3 16.75 15.58 15.75 15.61 16.64 16.22 15.86 17.17 16.3 O35394 Rabac1 1 80.5640151 83583 - 80.5640151 80.567171 prenylated rab acceptor protein 1 None KDQQKDAEVEGLSATTLLPK None None 38182 17.15 14.41 16.68 16.43 15.1 16.64 15.91 15.54 16.27 15.59 17.58 17.85 17.03 16.68 17.8 16.3 16.51 16.09 15.65 16.21 17.62 16.89 16.57 17.79 16.53 15.33 15.48 16.31 17.15 17.17 16.53 P06687 Atp1a3 1 80.5727971 24213 - 80.5727971 80.60192 sodium/potassium-transporting atpase subunit alpha-3 None DRCATILLQGKEQPLDEEMK None 182350 113729 23.76 25.68 24.58 25.26 25.83 25.2 25.77 25.53 25.56 26.48 25.11 25.22 25.71 25.06 25.14 25.0 25.92 24.38 24.48 25.36 24.24 24.6 26.11 24.38 23.94 24.85 24.1 25.5 25.61 24.71 23.98 Q63273 Grik5 1 80.6058931 24407 - 80.6058931 80.667072 glutamate receptor ionotropic, kainate 5 None RLALALAREQINGIIEVPAK None 600283 1578 16.38 14.26 15.21 17.2 15.16 15.59 16.16 16.84 16.82 16.13 15.76 15.61 16.01 16.2 15.51 15.45 15.63 15.56 17.0 15.36 15.69 15.48 16.74 15.42 16.21 16.05 15.15 16.1 17.08 15.8 15.77 P18265 Gsk3a 1 80.8158511 50686 - 80.8158511 80.825691 glycogen synthase kinase-3 alpha None PSSRLSPLEACAHSFFDELR None None 88581 19.33 21.91 18.93 19.37 18.65 19.48 19.71 19.3 19.33 19.69 18.78 19.67 19.22 20.08 19.64 19.42 19.44 19.74 20.28 19.08 20.43 19.59 19.13 20.14 19.44 20.77 20.02 20.15 17.91 19.01 19.17 D4A853 Cic 1 80.86921 308435 + 80.86921 80.880535 capicua transcriptional repressor None KPFPTSGRAEASSNDTVGAR None 612082 87637 14.73 14.65 15.6 15.73 15.49 15.0 14.35 14.25 14.5 15.4 16.28 15.33 14.79 16.18 14.43 15.21 14.51 15.47 16.14 15.61 15.3 16.0 16.19 16.21 15.03 14.41 16.28 14.75 15.32 15.91 16.37 O35263 Pafah1b3 1 80.8811261 114113 - 80.8811261 80.883893 platelet-activating factor acetylhydrolase ib subunit alpha1 None STQHVLWRLENGELEHIRPK None 603074 1933 17.55 19.29 19.21 17.99 17.42 18.48 19.05 19.19 17.64 17.36 18.98 17.24 17.11 17.09 17.38 17.43 17.58 18.01 17.11 18.61 17.75 18.0 16.86 17.56 16.87 18.12 18.25 17.66 16.8 17.61 17.98 Q9QYP0 Megf8 1 80.9025751 114029 + 80.9025751 80.951613 multiple epidermal growth factor-like domains protein 8 None HVDRRVWTTLKGRDGLQGPR None 604267 15988 15.67 13.68 14.57 14.56 14.29 15.14 15.95 14.73 16.6 15.92 14.24 15.46 15.8 16.47 14.94 15.62 15.7 14.22 16.14 15.24 15.95 16.55 15.68 14.72 14.81 15.87 14.23 16.15 16.4 15.39 15.77 P15304 Lipe 1 80.9656281 25330 - 80.9656281 80.98431 hormone-sensitive lipase None SVSEAALAQPEGLLGTDSLK None 151750 3912 16.03 17.87 16.54 15.92 17.21 15.66 16.18 17.36 14.97 15.67 17.57 16.07 15.55 15.45 15.42 16.74 16.57 15.95 16.49 16.85 14.79 15.65 15.58 15.4 15.59 16.65 15.87 16.6 16.29 16.04 15.49 P11960 Bckdha 1 81.1389331 25244 - 81.1389331 81.16794 2-oxoisovalerate dehydrogenase subunit alpha None LERTDLVFGQYREAGVLMYR None 608348 569 18.74 18.28 18.74 18.69 19.67 16.33 17.89 18.03 17.85 18.4 19.41 17.81 17.94 19.26 18.38 17.57 18.11 18.1 17.88 19.33 18.8 17.49 18.47 18.35 19.27 17.79 19.17 16.98 18.98 18.86 18.69 D4A4L2 Ccdc97 1 81.2192311 292724 - 81.2192311 81.226986 coiled-coil domain-containing 97 None EEDQRSDKDLEAWVPDSEER None None 32701 16.37 13.47 16.34 14.92 15.3 15.66 16.28 15.81 14.99 14.41 16.05 14.78 14.91 14.34 14.87 16.86 15.4 15.55 15.13 15.29 14.64 15.33 15.83 14.7 16.33 14.78 14.09 15.58 16.3 15.9 15.69 D4A962 Hnrnpul1 1 81.2284051 361522 - 81.2284051 81.262593 heterogeneous nuclear ribonucleoprotein u-like 1 None GYGGTGKKSTNSRFENYGDK None 605800 31419 17.73 16.87 19.12 17.96 17.81 17.65 16.97 17.67 18.56 17.09 16.89 18.22 18.09 18.27 17.98 17.31 16.81 18.89 19.13 17.62 19.84 17.97 17.99 18.76 19.0 17.57 19.14 16.83 18.57 18.34 19.6 P51146 Rab4b 1 82.4613971 50866 - 82.4613971 82.472688 ras-related protein rab-4b None FAQENELMFLETSALTGENVEEAFLK None 612945 100632 21.29 22.79 20.95 20.53 20.57 20.41 21.64 21.52 21.72 22.07 20.71 19.7 20.33 19.89 20.24 21.83 19.64 22.12 21.03 21.52 20.23 20.84 20.09 20.29 20.15 21.16 19.5 21.15 21.76 19.96 20.74 Q5U214 Snrpa 1 82.4817721 292729 - 82.4817721 82.490393 u1 small nuclear ribonucleoprotein a None AVQGGAAAPVVGAVQPVPGMPPMTQAPR None 182285 3380 19.04 18.35 19.56 19.09 19.09 18.33 17.72 19.33 19.54 18.72 18.51 19.09 19.44 19.74 19.05 18.08 19.44 19.06 18.69 20.03 20.72 19.33 19.22 19.84 20.1 19.76 20.25 18.75 20.02 19.8 20.54 Q6AY19 Coq8b 1 82.5266591 308453 + 82.5266591 82.549182 atypical kinase coq8b None FGASRAFGTEFTDHYIEVVK None None 86731 16.55 16.82 15.84 17.4 16.65 16.1 17.36 16.46 15.97 16.35 16.76 16.37 17.59 16.43 17.16 17.21 17.04 16.72 16.35 16.27 16.11 16.96 15.9 16.71 17.62 17.62 17.6 16.55 15.88 16.21 18.21 A1L1I3 Numbl 1 82.5500551 292732 + 82.5500551 82.573788 numb-like protein None DSGERLSHAVGCAFAACLER None 604018 68413 17.14 19.93 17.21 17.96 17.14 18.18 17.87 17.36 17.88 18.91 17.32 18.44 18.52 18.76 17.36 19.03 17.96 18.59 19.43 17.57 18.47 19.23 18.15 18.67 18.77 19.7 18.35 18.95 17.63 17.22 17.54 A0A0G2K677 Sptbn4 1 82.6507521 308458 - 82.6507521 82.737228 spectrin beta chain None PPTPLLGRKFFGDPTELAAK None 606214 11879 20.03 21.6 18.79 19.77 21.03 19.65 19.39 19.99 19.86 20.02 20.33 19.36 19.16 19.82 20.13 20.32 19.97 19.23 19.21 19.89 18.6 18.78 19.4 19.96 20.81 19.83 19.6 19.79 20.35 19.84 19.59 B5DF65 Blvrb 1 82.7387431 292737 + 82.7387431 82.756661 biliverdin reductase b None DLSPTTVMSEGTRNIVAAMK None 600941 573 20.41 22.45 19.82 20.79 20.45 20.77 22.03 22.23 19.92 20.52 21.99 20.58 19.77 20.16 19.56 20.72 20.93 20.93 21.43 19.4 19.92 19.57 20.04 20.68 19.53 21.24 20.1 20.3 19.16 20.28 19.6 G3V8D2 Prx 1 82.7868181 78960 + 82.7868181 82.807154 periaxin None PKIPEMAVPDVHLPDIQLPK None 605725 76542 17.74 14.78 15.89 14.88 16.32 15.8 16.49 14.62 14.99 15.93 16.65 14.79 15.47 15.13 16.58 16.44 15.02 14.95 14.8 16.02 14.49 15.57 15.45 15.26 16.02 14.87 15.27 15.2 14.97 15.48 14.58 Q63425 Prx 1 82.7868181 78960 + 82.7868181 82.807154 periaxin None PKVSEVKLPKIPDMAVPDVR None 605725 76542 17.74 14.78 15.97 14.88 16.32 15.76 16.49 14.62 15.0 15.93 16.63 14.78 15.47 15.13 16.58 16.44 15.02 14.95 14.8 16.02 14.49 15.57 15.45 15.26 15.97 14.83 15.27 15.2 14.97 15.48 14.58 Q5FVH2 Pld3 1 82.8218561 361527 - 82.8218561 82.836319 5'-3' exonuclease pld3 None GAQVRMVDMQKLTHGVLHTK None None 7893 17.99 18.99 17.49 18.19 17.64 17.02 16.92 18.69 17.71 19.18 16.94 17.79 17.35 16.68 17.19 18.5 17.93 17.89 18.21 16.9 16.37 17.42 16.99 19.09 16.73 17.83 18.01 17.23 16.97 16.73 17.06 P47197 Akt2 1 82.8943231 25233 + 82.8943231 82.932767 rac-beta serine/threonine-protein kinase None CLQWTTVIERTFHVDSPDER None 164731 48773 17.38 18.6 17.77 17.33 18.3 17.25 17.93 18.88 18.26 16.87 16.23 18.51 17.38 17.1 18.33 17.97 17.21 17.56 18.82 16.65 17.95 16.75 17.01 17.24 17.88 18.42 18.65 18.74 16.36 17.32 18.78 Q3HSE5 Akt2 1 82.8943231 25233 + 82.8943231 82.932767 non-specific serine/threonine protein kinase None DRARFYGAEIVSALEYLHSR None 164731 48773 17.43 18.57 17.8 17.33 18.3 17.01 18.04 18.88 18.29 16.76 16.41 18.52 17.34 17.1 18.21 17.97 17.19 17.72 18.82 16.6 17.95 16.75 17.04 17.15 17.97 18.43 18.67 18.77 16.39 17.26 18.75 D3ZTK0 Ttc9b 1 82.9534351 361528 + 82.9534351 82.955616 tetratricopeptide repeat domain 9b None MNRCSLQREDSDSGTGGPAR None None 19938 16.72 14.88 15.59 16.09 15.93 16.04 16.1 16.02 16.37 15.66 16.08 17.58 16.92 16.92 15.76 15.95 17.43 16.55 17.09 15.38 17.39 16.77 16.94 15.85 17.02 16.7 16.78 16.74 16.4 16.66 16.64 D3ZG83 Map3k10 1 82.9556771 308463 - 82.9556771 82.974071 mitogen-activated protein kinase kinase kinase 10 None IENHNLADTVLKITDFGLAR None 600137 1834 16.04 17.67 17.18 16.93 16.16 17.32 15.97 15.71 17.24 16.92 17.24 16.6 16.4 17.15 17.2 16.9 17.49 17.37 16.04 16.05 16.97 17.38 16.87 16.23 15.94 17.22 16.16 18.02 17.69 16.21 16.59 Q63570 Psmc4 1 83.3491231 117262 - 83.3491231 83.357497 26s proteasome regulatory subunit 6b None FEKAYKTVIKKDEQEHEFYK None 602707 4744 20.66 19.2 19.44 20.39 19.67 17.95 19.67 20.38 19.01 19.03 19.8 19.22 19.95 19.39 19.66 19.15 20.38 19.33 19.92 18.12 19.11 19.42 19.3 19.32 20.56 20.51 20.31 19.21 18.77 19.24 19.65 P22509 Fbl 1 83.4698331 292747 + 83.4698331 83.478932 rrna 2'-o-methyltransferase fibrillarin None PHRHEGVFICRGKEDALVTK None 134795 1099 18.63 18.05 19.37 18.34 17.87 18.15 17.14 18.54 18.8 17.77 18.76 17.96 18.42 18.27 19.68 17.48 18.42 17.44 19.03 18.4 20.06 19.14 17.75 19.44 18.79 18.3 19.44 18.29 18.06 18.9 20.12 A0A0G2KAP6 Dyrk1b 1 83.4785611 308468 + 83.4785611 83.487169 dual-specificity kinase None IVRSGERWLERYEIDSLIGK None None None 16.55 18.79 16.41 17.13 15.94 17.48 15.55 16.25 17.4 16.15 17.27 17.79 16.14 16.65 17.57 17.23 17.73 17.24 17.05 15.39 17.02 18.08 16.21 17.43 16.59 16.19 16.72 17.48 17.72 16.7 16.65 P0C7J6 Lrfn1 1 83.751511 365222 - 83.751511 83.760873 leucine-rich repeat and fibronectin type iii domain-containing protein 1 None RLTREDDLETCATPEHLTDR None None None 16.83 14.54 15.1 17.11 15.82 16.26 17.22 17.09 16.73 17.67 16.25 16.72 17.21 15.11 15.54 17.82 17.65 15.65 16.14 16.73 16.42 15.53 16.83 14.89 15.78 17.26 15.86 17.15 17.04 16.72 16.71 D4A769 Samd4b 1 83.6894131 308473 + 83.6894131 83.727615 sterile alpha motif domain-containing 4b None QIIITPIKAYSVLQATPTAK None None 35268 15.85 17.59 16.82 15.89 15.21 17.03 16.45 15.37 16.31 16.05 16.71 15.68 15.79 15.68 16.64 16.17 16.37 16.67 16.12 14.93 17.13 16.58 15.55 15.68 14.58 15.57 16.11 16.14 15.69 15.25 15.31 Q4V886 Paf1 1 83.6836221 361531 - 83.6836221 83.689385 rna polymerase ii-associated factor 1 homolog None NYFFIFREGDGVYYNELETR None 170993 2080 15.73 15.96 17.5 16.49 16.0 15.83 15.25 16.4 17.4 15.71 16.05 16.84 16.51 16.84 17.75 15.71 16.51 16.79 16.16 16.23 18.26 17.0 16.68 17.98 16.91 16.15 16.92 15.93 16.91 16.79 18.05 A0A1W2Q631 Rps16 1 83.6431111 140655 - 83.6431111 83.646042 40s ribosomal protein s16 None HCVLQLSGSLSQKLWWLITK None 603675 794 17.19 17.99 17.31 18.85 18.79 18.25 16.71 19.17 18.38 18.37 17.15 19.01 18.42 17.59 19.47 18.82 17.3 17.69 17.66 18.45 16.93 17.44 18.11 19.04 17.0 18.64 18.66 17.21 19.06 17.45 18.34 P62250 Rps16 1 83.6431111 140655 - 83.6431111 83.646042 40s ribosomal protein s16 None MIEPRTLQYKLLEPVLLLGK None 603675 794 20.15 18.28 18.5 20.28 20.06 19.22 18.11 20.45 18.87 18.45 19.02 20.26 19.49 19.24 20.43 20.47 19.49 19.45 18.74 19.67 18.17 19.05 19.21 20.53 20.53 20.89 20.16 18.65 20.35 19.28 20.92 E9PTB2 Supt5h 1 83.5867131 308472 + 83.5867131 83.616891 transcription elongation factor spt5 None QNNIHVKDIVKVIDGPHSGR None 602102 2384 19.3 16.66 19.0 19.4 19.46 18.98 18.76 19.15 18.98 16.66 18.63 17.13 17.76 17.56 19.04 17.06 18.67 18.54 18.95 16.36 18.14 17.33 19.56 18.56 19.15 18.73 19.12 16.34 18.64 18.04 18.38 D3ZJX5 Timm50 1 83.575281 687295 + 83.575281 83.582735 mitochondrial import inner membrane translocase subunit tim50 None VKDISCLNRDPARVVVVDCK None None 57031 19.01 17.5 19.2 19.53 18.45 17.77 18.96 17.87 18.61 18.08 17.52 18.68 19.01 19.24 19.63 18.31 19.06 18.63 19.29 17.07 19.65 19.24 18.99 18.96 20.21 19.41 18.96 18.56 18.7 19.41 19.73 D3ZM09 Sars2 1 84.0288091 292759 + 84.0288091 84.041123 seryl-trna synthetase None KGELRPADLPAIISTWQELR None 612804 6073 16.44 18.42 16.78 16.84 17.13 16.0 17.26 16.29 17.27 18.59 16.32 19.01 18.18 18.2 17.11 18.49 16.9 17.08 17.07 19.47 17.76 17.92 16.06 16.74 17.18 17.06 17.05 19.36 16.99 18.09 18.32 A0A0G2JWM2 Sirt2 1 84.0539361 361532 + 84.0539361 84.076973 nad-dependent protein deacetylase None None None None 22.49 23.5 20.71 22.14 23.32 23.41 22.14 22.67 21.67 22.52 21.88 22.33 21.86 21.63 21.46 22.79 22.61 22.11 21.43 23.11 20.91 21.48 21.97 22.34 22.15 22.42 22.0 20.6 23.59 22.26 21.18 Q5RJQ4 Sirt2 1 84.0539361 361532 + 84.0539361 84.076973 nad-dependent protein deacetylase sirtuin-2 None TGQTDPFLGMMMGLGGGMDFDSK None 604480 40823 22.49 23.5 20.71 22.14 23.32 23.41 22.15 22.67 21.67 22.52 21.88 22.33 21.86 21.63 21.47 22.79 22.6 22.11 21.44 23.1 20.91 21.48 21.97 22.34 22.15 22.42 22.0 20.6 23.59 22.26 21.18 F1LQ48 Hnrnpl 1 84.1008861 80846 + 84.1008861 84.111568 heterogeneous nuclear ribonucleoprotein l None QPAIMPGQSYGLEDGSCSYK None None 1174 20.29 19.15 20.47 20.26 20.34 19.5 18.94 20.11 20.8 19.19 19.07 20.74 20.37 20.29 21.01 19.61 20.17 19.91 20.19 20.5 21.31 20.21 20.25 21.1 21.0 19.82 21.28 19.09 20.43 20.53 21.46 Q62651 Ech1 1 84.1145231 64526 + 84.1145231 84.120797 delta(3,5)-delta(2,4)-dienoyl-coa isomerase None TFTARKMMADEALDSGLVSR None 600696 1069 19.44 20.74 19.01 19.48 19.14 18.56 20.05 20.36 18.78 20.0 18.13 19.22 18.51 18.72 18.56 19.42 19.51 19.64 18.46 20.88 19.32 18.95 18.41 19.11 19.67 20.45 19.54 18.78 18.97 19.66 19.67 A0A0G2K5U9 Actn4 1 84.1827921 63836 - 84.1827921 84.251843 alpha-actinin-4 None HLRRQFASQANMVGPWIQTK None 604638 55857 21.68 19.73 20.6 21.52 20.79 20.53 20.1 21.33 21.34 21.26 21.93 21.17 21.54 21.81 21.33 20.78 20.46 21.62 20.58 21.27 20.69 21.3 21.67 21.52 20.49 21.05 21.07 21.78 20.73 20.95 21.02 Q9QXQ0 Actn4 1 84.1827921 63836 - 84.1827921 84.251843 alpha-actinin-4 None SKGVKLVSIGAEEIVDGNAK None 604638 55857 20.94 19.64 20.52 21.41 20.68 20.4 20.01 21.29 21.25 21.25 21.87 21.11 21.77 21.77 21.24 20.72 20.32 21.59 20.5 21.26 20.59 21.25 21.81 21.43 20.34 20.99 21.02 21.76 20.58 20.71 20.74 Q99MC0 Ppp1r14a 1 84.5834681 114004 + 84.5834681 84.590749 protein phosphatase 1 regulatory subunit 14a None LQRRLDVEKWIDGRLEELYR None 608153 12267 19.14 16.92 17.22 17.8 18.84 19.01 18.38 17.98 17.13 17.94 19.64 17.39 17.77 17.57 16.6 18.42 17.83 18.53 17.51 19.28 16.75 17.7 18.41 18.06 18.33 17.44 18.17 16.51 18.07 18.63 17.86 F1LYG2 Sipa1l3 1 84.6187181 292771 - 84.6187181 84.825903 rcg54282 None RELITLRGSILEDATPTATK None None 77938 16.97 15.57 16.95 16.01 17.09 17.67 16.51 16.24 16.6 15.88 15.38 17.65 16.57 16.36 17.4 18.69 16.36 16.63 17.12 15.78 16.79 16.21 17.38 16.96 17.7 17.34 16.67 17.33 16.75 16.84 17.88 A0A0G2JU77 Eif3k 1 84.2601251 292762 - 84.2601251 84.2705 eukaryotic translation initiation factor 3 subunit k None AQILLKALTNLPHTDFTLCK None 609596 8292 18.54 17.46 17.27 17.65 17.36 17.65 17.99 17.8 17.84 18.14 18.27 17.94 18.58 18.47 18.33 17.14 18.76 18.47 18.21 18.09 19.73 18.39 18.16 18.89 18.7 18.9 17.13 17.85 18.52 18.32 19.05 A0A0G2K5J1 Ryr1 1 84.2926951 114207 - 84.2926951 84.423687 ryanodine receptor 1 RYR-1; Ryr1l None None None None 17.47 18.05 16.27 17.11 17.83 18.08 16.67 17.87 17.95 16.38 16.44 17.82 16.9 16.71 17.78 17.82 17.5 17.11 18.47 15.76 17.36 16.61 16.87 17.53 18.06 17.99 17.38 18.26 17.05 16.3 18.22 F1LMY4 Ryr1 1 84.2926951 114207 - 84.2926951 84.423687 ryanodine receptor 1 None PALRGEGGSGLLAAIEEAIR None 180901 37423 17.47 18.05 16.27 17.11 17.83 18.08 16.72 17.87 17.95 16.38 16.44 17.82 16.9 16.71 17.78 17.82 17.5 17.11 18.47 15.76 17.36 16.61 16.87 17.62 18.06 17.99 17.32 18.18 17.05 16.3 18.22 F1LQ27 Fam98c 1 84.4528081 292764 - 84.4528081 84.456351 family with sequence similarity 98, member c None LTTSAFHWGDRAEAHSEVMK None None None 15.42 15.19 16.37 15.53 15.55 15.29 15.95 15.76 15.69 15.85 16.54 15.84 15.96 16.31 15.47 14.86 15.7 16.3 15.29 17.92 17.33 17.07 15.24 15.4 16.86 17.01 15.5 18.03 15.75 16.79 17.88 A0A096MJ78 Spred3 1 84.4612861 308478 - 84.4612861 84.470249 similar to spred-3, isoform cra_a None GDCKFGLTFQSPAEADEFQK None 609293 28061 15.12 14.3 15.59 15.05 14.19 15.03 14.67 13.26 14.3 15.45 14.81 14.26 14.68 15.2 14.66 14.51 15.37 15.68 13.78 14.21 14.78 16.05 15.42 14.2 14.67 14.64 14.66 14.67 14.73 14.28 14.19 F1LMQ3 Psmd8 1 84.4743791 292766 - 84.4743791 84.481209 26s proteasome non-atpase regulatory subunit 8 None EIAGCIEKAYEKILFAEATR None None 37686 19.33 18.22 19.33 17.57 17.84 19.24 18.02 18.37 17.98 19.17 17.73 18.28 19.12 19.0 19.95 18.33 18.72 19.25 18.35 18.73 20.01 19.83 18.61 19.7 19.47 19.78 19.85 17.88 19.01 18.79 19.47 Q1RP74 Tbcb 1 85.477561 103690005 - 85.477561 85.483318 rcg53953, isoform cra_a None EYEDVSKVEKYEISPEAYER None None None 21.11 21.33 21.73 20.02 19.69 20.32 21.74 21.09 19.81 20.87 20.67 19.36 20.16 19.97 19.19 20.46 20.74 20.48 19.74 21.79 19.18 20.8 19.89 19.72 19.4 20.6 19.79 19.96 20.12 19.7 20.16 G3V9E2 Alkbh6 1 85.5636071 108348106 + 85.5636071 85.568972 alpha-ketoglutarate-dependent dioxygenase alkb homolog 6 None PLIYYVPDFISKEEEEYLLR None None None 16.3 13.46 15.29 16.01 15.88 15.77 16.53 16.49 14.72 13.68 15.39 16.21 15.96 15.52 15.2 15.91 16.16 15.72 15.67 14.59 14.98 14.64 16.29 13.93 16.43 16.53 15.11 16.02 16.09 15.36 15.93 F1LRS5 Aplp1 1 85.696891 502317 - 85.696891 85.707143 amyloid beta precursor-like protein 1 None EKAQQMRFQVQTHLQVVQER None 104775 68447 17.95 19.06 17.34 17.54 17.2 18.94 16.9 17.23 16.22 18.28 17.83 17.17 17.24 17.48 17.13 18.17 18.77 16.66 16.84 18.81 16.59 18.33 17.48 17.74 17.51 18.39 17.0 17.93 18.91 17.41 16.24 D4A9G6 Arhgap33 1 85.7765561 100362311 - 85.7765561 85.787702 rho gtpase-activating protein 33 None SLAGSSPSTRLLTLEEAQAR None None None 16.14 17.12 15.64 16.21 15.39 14.77 16.6 15.94 16.58 16.89 15.5 15.67 15.36 16.03 14.99 16.58 15.82 16.57 16.9 14.88 15.51 15.61 15.35 14.87 15.29 16.23 14.57 16.45 16.71 14.71 15.55 Q7TP17 U2af1l4 1 85.8162911 361542 + 85.8162911 85.818748 splicing factor u2af 26 kda subunit None PVTDFRESCCRQYEMGECTR None None 134014 16.46 15.23 15.28 15.16 15.18 16.75 14.68 15.82 16.38 15.38 15.2 16.85 15.24 16.11 17.2 15.31 15.54 16.19 15.62 16.05 18.04 16.18 15.68 16.7 15.16 16.26 17.17 15.4 15.96 16.06 16.58 D3ZD09 Cox6b1 1 85.8750811 688869 - 85.8750811 85.88242 cytochrome c oxidase subunit None MAEDIKTKIKNYKTAPFDSR None None None 19.52 21.03 20.5 21.03 21.8 20.79 20.72 21.27 21.59 21.82 20.37 21.79 21.85 20.27 20.18 21.77 19.94 21.49 21.79 21.04 20.76 20.65 21.69 20.39 19.57 20.72 20.5 20.49 22.9 20.18 20.65 Q6AXT7 Rbm42 1 85.89861 361545 - 85.89861 85.908555 rna-binding protein 42 None EPEPLPLPLEVVRGLLPPLR None 613232 32579 14.59 16.28 14.41 15.8 14.76 13.88 13.47 15.61 14.56 15.74 13.69 14.47 14.48 14.2 14.57 14.5 13.69 15.41 15.92 14.02 15.42 14.16 14.13 14.48 15.11 15.23 15.33 15.95 15.05 14.07 15.74 P09626 Atp4a 1 85.9616731 24216 + 85.9616731 85.974844 potassium-transporting atpase alpha chain 1 None FASIVTGVEQGRLIFDNLKK None 137216 68081 24.46 26.48 24.27 24.52 24.99 23.63 24.4 25.01 24.51 25.98 23.98 23.76 23.96 24.44 25.26 23.98 25.03 23.5 24.05 23.67 23.3 24.32 23.85 24.47 24.27 24.88 23.1 24.97 25.2 23.91 23.99 Q9ESV6 Gapdhs 1 85.9790971 66020 - 85.9790971 85.99364 glyceraldehyde-3-phosphate dehydrogenase, testis-specific None KAVGKVIPELNGKLTGMAFR None 609169 101265 23.23 22.27 23.28 23.82 24.27 24.71 24.89 23.68 24.26 24.74 23.06 24.41 24.67 24.32 23.3 23.32 23.41 24.2 23.98 23.72 23.93 22.39 24.63 23.8 22.38 23.67 23.77 24.1 22.34 23.89 23.95 M0RCN1 Rpl36 1 86.0625721 100361079 - 86.0625721 86.062953 60s ribosomal protein l36 None THIRAKRKREELSNVLAAMR None None None 18.37 18.18 16.79 18.82 18.48 16.3 16.6 18.54 17.21 17.61 17.78 17.85 18.0 17.45 18.6 18.48 18.47 17.31 18.05 17.42 15.99 17.58 17.44 18.85 19.11 19.22 18.13 16.84 18.92 17.34 18.72 G3V9B3 Mag 1 86.1483321 29409 - 86.1483321 86.16364 myelin-associated glycoprotein None GDNPHVLYSPEFRISGAPDK None 159460 1771 22.64 20.25 20.56 20.71 21.7 20.47 21.33 20.76 20.26 21.93 21.92 19.8 20.41 20.09 19.57 21.48 20.81 21.06 20.42 21.66 19.59 20.56 20.91 20.69 20.41 20.08 19.43 20.02 21.46 20.93 19.24 P07722 Mag 1 86.1483321 29409 - 86.1483321 86.16364 myelin-associated glycoprotein None VLYSPEFRISGAPDKYESEK None 159460 1771 22.49 19.66 20.43 20.47 21.6 20.41 21.14 20.67 20.0 21.57 21.86 19.63 20.21 20.02 19.37 21.21 20.63 20.88 20.24 21.43 19.32 20.28 20.94 20.5 20.37 19.79 19.23 19.83 21.27 20.83 19.3 O08589 Fxyd1 1 86.2871661 58971 - 86.2871661 86.291191 phospholemman None CKFNQQQRTGEPDEEEGTFR None 602359 3691 17.31 15.98 16.62 16.84 17.3 17.47 18.16 17.06 18.4 17.51 17.27 17.21 18.05 18.56 16.63 16.69 16.33 18.35 18.44 18.15 18.78 17.67 17.86 17.51 18.43 18.13 17.13 17.37 18.11 18.58 18.42 Q6P2A4 Lgi4 1 86.2946231 361549 + 86.2946231 86.305944 leucine-rich repeat lgi family, member 4 None GGRFERRTDIPEAEDVYATK None 608303 16408 15.23 14.76 16.37 15.36 15.49 15.63 15.93 15.34 16.5 15.6 15.55 16.06 16.11 16.69 15.02 15.76 15.17 15.36 16.67 17.01 17.56 15.53 15.81 15.81 15.51 15.58 15.75 15.09 17.17 17.04 16.8 Q00954 Scn1b 1 86.3539181 29686 - 86.3539181 86.363739 sodium channel subunit beta-1 None DSETEAVYGMTFKILCISCK None 600235 810 19.08 17.58 18.53 18.36 19.4 19.15 18.65 18.49 19.6 18.54 18.89 20.13 19.68 19.53 19.51 18.69 19.47 18.89 19.03 19.14 19.77 18.78 19.55 18.18 19.11 18.58 18.41 19.99 20.21 19.77 19.85 Q3KR56 Gramd1a 1 86.3669961 361550 - 86.3669961 86.393397 protein aster-a None SLIEKSSWTGIEDYFHHLDR None None None 15.66 13.48 15.97 15.59 15.11 15.11 15.23 14.78 15.48 16.26 14.69 15.04 16.01 15.87 14.7 14.91 16.28 15.56 16.68 14.41 16.93 14.92 15.81 15.63 16.13 15.82 15.74 15.54 15.42 16.04 15.88 F1LS72 Uba2 1 86.7758721 308508 - 86.7758721 86.799898 sumo-activating enzyme subunit 2 None STKKSRLEQVEDQDDVIALD None 613295 4018 19.14 17.68 19.38 19.37 19.24 18.93 19.72 18.87 19.98 18.11 18.54 20.01 19.87 19.46 19.68 18.5 18.67 19.35 20.1 18.79 20.87 19.36 19.56 18.67 20.03 18.94 20.38 19.7 18.33 19.86 20.38 D3ZSC2 Pdcd2l 1 86.8103341 689637 - 86.8103341 86.822721 programmed cell death 2-like None ASKIGGVPDALPAVTAPGPR None None 41861 16.16 15.08 15.95 15.28 15.66 17.53 16.11 15.89 16.24 16.6 16.67 16.9 17.9 17.09 15.74 16.68 15.83 16.99 15.88 18.25 17.7 17.32 16.08 16.18 16.99 15.07 15.62 17.09 17.54 17.42 17.15 Q6P6V0 Gpi 1 86.8282121 292804 - 86.8282121 86.856077 glucose-6-phosphate isomerase None DLAKSRGVEAARDNMFSGLK None 172400 145 24.63 24.53 23.76 23.27 23.94 23.42 24.73 24.6 23.07 24.49 22.54 23.14 23.59 23.59 22.13 24.79 23.83 24.18 23.92 24.71 22.6 23.61 23.18 22.95 24.21 25.31 23.65 23.5 24.04 24.22 23.65 B2GV58 Lsm14a 1 86.9648111 361554 - 86.9648111 87.00933 lsm14a mrna-processing body assembly factor None GPMKFEKDFDFESANAQFNK None None 40537 17.3 15.02 17.53 16.76 16.62 17.28 18.28 16.2 17.47 17.54 18.02 16.79 17.66 17.81 16.07 16.05 16.19 17.91 17.47 18.11 18.74 17.89 17.64 16.44 17.07 15.95 16.07 17.26 17.82 17.72 17.62 Q5I0D7 Pepd 1 1.0 292808 + 1.0 1.0 xaa-pro dipeptidase None NGAVQAGSAVVLQGGEEMQR None None None 17.2 19.5 18.05 17.72 17.56 20.03 19.17 18.28 18.19 19.8 17.7 19.47 19.28 18.53 18.21 19.27 17.72 19.08 18.51 20.44 19.62 19.63 19.37 18.53 18.07 18.69 18.52 17.8 19.05 18.5 18.62 B0K036 Sdhaf1 1 85.5767741 108348111 + 85.5767741 85.577129 succinate dehydrogenase assembly factor 1 None FVRPRGPTEEPVDATAPGNR None None None 14.67 13.36 14.27 15.54 15.73 14.36 15.07 15.31 14.4 14.12 13.59 15.47 15.82 14.89 16.12 15.62 15.64 13.94 14.36 14.55 13.96 13.77 14.92 16.09 16.08 16.02 14.89 14.12 14.69 15.58 15.89 D4A507 Clip3 1 85.5471981 108348122 - 85.5471981 85.5634 cap-gly domain-containing linker protein 3 None LMLSALGLRLGDRVLLDGQK None None None 16.66 18.49 16.07 16.92 16.44 16.62 17.15 16.26 16.65 16.41 15.32 16.75 16.29 16.19 16.58 17.5 17.05 17.81 16.65 15.36 15.87 17.02 16.02 16.9 17.54 17.98 16.2 16.49 16.93 15.94 16.85 Q64537 Capns1 1 85.4484021 100912380 - 85.4484021 85.4538 calpain small subunit 1 None RYSDETGNMDFDNFISCLVR None None None 20.57 18.4 18.73 18.97 19.13 19.59 20.77 20.03 17.9 19.23 20.5 18.96 19.73 19.11 18.48 19.22 19.26 19.34 19.3 20.83 19.24 19.28 18.97 18.47 19.75 19.87 18.85 19.1 19.16 19.37 20.1 D4ADF5 Pdcd5 1 88.305871 108348109 - 88.305871 88.3112 programmed cell death 5 None QREAEMRNSILAQVLDQSAR None None None 20.2 22.11 20.68 20.0 19.5 19.15 20.64 20.19 19.73 20.41 20.62 18.9 19.41 20.29 19.78 18.89 19.52 19.76 19.49 21.65 18.7 20.96 19.18 19.42 20.59 19.56 19.48 19.98 19.98 19.47 19.63 P63116 Slc7a10 1 87.8291761 114518 + 87.8291761 87.845071 asc-type amino acid transporter 1 None GVFWRSKPKCVHRFTESMTR None None 56767 17.76 14.81 17.67 17.21 16.53 16.34 16.37 16.25 16.64 18.11 16.41 15.53 17.04 17.0 16.49 17.52 17.29 16.05 16.57 17.61 16.7 17.33 17.2 16.0 17.0 16.8 17.69 17.23 17.49 17.68 17.12 Q75T81 Slc7a10 1 87.8291761 114518 + 87.8291761 87.845071 asc-type amino acid transporter 1 None GVFWRSKPKCVHRFTESMTR None None 56767 17.08 15.15 16.82 16.68 16.34 16.06 15.82 15.72 15.67 16.88 16.76 15.57 16.67 16.18 16.77 17.27 17.17 15.73 15.61 17.19 16.14 16.82 16.64 17.05 17.1 16.59 17.04 16.16 16.48 17.48 16.31 B5DEP7 Snrpg 1 87.9826731 681031 - 87.9826731 87.983053 small nuclear ribonucleoprotein g None NIGMVVIRGNSIIMLEALER None None None 18.15 17.09 18.59 18.18 18.16 16.65 16.51 18.35 17.48 17.97 16.78 17.87 18.19 17.81 18.85 18.01 17.32 17.56 18.28 18.33 18.57 17.81 18.15 18.92 18.98 18.95 18.99 17.25 18.51 18.6 19.22 D3ZQW7 Ac136661.1 1 88.1406391 + 88.1406391 88.141326 40s ribosomal protein s2 None None None None 18.41 20.67 18.11 18.78 18.31 18.21 17.24 19.04 18.79 19.69 18.12 18.01 18.28 18.07 19.15 18.38 17.98 18.28 18.56 19.11 17.47 19.45 17.98 19.27 18.8 18.83 19.47 17.58 19.22 17.88 18.84 Q6AYD9 Nudt19 1 88.2145011 308518 - 88.2145011 88.226217 nucleoside diphosphate-linked moiety x motif 19 None TECFLSKEIWLAPPQFYEVR None None 13211 18.42 15.99 18.04 17.98 18.37 17.05 17.79 17.69 16.73 16.35 18.01 16.96 16.83 16.73 16.27 17.01 18.17 17.62 17.56 16.88 16.79 16.89 16.95 15.86 18.55 17.29 18.19 17.13 17.4 18.14 17.78 A0A0G2JVS9 Ankrd27 1 88.2512261 361555 + 88.2512261 88.303615 ankyrin repeat domain 27 None QDLQQKDIGVKPEFSFNIPR None None None 15.8 15.25 16.26 16.26 15.94 15.16 16.84 16.61 15.99 16.34 16.73 16.18 16.68 16.17 15.23 15.81 16.96 16.48 16.29 14.71 16.38 15.75 16.63 14.94 15.74 14.8 15.13 16.65 16.31 15.96 15.28 D4A9G5 Dpy19l3 1 88.3503041 308519 - 88.3503041 88.417339 dpy-19-like c-mannosyltransferase 3 None IRQRKETKPVEVSEDFPSPK None None None 15.94 15.41 15.95 16.3 16.42 15.47 15.52 15.49 16.41 14.78 15.87 14.85 15.75 16.61 16.26 16.26 16.75 15.64 16.37 14.68 15.47 15.66 14.61 16.1 16.51 16.1 16.1 16.7 14.54 16.52 15.21 P80349 Fuc2 1 88.4234121 + 88.4234121 88.423479 fuctinin-3 None ELNSNHDGADETSEKEQQEA None None None 16.75 14.5 17.0 16.33 15.44 16.11 16.54 15.43 16.39 15.78 17.23 17.24 16.88 17.2 15.82 16.33 16.06 17.59 16.08 16.72 17.9 17.38 17.04 16.38 16.46 16.42 16.71 16.63 16.28 17.07 17.22 A0A0G2K7W6 Rgd1562402 1 89.5630611 499133 + 89.5630611 89.563503 60s ribosomal protein l27a None FSRRAEEKIKGVGGACVLVA None None None 16.94 17.15 17.34 17.81 17.51 18.19 16.66 18.4 18.3 18.74 18.65 18.47 19.02 19.0 19.17 17.39 18.04 18.17 18.78 16.65 19.04 18.36 19.01 18.93 17.85 18.02 18.95 17.35 18.81 18.02 17.94 D4A234 Uri1 1 90.6463941 308537 - 90.6463941 90.704656 similar to nnx3 None QEKIQHWEKVDNDYSALQER None None None 15.78 13.22 15.73 16.51 15.69 16.14 15.82 14.33 15.42 14.96 15.99 16.2 16.11 14.6 14.38 16.66 16.23 15.92 15.48 15.58 14.3 15.56 15.7 15.49 14.38 15.18 14.6 14.73 16.53 16.18 15.56 D3ZWS2 Cg3740-pa 1 90.8784371 690000 + 90.8784371 90.886582 similar to cg3740-pa None MELPPAEQQKLVNEATAIIR None None 41744 16.72 18.09 15.77 17.24 17.0 15.76 17.46 17.68 16.13 16.26 16.17 16.32 16.47 15.15 16.58 16.97 15.6 17.53 16.71 16.84 15.54 16.23 15.76 15.06 17.98 17.24 16.44 16.9 17.07 15.66 17.51 Q68FU1 Plekhf1 1 90.9086411 308543 - 90.9086411 90.910117 pleckstrin homology domain-containing family f member 1 None WMIKTAKKSFVVSAASTTER None None 11516 15.21 16.69 15.23 15.13 16.14 15.83 15.46 14.74 14.23 14.26 14.83 14.23 14.37 13.42 15.18 15.93 14.52 14.99 15.04 15.42 14.74 14.54 14.35 14.85 16.94 15.37 14.61 15.53 14.31 14.12 15.06 D4A3Q0 Vstm2b 1 92.5920711 361560 + 92.5920711 92.620491 similar to contains transmembrane (tm) region None EGVYECRVSDYSDDDTQEHK None None 10970 15.97 14.24 15.0 15.82 14.1 15.55 15.66 14.56 14.57 15.85 14.89 15.42 15.33 15.33 14.27 15.45 16.14 14.59 14.99 14.64 15.41 15.82 15.07 14.49 14.92 15.68 14.05 15.97 15.2 15.58 13.85 F1LVR0 Iglon5 1 93.8829281 308557 + 93.8829281 93.898753 iglon family member 5 None QLRDGFTSEGEILEISDIQR None None None 16.69 14.54 16.72 16.6 17.08 15.59 15.73 16.57 16.12 15.31 17.07 16.03 16.41 15.4 16.51 17.02 15.29 16.09 16.99 16.51 15.43 15.78 16.36 15.5 17.53 16.12 15.84 17.82 16.91 16.67 18.06 Q68FU3 Etfb 1 93.8518721 292845 - 93.8518721 93.866102 electron transfer flavoprotein subunit beta None LEGDKVKVEREIDGGLETIR None 130410 1503 20.34 20.6 19.17 20.17 21.23 19.79 20.26 21.08 19.33 19.16 19.95 20.7 20.08 19.64 19.75 20.92 19.55 20.58 20.2 20.52 18.94 19.25 18.9 19.99 21.16 20.96 20.27 21.76 18.77 19.91 22.11 B1WBV0 Ctu1 1 94.1154331 292847 + 94.1154331 94.121224 cytoplasmic trna 2-thiolation protein 1 None AAKPPPPGTCSRCGALASNK None 612694 None 14.21 14.68 15.81 14.73 14.1 15.78 14.69 13.26 13.98 13.44 14.92 14.64 14.64 14.95 14.17 13.9 15.56 14.45 14.6 14.06 15.08 15.6 13.85 13.65 15.97 14.21 14.98 15.29 15.17 14.6 14.85 O54854 Klk6 1 94.27891 29245 + 94.27891 94.286138 kallikrein 6, isoform cra_a None EGNDSCQGDSGGPLVCGGHLR None 602652 68279 14.8 14.44 15.35 15.39 17.01 16.83 16.03 16.01 15.98 15.99 15.75 16.59 16.32 15.5 14.82 16.82 16.11 15.91 15.94 15.97 14.87 15.25 16.92 15.83 14.64 15.65 15.94 14.79 16.3 16.4 15.63 Q9WV48 Shank1 1 94.8082761 78957 + 94.8082761 94.855824 sh3 and multiple ankyrin repeat domains protein 1 None HTKTGLKKFLEYVQLGTSDK None None 22949 18.29 18.06 18.34 18.27 18.48 18.3 18.52 18.15 19.43 18.01 17.46 19.84 19.08 19.24 18.74 18.46 18.45 18.69 19.9 17.55 19.67 18.1 18.3 18.93 18.69 18.44 18.84 19.04 17.76 18.77 19.67 A0A0G2JSR2 Syt3 1 94.8812471 25731 + 94.8812471 94.895246 synaptotagmin iii, isoform cra_a SIII None None None None 17.73 17.21 16.97 17.83 18.2 17.16 18.24 17.49 18.13 17.36 16.95 18.06 17.63 17.85 17.79 19.08 17.69 17.54 17.61 18.13 16.59 17.34 17.08 17.44 17.85 19.51 16.55 18.32 18.39 18.1 19.34 P40748 Syt3 1 94.8812471 25731 + 94.8812471 94.895246 synaptotagmin-3 None CARIRDADTNDRCQEFNELR None 600327 9617 17.7 17.19 16.95 17.8 18.18 17.13 18.12 17.47 18.11 17.34 16.93 18.03 17.61 17.83 17.86 19.06 17.87 17.3 17.61 17.99 16.57 17.32 17.06 17.5 17.82 19.48 16.61 18.4 18.41 18.08 19.32 P0CC10 Lrrc4b 1 94.9356041 308571 + 94.9356041 94.956263 leucine-rich repeat-containing protein 4b None DIPNLTALVRLEELELSGNR None None 45681 18.79 17.86 17.91 19.22 19.06 17.49 17.16 18.88 17.97 18.35 18.14 17.86 18.58 17.28 17.79 18.74 18.94 18.02 18.07 17.97 17.39 17.37 18.07 19.8 19.06 18.51 17.43 18.09 18.48 17.71 19.0 Q6AYH6 Emc10 1 94.982521 292878 - 94.982521 94.988837 er membrane protein complex subunit 10 None APGPETAAFIERLEMEQAQK None None None 17.7 15.84 17.67 18.18 17.82 16.82 17.52 18.02 17.98 17.44 17.54 17.17 17.62 16.71 17.91 16.58 17.63 16.68 17.5 16.18 15.91 16.78 17.47 16.35 15.45 16.85 16.42 17.37 17.92 17.46 17.7 Q01956 Kcnc3 1 95.0809721 117101 + 95.0809721 95.095165 potassium voltage-gated channel subfamily c member 3 None EVGLSGLSSKAAKDVLGFLR None 176264 3650 17.32 16.66 16.79 16.34 18.87 17.01 17.73 17.31 17.28 16.66 16.86 17.57 17.92 17.43 18.41 17.76 16.53 16.9 18.48 17.28 17.51 16.31 16.93 16.1 18.42 18.12 17.02 17.66 18.46 17.65 18.45 Q5PXK5 Kcnc3 1 95.0809721 117101 + 95.0809721 95.095165 potassium voltage-gated channel subfamily c member 3 KShIIID; Kv3.3 None None None None 17.32 16.66 16.79 16.34 18.87 17.01 17.63 17.31 17.28 16.66 16.86 17.57 17.92 17.43 18.42 17.76 16.48 16.94 18.56 17.22 17.51 16.31 16.93 16.17 18.42 18.12 16.98 17.76 18.52 17.65 18.45 Q811T3 Kcnc3 1 95.0809721 117101 + 95.0809721 95.095165 kv3.3c voltage gated potassium channel subunit splice variant c None EVGLSGLSSKAAKDVLGFLR None 176264 3650 17.32 16.67 16.78 16.45 18.78 16.64 17.74 17.56 17.27 16.67 16.87 17.57 17.93 17.62 18.24 17.15 16.47 16.97 18.53 17.4 18.09 16.39 16.94 16.14 18.45 18.16 16.96 17.64 18.58 17.66 18.46 F1LNF0 Myh14 1 95.0962581 308572 - 95.0962581 95.158836 myosin heavy chain 14 None AEDMAELTCLNEASVLHNLR None 608568 23480 20.3 18.36 19.55 19.28 20.59 19.12 19.93 20.71 19.24 18.77 20.51 19.29 19.6 19.73 20.85 19.66 18.64 19.07 19.9 19.65 19.08 18.97 19.55 18.76 20.96 19.2 19.18 19.65 20.76 20.85 20.02 F1LTH0 Zfp473 1 95.2240121 292884 - 95.2240121 95.233791 zinc finger protein 473 None PQPSLIFQPDVREELEAIVR None None None 19.57 18.1 20.05 19.29 19.38 19.68 19.95 19.25 20.6 19.1 18.99 20.11 20.44 20.54 20.21 19.0 17.91 20.46 20.43 20.0 20.81 19.92 19.93 19.08 19.63 19.25 19.94 20.49 19.28 20.44 20.44 P17955 Nup62 1 95.2995371 65274 + 95.2995371 95.314894 nuclear pore glycoprotein p62 None ILSQQKELEDLLSPLEESVK None 605815 68773 16.08 17.54 17.28 17.95 17.77 16.85 16.44 17.82 17.62 16.31 17.24 17.54 17.89 17.68 18.13 17.2 16.52 17.75 17.51 18.05 18.25 17.04 17.9 17.69 18.53 17.64 17.94 16.64 18.79 17.39 17.54 B1H264 Tbc1d17 1 95.3247741 292886 - 95.3247741 95.333175 tbc1 domain family, member 17 None GALQPHPEGASSPDLPPLPDDEPEPGFEVISCVELGQRPTVER None None 11656 18.44 18.98 18.16 18.35 18.62 17.18 17.69 19.38 18.29 17.05 18.21 17.86 17.13 17.54 18.29 18.61 18.12 17.92 19.02 16.49 17.11 16.99 17.48 18.17 19.53 18.04 18.61 17.9 17.66 17.51 18.39 D3ZH75 Akt1s1 1 95.3333471 292887 + 95.3333471 95.339677 akt1 substrate 1 None LPTQQYAKSLPVSVPVWAFK None None 12162 16.31 18.15 17.08 17.2 16.56 16.55 15.21 16.88 15.99 15.76 17.09 15.41 15.57 16.94 16.22 15.34 17.0 15.77 16.31 16.11 16.37 14.66 15.7 16.85 17.15 15.95 16.43 16.11 17.02 16.08 15.8 A0A0G2JUH4 Pnkp 1 95.341621 308576 + 95.341621 95.346803 polynucleotide kinase 3'-phosphatase None VMDRKCSRNQVELIADPETR None 605610 5247 15.66 15.46 16.15 17.76 16.49 14.89 15.9 17.11 16.37 15.59 17.24 16.02 16.8 15.88 15.02 16.71 15.82 16.87 16.85 17.02 15.64 16.61 16.7 17.61 17.26 17.84 17.05 16.5 15.53 16.94 17.62 D3ZUY8 Ap2a1 1 95.3846691 308578 - 95.3846691 95.414057 ap-2 complex subunit alpha None RDTSSNDINGGVEPTPSNVSTPSPSADLLGLR None None None 21.12 23.44 21.79 22.58 22.39 22.58 21.98 23.11 23.04 23.55 21.71 23.02 23.15 22.41 21.6 22.89 22.11 22.81 23.29 22.42 22.1 22.12 23.16 21.62 21.16 22.62 21.93 22.7 24.25 21.56 22.01 F1LN46 Cpt1c 1 95.4428161 308579 - 95.4428161 95.457281 carnitine o-palmitoyltransferase 1, brain isoform None LEGRTETVRSCTREACQFVR None 608846 17561 17.41 17.59 17.59 18.06 16.31 19.0 17.42 17.09 17.77 18.26 17.41 17.46 17.53 17.95 18.54 17.4 18.12 17.46 18.28 16.02 18.21 18.43 17.87 17.9 17.55 18.52 17.43 18.28 17.79 18.11 16.46 Q63624 Scaf1 1 95.485471 56081 - 95.485471 95.496026 splicing factor, arginine/serine-rich 19 None CSQAASAKGTEETSWSGEER None None 10442 16.31 14.7 17.15 15.93 16.13 16.46 14.65 15.66 17.64 15.31 15.64 16.87 16.82 17.13 16.26 15.16 16.37 16.82 16.33 17.02 18.32 16.7 16.75 16.97 17.05 15.75 17.11 16.33 17.17 16.98 17.37 D3Z8L7 Rras 1 95.5005831 361568 + 95.5005831 95.504362 ras-related protein r-ras None IPARLDILDTAGQEEFGAMR None 165090 4565 18.66 16.44 17.95 18.03 17.77 17.12 18.59 19.47 17.7 18.55 19.67 18.24 18.48 18.93 17.93 18.23 18.94 18.29 18.22 16.95 17.28 18.03 18.71 18.2 18.39 17.6 18.3 18.61 16.65 18.86 17.99 D3ZH12 Nosip 1 95.54341 292894 + 95.54341 95.559101 nitric oxide synthase-interacting protein None AATLPNTDGEQPGPSVGPLGK None None 9315 15.64 13.99 15.46 16.02 16.03 14.98 14.69 16.24 16.48 15.86 13.88 15.83 15.88 15.72 15.18 14.68 16.33 15.54 15.95 14.48 16.24 14.72 15.83 16.16 15.63 15.94 16.1 14.8 16.39 15.5 16.85 I6L9G5 Rcn3 1 95.5644311 494125 - 95.5644311 95.573762 reticulocalbin-3 None EEFPHMRDIVVAETLEDLDK None None None 15.45 14.59 16.28 15.49 14.68 15.79 16.23 17.04 15.63 15.22 17.09 15.92 16.99 16.44 16.29 15.44 15.25 16.72 15.4 15.7 16.4 16.26 15.99 15.21 16.27 14.6 15.52 16.11 16.17 16.08 16.33 P13599 Fcgrt 1 95.5744421 29558 - 95.5744421 95.58356 igg receptor fcrn large subunit p51 None WEKETTDLKSKEQLFLEAIR None 601437 3030 15.7 17.18 15.74 15.09 15.08 15.21 16.77 16.77 14.95 14.68 16.5 14.85 15.14 16.03 15.4 16.15 15.37 16.59 15.45 15.38 16.55 14.77 14.85 15.53 17.24 16.09 14.72 16.71 15.09 14.98 15.79 P62282 Rps11 1 95.6056851 81774 - 95.6056851 95.607874 40s ribosomal protein s11 None NIGLGFKTPKEAIEGTYIDK None 180471 88443 21.46 20.42 19.74 21.04 20.13 19.94 19.26 21.09 20.8 20.34 20.11 21.89 20.34 20.92 21.65 21.08 20.43 21.23 20.24 19.93 21.23 21.06 19.86 21.56 20.33 21.96 21.41 19.67 21.29 19.37 21.44 A0A1W2Q6L2 Flt3lg 1 95.6135291 - 95.6135291 95.620463 60s ribosomal protein l13a None RLAHEVGWKYQAVTATLEEK None None None 18.77 20.49 20.24 19.23 18.27 19.59 18.06 18.51 19.94 20.37 20.41 19.79 18.74 20.11 20.7 18.9 19.86 19.27 19.18 18.86 20.9 20.16 19.63 20.4 17.91 18.67 20.22 18.47 19.83 18.99 18.81 Q3T1L0 Aldh16a1 1 95.6267391 361571 - 95.6267391 95.639808 aldehyde dehydrogenase family 16 member a1 None RGAVEAAHQAAPGWGAQSPR None 613358 34938 15.23 17.13 16.72 14.72 16.51 15.85 17.02 15.71 16.43 15.33 16.92 15.48 15.55 15.94 15.94 14.6 14.98 16.62 15.48 15.72 16.88 15.95 14.52 15.3 15.46 14.27 16.27 15.32 15.28 15.3 16.31 Q4V7F5 Pih1d1 1 95.6412231 292898 + 95.6412231 95.645294 pih1 domain-containing protein 1 None VDLPKLDGAQGLALEIGENR None 611480 9914 15.8 13.94 15.07 15.51 15.19 15.68 15.9 16.56 15.58 15.06 16.19 16.25 15.47 15.87 16.56 14.62 15.75 14.89 15.87 14.78 15.11 14.76 16.1 14.0 14.61 14.51 16.25 15.6 15.46 15.82 15.35 Q62634 Slc17a7 1 95.6497461 116638 + 95.6497461 95.661595 vesicular glutamate transporter 1 None GGQIADFLRSRHIMSTTNVR None 605208 113454 20.96 19.8 20.31 20.52 20.65 21.47 20.09 20.52 22.22 21.2 20.2 21.7 21.63 21.65 21.92 21.19 20.91 21.12 21.66 19.49 22.05 20.51 21.66 21.28 20.29 21.2 20.85 22.27 20.82 20.87 21.41 Q91Z79 Ppfia3 1 95.8165621 140591 - 95.8165621 95.840449 liprin-alpha-3 None YSQAPTLPSGAPLDPYGAGSGR None 603144 37833 20.49 19.84 19.07 19.51 19.01 20.09 19.43 19.16 19.84 20.03 19.39 20.19 20.34 20.28 20.15 20.55 20.62 19.55 20.49 18.04 19.75 20.28 19.99 20.38 19.35 20.88 19.81 20.47 19.15 19.2 19.45 Q9Z252 Lin7b 1 95.8469721 60377 - 95.8469721 95.849546 protein lin-7 homolog b None SRAVELLERLQRSGELPPQK None 612331 22648 19.4 17.74 19.1 19.21 18.59 18.68 17.97 18.62 20.59 18.94 18.04 19.46 19.6 20.11 18.92 18.09 19.5 18.67 19.49 19.78 20.38 19.28 19.39 19.59 19.03 19.29 18.69 19.76 20.31 19.47 20.04 B2RZ74 Snrnp70 1 95.8560471 361574 - 95.8560471 95.876375 u1 small nuclear ribonucleoprotein 70 kda None YSKRSGKPRGYAFIEYEHER None 180740 None 18.97 18.41 19.79 18.81 18.64 18.98 17.71 18.59 20.08 18.23 18.47 19.19 19.15 19.34 19.79 18.48 18.87 18.73 18.43 19.95 20.89 19.24 19.02 19.96 19.34 18.8 19.92 18.19 19.74 19.45 20.34 G3V8T5 Ruvbl2 1 95.9020151 292907 - 95.9020151 95.9151 ruvb-like helicase None EETEIIEGEVVEIQIDRPATGTGSK None 604788 4856 18.35 20.4 19.42 18.24 17.95 18.88 18.32 17.91 17.48 17.99 18.84 18.07 17.93 18.99 19.36 17.76 18.62 18.27 18.05 19.18 19.88 19.26 17.87 18.71 20.01 18.22 18.81 17.3 19.85 18.74 19.25 A2RRU1 Gys1 1 95.9154441 690987 + 95.9154441 95.935292 glycogen [starch] synthase, muscle None RQRIIQRNRTERLSDLLDWK None 138570 113557 18.36 15.52 17.68 17.43 18.78 17.78 16.6 17.56 16.5 17.31 18.53 17.42 18.06 16.54 17.92 18.84 17.83 17.79 17.77 17.82 17.08 16.8 18.41 17.85 18.53 17.64 17.91 17.32 18.36 18.21 17.99 G3V8T9 Bax 1 95.9400031 24887 - 95.9400031 95.945407 apoptosis regulator bax None SSEQIMKTGAFLLQGFIQDR None 600040 7242 16.51 14.36 17.52 16.67 15.32 15.26 16.59 15.16 15.5 15.44 15.78 15.61 16.23 16.29 15.52 15.5 15.68 17.03 17.02 14.68 17.33 16.11 16.32 16.58 17.03 15.78 15.38 16.92 14.88 16.63 16.75 Q63690 Bax 1 95.9400031 24887 - 95.9400031 95.945407 apoptosis regulator bax None SSEQIMKTGAFLLQGFIQDR None 600040 7242 15.79 13.7 16.57 15.15 15.07 14.31 16.18 14.31 14.7 14.81 15.22 14.69 15.44 15.08 15.77 15.12 14.08 16.36 15.71 14.86 17.08 16.27 15.41 15.11 16.24 15.0 14.61 16.26 14.4 15.81 16.07 Q63083 Nucb1 1 95.9683111 84595 - 95.9683111 95.989004 nucleobindin-1 None DRLEAQKRELQQAVLQMEQR None 601323 3676 20.3 19.11 19.48 20.06 19.23 18.2 19.66 19.97 19.38 20.05 20.62 18.9 19.83 19.04 19.53 18.59 19.94 19.33 18.25 20.13 18.96 19.76 18.45 18.82 19.28 19.12 18.94 19.41 20.57 20.44 19.43 O35854 Bcat2 1 96.0426721 64203 + 96.0426721 96.059985 branched-chain-amino-acid aminotransferase None EVFGSGTACQVCPVHQILYEGK None 113530 81684 17.81 19.09 17.09 16.75 17.23 17.25 18.98 18.98 17.82 16.24 19.17 17.68 16.99 18.4 17.44 16.89 16.92 19.03 18.31 17.05 18.44 17.86 16.81 18.04 18.4 18.06 17.63 17.68 16.46 17.13 18.6 Q6AYB2 Sphk2 1 96.1808741 308589 - 96.1808741 96.185177 rcg53912, isoform cra_a None CRGGSHPLDLLSVTLASGSR None 607092 32456 15.46 15.61 15.83 14.69 16.52 15.92 16.28 14.99 15.75 14.79 16.27 15.34 15.17 16.35 15.29 16.08 16.65 15.37 16.19 14.45 15.21 15.11 15.25 16.02 17.32 15.09 14.57 15.57 16.07 15.81 15.5 D3ZM33 Rpl18 1 96.1888121 + 96.1888121 96.191452 40s ribosomal protein s18 None None None None 19.81 18.57 19.28 20.7 20.39 18.52 18.39 20.72 19.54 19.89 18.62 19.49 20.53 19.14 20.96 20.81 20.05 19.24 19.33 19.12 18.35 19.02 19.26 20.7 20.45 21.57 20.39 18.81 20.63 19.56 21.58 P12001 Rpl18 1 96.1898771 81766 + 96.1898771 96.191451 60s ribosomal protein l18 None KLYRFLARRTNSTFNQVVLK None 604179 756 19.57 20.78 19.27 18.97 18.13 18.21 17.68 18.61 19.34 19.97 19.76 19.39 18.56 19.67 20.73 19.12 19.5 18.77 19.05 17.95 20.38 20.14 18.96 20.22 18.73 19.95 19.98 18.38 19.75 18.45 18.46 Q63003 Lmtk3 1 96.2715611 + 96.2715611 96.28039 5e5 antigen None PGISGERRESPGEWGADVPR None None None 16.52 14.4 15.49 15.72 15.61 16.55 15.59 14.69 16.58 15.95 16.61 16.58 16.38 16.66 14.91 16.86 16.98 16.44 15.96 15.59 16.87 15.78 16.83 16.29 15.46 15.73 15.22 16.04 17.45 16.19 16.1 P63035 Cyth2 1 96.2842531 116692 - 96.2842531 96.291104 cytohesin-2 None FLYKGEGLNKTAIGDYLGER None 602488 31262 18.21 17.13 17.56 18.34 17.61 17.86 17.92 17.64 18.66 18.95 17.85 18.49 18.59 18.47 17.67 17.92 18.68 18.4 18.9 16.74 19.34 17.92 18.82 17.68 18.28 17.52 18.46 19.28 17.7 17.96 18.82 Q62645 Grin2d 1 96.3083661 24412 - 96.3083661 96.344793 glutamate receptor ionotropic, nmda 2d None PDAPRPEKRCCKGFCIDILK None 602717 648 16.7 17.84 16.74 17.03 16.95 15.69 16.1 16.88 16.97 18.14 16.51 16.09 17.13 16.38 17.22 18.27 17.35 16.81 17.53 15.86 17.45 16.62 16.43 17.96 16.79 17.97 16.99 17.01 17.08 17.43 16.74 Q569A6 Kdelr1 1 96.3472591 361577 + 96.3472591 96.358145 er lumen protein-retaining receptor 1 None IILLLLKIWKSRSCAGISGK None None 38236 16.51 14.65 17.13 16.83 16.29 16.24 16.67 17.41 15.94 17.52 16.53 17.39 17.58 16.71 17.02 16.86 16.92 17.24 17.12 15.99 16.57 17.01 17.3 16.05 15.83 16.69 16.82 17.39 17.04 17.17 17.22 D3ZSD8 Tmem143 1 96.3719391 308593 + 96.3719391 96.387991 transmembrane protein 143 None MLYYRSTSNNSELLSALALR None None 10105 16.67 14.99 15.15 16.51 16.34 16.19 17.18 15.73 17.12 16.57 15.08 16.35 16.33 16.8 16.31 16.1 17.04 15.06 17.16 16.08 17.73 16.06 16.3 15.15 16.51 17.25 16.33 15.99 16.96 16.96 17.29 D3ZSA9 Nomo1 1 96.5054851 361578 + 96.5054851 96.556279 nodal modulator 1 None EGKFRLRGLLPGCMYHVQLK None None 13810 18.74 17.0 19.51 17.91 18.05 17.18 18.14 18.92 18.13 17.41 19.47 17.66 19.39 17.99 19.39 18.56 18.9 18.46 18.1 17.14 18.55 18.54 18.43 16.98 18.96 17.62 19.01 18.55 19.68 18.42 19.57 Q09429 Abcc8 1 96.5986641 25559 - 96.5986641 96.679495 atp-binding cassette sub-family c member 8 None FVATKLSQAQRSTLEYSNER None 600509 68048 17.3 16.67 15.79 16.86 16.25 16.94 16.54 15.61 17.4 16.24 16.84 17.3 15.99 17.06 16.43 16.57 16.61 16.48 17.7 15.26 16.93 16.87 17.01 15.91 16.59 16.92 15.78 17.49 17.83 16.99 16.47 P25122 Kcnc1 1 96.9029541 25327 + 96.9029541 96.944744 potassium voltage-gated channel subfamily c member 1 None AALANEDCPHIDQALTPDEGLPFTR None 176258 68134 18.29 16.96 17.92 17.79 18.79 17.77 18.61 18.61 18.73 17.74 17.68 18.84 19.1 18.94 18.92 17.65 17.81 17.87 19.85 17.86 19.27 17.89 18.29 17.31 18.75 18.97 17.84 18.57 19.82 18.66 19.84 D3ZN16 Sergef 1 96.9496631 365243 - 96.9496631 97.152492 secretion-regulating guanine nucleotide exchange factor None VCGLNKDGQLGLGHTEEVLR None None 40812 16.09 17.69 16.22 15.93 16.75 16.83 15.97 15.38 15.56 15.71 17.15 15.37 15.47 15.93 16.26 17.56 15.96 16.38 15.35 17.52 15.27 16.66 15.29 15.89 16.15 17.52 16.41 15.75 17.32 16.07 16.11 Q7TMC3 Hps5 1 97.2475841 365245 - 97.2475841 97.320945 hermansky-pudlak syndrome 5 protein homolog None NRYYFGIRDHGLESLQSTQK None None None 15.98 17.82 15.39 17.48 16.22 15.12 17.02 17.3 15.31 15.04 17.66 16.52 16.09 15.83 15.96 15.7 16.02 17.0 15.03 16.75 15.53 15.32 15.57 16.74 16.52 16.71 14.57 16.44 15.64 15.58 15.0 P04642 Ldha 1 97.3718221 24533 + 97.3718221 97.381242 l-lactate dehydrogenase a chain None NGISDVVKVTLTPDEEARLK None 150000 56495 23.38 23.46 24.42 22.33 23.02 24.4 23.78 23.23 23.73 24.46 23.39 23.66 23.26 24.1 21.9 22.21 23.43 24.27 23.88 23.68 24.76 24.39 24.08 24.03 21.68 23.09 21.92 23.65 23.94 23.51 23.94 Q6IRE4 Tsg101 1 97.4127721 292925 - 97.4127721 97.442513 tumor susceptibility gene 101 protein None MENQSENNDIDEVIIPTAPLYK None 601387 4584 18.45 17.44 19.3 18.61 17.82 17.28 18.35 19.55 19.06 17.87 18.15 18.06 19.21 19.35 18.89 18.09 19.75 19.55 18.15 18.38 19.39 18.28 18.48 18.54 18.42 20.18 19.84 19.43 17.42 19.05 20.16 F1M0M3 Uevld 1 97.4536891 691172 - 97.4536891 97.485927 uev and lactate/malate dehyrogenase domains None VDLLAYITKITEGVSDINSR None None None 16.81 14.19 15.49 16.19 16.46 17.26 16.8 16.8 15.9 15.06 16.38 16.09 15.96 15.35 15.92 15.46 14.63 16.9 16.1 16.0 14.54 15.99 15.59 15.26 15.74 15.34 15.66 16.52 15.35 15.86 16.79 A0A0G2QC31 Ptpn5 1 97.6206361 29644 - 97.6206361 97.679717 protein-tyrosine-phosphatase None VVHDGVEITVQKVIHTEDYR None 176879 8423 19.55 19.5 18.47 18.62 18.83 19.54 19.04 18.45 19.45 19.05 19.25 18.0 17.93 19.29 17.67 18.71 19.86 17.77 19.36 18.75 17.93 19.85 19.33 18.31 18.09 18.58 17.74 19.31 19.02 18.73 17.8 P35234 Ptpn5 1 97.6206361 29644 - 97.6206361 97.679717 tyrosine-protein phosphatase non-receptor type 5 None DPLSSYINANYIRGYNGEEK None 176879 8423 19.52 19.63 18.49 18.59 18.81 19.55 19.04 18.48 19.49 18.95 19.21 17.95 17.91 19.29 18.09 18.69 19.78 17.52 19.15 18.76 17.94 19.87 19.25 18.48 18.15 18.53 17.54 19.28 18.99 18.69 17.81 A0A0G2QC15 Htatip2 1 99.4735831 292935 + 99.4735831 99.488634 hiv-1 tat interactive protein 2 None SGETGKVLLKEILGQNLFSK None 605628 4676 17.52 15.41 17.02 17.58 16.5 16.06 15.39 16.01 16.73 17.45 15.99 15.87 16.23 15.63 16.51 16.39 15.7 17.61 16.04 16.56 16.65 17.02 16.63 17.21 16.28 16.08 17.14 16.86 15.64 15.77 16.64 O70467 Prmt3 1 99.4927691 89820 + 99.4927691 99.579654 protein arginine n-methyltransferase 3 None EDTIVLIKGKIEEVSLPVEK None None 24255 17.26 15.9 16.49 16.79 16.45 16.95 15.61 15.99 17.31 17.09 16.09 16.71 16.64 16.32 16.6 15.86 16.3 16.04 17.65 15.82 17.17 16.86 16.1 15.74 15.48 15.77 15.93 17.5 17.38 15.32 16.16 P58295 Slc6a5 1 99.645391 171148 + 99.645391 99.69701 sodium- and chloride-dependent glycine transporter 2 None PKEMNKPPTNILEATVPGHR None 604159 37901 19.05 16.03 16.51 17.26 17.98 16.99 16.63 17.27 16.86 15.97 18.51 16.71 17.02 16.34 16.18 18.22 17.18 17.58 16.56 17.64 15.94 16.02 16.72 17.42 17.9 16.68 16.68 16.83 17.46 17.38 16.89 G3V851 Slc17a6 1 101.2124091 84487 + 101.2124091 101.252543 solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 None RRYIEESIGESANLLGAMEK None 607563 121617 19.72 17.37 20.21 19.84 18.7 19.01 18.7 18.49 18.32 19.57 19.18 17.44 19.26 19.11 18.71 18.9 18.94 19.05 18.6 19.9 18.05 19.52 19.72 19.13 19.77 19.33 18.69 18.83 19.34 19.7 18.82 Q9JI12 Slc17a6 1 101.2124091 84487 + 101.2124091 101.252543 vesicular glutamate transporter 2 None DNRETIELTEDGKPLEVPEK None 607563 121617 19.53 17.02 19.57 19.45 18.29 19.04 18.37 18.14 17.75 19.61 18.72 17.16 19.03 18.68 18.41 18.81 18.41 18.87 18.33 19.53 17.85 19.16 19.34 19.04 19.29 19.16 18.28 18.88 18.72 19.26 18.51 G3V857 Gas2 1 101.4821211 499156 + 101.4821211 101.582799 growth arrest-specific 2 None RDLGVDETCLFESEGLVLHK None 602835 31301 15.11 15.6 16.22 15.09 14.27 15.47 15.08 13.92 14.94 14.79 15.68 13.39 14.83 14.77 14.75 14.84 15.05 14.58 14.59 16.71 16.06 16.17 14.84 15.49 15.6 15.84 14.22 16.26 14.87 13.5 15.11 P0C0A9 Svip 1 101.5871291 499157 - 101.5871291 101.592818 small vcp/p97-interacting protein None RQKEAASRGILDIQSVEAKK None None None 18.92 19.25 18.55 18.27 18.9 17.76 17.41 19.59 17.48 19.82 19.19 17.37 18.55 17.77 17.76 18.61 17.85 18.45 17.51 19.88 16.92 18.01 17.92 18.83 17.91 18.11 18.7 18.1 19.12 18.84 18.12 A0A1W2Q6D6 Luzp2 1 105.8346661 100910839 + 105.8346661 108.479261 leucine zipper protein 2 None LKTEVERKSKMIRDLQNENK None None None 15.68 15.88 15.85 15.84 15.36 15.42 14.97 16.82 14.91 16.25 16.31 14.96 15.44 15.63 15.84 15.89 17.09 15.78 14.75 16.4 14.86 16.75 15.17 17.45 15.79 17.33 15.51 16.24 15.19 16.62 16.19 P19969 Gabra5 1 108.2687321 29707 - 108.2687321 108.381608 gamma-aminobutyric acid receptor subunit alpha-5 None DTEMEYTIDVFFRQSWKDER None 137142 20219 18.71 19.3 18.75 18.8 17.98 18.16 17.47 17.48 19.07 19.22 17.12 18.15 17.12 19.48 19.71 17.52 17.9 17.79 18.61 18.08 19.41 18.74 18.67 19.53 18.45 19.17 18.47 19.19 18.28 17.45 19.61 P63079 Gabrb3 1 108.410951 24922 + 108.410951 108.698961 gamma-aminobutyric acid receptor subunit beta-3 None KAVTGVERIELPQFSIVEHR None 137192 633 18.92 18.46 18.01 18.89 18.4 18.4 17.76 17.58 18.3 18.57 17.49 19.16 18.04 18.62 19.45 18.97 18.57 17.55 18.85 17.05 18.23 17.99 18.54 18.49 18.44 18.5 17.97 19.1 18.66 17.91 18.93 A0A0G2K472 Cyfip1 1 106.7109751 308666 + 106.7109751 106.799392 cytoplasmic fmr1-interacting protein None VICRLLGYQGIAVVMEELLK None 606322 22628 20.26 22.1 20.1 20.0 19.67 20.9 20.38 20.29 20.79 21.33 19.61 20.83 21.07 20.34 20.62 21.62 20.62 21.35 21.59 19.2 21.52 20.99 20.46 19.89 20.52 21.73 20.54 22.03 20.49 19.44 20.54 D4A8H8 Cyfip1 1 106.7109751 308666 + 106.7109751 106.799392 cytoplasmic fmr1-interacting protein None DMQIELARYIKTSAHYEENK None 606322 22628 20.22 22.32 20.18 20.03 19.69 20.93 20.13 20.14 20.91 21.3 19.58 20.98 21.13 20.43 20.67 21.55 20.6 21.46 21.49 19.22 21.64 20.99 20.53 20.03 20.57 21.44 20.61 21.88 20.58 19.49 20.62 A0A0G2JUC9 Herc2 1 106.9048131 308669 + 106.9048131 107.108144 hect-type e3 ubiquitin transferase None IGEPLTDCLRDVDLIPPFNR None 605837 3430 18.08 16.69 17.12 17.79 17.47 16.13 16.98 16.55 16.85 16.68 17.87 16.1 16.02 17.68 17.51 16.08 17.74 16.18 17.27 15.74 16.75 16.93 16.63 15.9 18.48 17.2 16.74 17.09 18.26 17.73 16.58 F1M7B8 Ube3a 1 110.0704811 361585 + 110.0704811 110.159062 ubiquitin-protein ligase e3a None SEASSSRMGDSSQGDNNVQK None 601623 7988 18.21 16.2 18.6 18.12 16.63 17.02 18.08 17.33 17.43 17.48 18.73 17.31 18.59 18.21 18.83 17.73 18.17 17.6 18.86 16.86 19.32 19.49 18.55 18.15 19.14 18.71 18.67 18.54 16.63 18.41 18.32 D4ABZ4 Otud7a 1 117.357871 309252 + 117.357871 117.38648 ubiquitinyl hydrolase 1 None GFGAARDGLEFADADAPAAR None 612024 15642 17.84 14.66 16.81 16.98 17.93 16.34 15.85 16.11 15.72 15.56 16.93 16.19 16.41 16.81 14.83 16.85 16.89 16.63 16.61 17.47 15.88 15.5 16.36 16.81 17.64 17.13 16.62 17.15 16.43 16.61 16.13 Q2WEA5 Trpm1 1 117.7188971 361586 + 117.7188971 117.834605 transient receptor potential cation channel subfamily m member 1 None DEGGVINESLRDQLLVTIQK None 603576 19940 16.57 13.69 16.37 15.15 15.83 14.83 15.37 15.56 16.08 15.08 15.94 15.78 16.0 15.99 16.12 15.01 15.78 15.42 15.87 15.54 16.72 15.67 15.35 16.7 15.4 15.13 14.9 15.47 16.26 16.32 16.14 G3V810 Mtmr10 1 117.8593561 309255 + 117.8593561 117.910839 myotubularin-related protein 10 None KLEPVLLPGEIVVNEVNFVR None None 9822 18.42 17.44 17.74 17.79 18.08 17.43 17.77 18.4 16.5 16.75 18.71 16.65 16.5 17.33 18.03 17.98 16.98 17.75 17.42 17.18 16.35 16.54 17.26 17.57 18.61 17.41 18.1 17.12 16.71 18.38 16.95 D4A197 Mcee 1 117.9645591 293829 + 117.9645591 117.987775 methylmalonyl coa epimerase None NAAVMDLKKQKIRSLSDEAK None 608419 13078 18.84 17.49 17.5 17.84 17.31 17.91 18.05 17.07 18.1 19.74 17.6 17.56 18.12 17.35 18.61 18.65 16.84 17.77 18.18 17.1 18.12 18.56 17.49 16.98 18.53 16.83 18.58 17.07 18.54 18.33 18.17 O35431 Apba2 1 118.1032331 83610 + 118.1032331 118.286855 amyloid-beta a4 precursor protein-binding family a member 2 None KTMPAAMFRLLTGQETPLYI None 602712 4021 17.04 15.23 16.84 17.3 16.96 17.3 16.6 17.26 16.87 16.06 16.8 17.16 18.18 17.35 16.85 18.71 18.68 17.5 16.7 16.65 15.99 16.63 17.89 16.72 18.52 18.19 16.37 18.46 17.96 17.23 17.5 A0A0G2K2P5 Tjp1 1 118.8498391 292994 - 118.8498391 118.931696 tight junction protein zo-1 None ILRPSMKLVKFRKGDSVGLR None 601009 2445 20.01 17.39 19.39 18.61 20.31 18.69 18.59 19.12 19.05 17.96 20.8 19.05 19.41 19.98 19.63 18.9 19.87 18.92 19.67 18.21 19.19 18.46 19.73 20.54 20.24 18.7 19.57 19.19 18.16 19.89 19.62 Q5XI17 Tars3 1 119.213231 308701 + 119.213231 119.249871 threonyl-trna synthetase None RPRSWREMPVRFADFGVLHR None None None 18.6 16.94 16.26 18.22 18.56 17.76 17.48 16.8 18.53 18.28 18.77 18.16 18.48 16.13 18.51 17.43 17.4 18.1 18.14 15.73 18.01 18.03 17.43 16.83 16.44 17.01 18.35 16.82 18.5 18.2 16.79 D3ZZR5 Snrpa1 1 119.6415921 100361269 + 119.6415921 119.654653 small nuclear ribonucleoprotein polypeptide a' None TLAEVERLKGLLQSGQIPGR None None None 17.81 16.43 16.81 17.61 18.09 17.34 16.2 17.44 18.07 16.24 16.84 18.5 17.82 17.5 18.18 16.91 17.98 16.83 17.28 17.3 18.46 17.29 17.28 18.46 18.49 17.42 18.29 16.48 18.31 17.34 19.28 A0A0G2K953 Selenos 1 119.6597761 286900 + 119.6597761 119.669546 selenoprotein s None LRQRQLDQAEAVLEPDVVVK None 607918 None 15.4 14.16 15.82 15.36 15.72 15.54 15.32 15.24 15.77 14.95 16.45 16.55 16.23 16.49 14.25 15.55 14.97 16.43 16.42 15.94 16.59 15.13 15.66 14.8 14.88 14.38 15.28 17.0 15.11 16.44 16.08 Q8VHV8 Selenos 1 119.6597761 286900 + 119.6597761 119.669546 selenoprotein s None LRQRQLDQAEAVLEPDVVVK None 607918 None 15.21 13.97 15.62 15.17 15.52 15.34 15.7 15.05 15.58 14.76 16.25 16.35 16.04 16.3 14.05 15.36 14.78 16.23 16.23 15.75 16.4 14.94 15.47 14.54 14.69 14.18 15.61 16.73 14.25 16.25 15.88 D3ZRJ7 Lrrk1 1 119.8439261 308703 - 119.8439261 119.973003 non-specific serine/threonine protein kinase None RLLNWMLALACQRGHLEVVK None 610986 23464 16.68 18.22 15.4 17.42 17.28 16.0 15.95 17.79 16.44 16.49 16.33 16.55 16.1 16.01 16.81 17.63 17.28 17.23 17.42 15.08 15.37 16.27 16.3 17.66 17.11 18.6 16.35 16.65 17.2 15.95 16.78 Q8K4D8 Aldh1a3 1 119.9822661 266603 - 119.9822661 120.01739 aldehyde dehydrogenase family 1 member a3 None GPQIDQKQFDKILELIESGK None 600463 68080 16.41 17.29 16.12 15.6 16.13 14.65 16.08 16.01 15.36 16.66 16.73 16.2 15.67 15.21 16.59 17.05 15.6 15.31 15.65 16.85 14.93 15.89 14.9 15.9 14.32 16.29 15.61 16.86 14.82 14.52 16.14 G3V9G5 Synm 1 121.3337131 308709 - 121.3337131 121.363652 rcg24674, isoform cra_b None LSWRLQTSSEKAELQELNAR None None 9081 23.13 20.81 21.17 21.46 21.63 21.53 22.31 21.38 20.71 21.39 23.24 20.45 21.15 20.91 22.46 21.95 20.84 20.51 20.7 21.65 20.04 21.62 20.57 21.15 21.06 20.91 20.52 21.56 20.6 21.54 20.84 P24062 Igf1r 1 121.5507871 25718 + 121.5507871 121.831248 insulin-like growth factor 1 receptor None CRHYYYKGVCVPACPPGTYR None 147370 30997 16.16 17.15 17.84 17.44 16.73 15.2 16.17 17.07 16.99 16.5 17.58 15.99 16.81 15.78 17.02 17.66 15.58 17.11 15.88 17.53 16.48 15.87 15.79 17.34 15.49 16.82 16.73 16.46 16.29 15.44 18.15 D4A188 Rgma 1 127.1291811 308739 + 127.1291811 127.172921 rgm domain family, member a, isoform cra_a None PPAGDSQERSDSPEICHYEK None 607362 10626 14.36 15.52 15.24 16.06 15.58 16.03 17.02 15.65 16.46 15.4 15.66 16.86 16.68 16.96 14.7 15.46 16.09 16.74 16.04 16.29 17.36 15.86 16.9 14.98 16.2 16.55 15.16 16.72 16.26 15.96 15.71 A0A0G2KA92 Chd2 1 127.1881521 308738 - 127.1881521 127.300499 dna helicase None NSGRSNSNPFNKEELTAILK None 602119 37462 15.95 15.37 16.81 16.61 16.51 16.07 15.51 16.43 17.36 15.3 15.56 16.65 15.3 16.71 17.21 15.05 16.96 15.3 16.37 15.18 17.31 15.65 16.35 17.37 16.65 16.3 16.78 15.45 16.35 16.57 17.25 A0A0G2K992 Slco3a1 1 128.1061851 140915 - 128.1061851 128.387944 solute carrier organic anion transporter family member Slc21a11 None None None None 17.0 13.94 16.83 14.92 15.91 15.41 15.62 16.36 15.28 15.54 15.44 15.7 16.17 16.2 14.28 16.4 15.9 16.56 16.26 16.58 15.95 14.83 16.51 15.36 16.35 16.84 15.97 15.54 17.21 16.68 15.99 Q99N02 Slco3a1 1 128.1061851 140915 - 128.1061851 128.387944 solute carrier organic anion transporter family member 3a1 None LSALPEFLTHQYKYEAGEIR None 612435 40862 17.52 14.46 17.36 15.45 16.44 15.94 16.43 16.89 15.81 16.07 15.97 16.23 16.7 16.73 15.01 16.93 15.94 17.1 16.9 17.15 16.48 15.35 17.04 15.62 16.88 17.37 16.22 16.75 17.24 17.21 16.52 Q63564 Ac126641.1 1 128.9784791 117556 - 128.9784791 129.152479 synaptic vesicle glycoprotein 2b None MEDEEQLAHQYETIIDECGHGR None None 32236 21.17 20.22 20.07 20.7 20.75 20.37 21.08 21.4 22.01 21.73 20.17 21.72 22.12 21.05 21.61 22.28 21.19 21.22 21.2 20.66 21.46 20.73 21.82 20.92 20.44 22.04 20.3 22.22 21.37 20.18 21.56 F1M3G7 Akap13 1 129.3144031 293024 + 129.3144031 129.619646 a-kinase anchor protein 13 None FAKEDLRRKKLVRDGSVFLK None 604686 4903 16.51 14.53 16.08 16.72 15.83 14.39 16.83 17.33 16.56 15.5 16.31 15.72 16.35 16.33 15.63 16.16 16.71 16.17 15.57 16.57 16.49 15.4 16.41 15.84 17.31 16.94 16.5 16.01 15.71 16.53 17.28 Q03351 Ntrk3 1 132.1328731 29613 - 132.1328731 132.503286 nt-3 growth factor receptor None FVHRDLATRNCLVGANLLVK None 191316 49183 19.11 19.08 18.02 18.26 17.15 18.38 17.85 17.03 18.28 18.42 18.92 18.73 18.0 19.26 18.23 18.33 19.15 18.27 18.75 16.49 19.47 18.36 18.28 18.84 17.69 17.98 17.94 19.22 17.58 17.1 17.81 Q5RK00 Mrpl46 1 132.6985961 293054 - 132.6985961 132.707801 39s ribosomal protein l46 None LRGTAERILATLSENNMEAK None 611851 6747 16.58 17.39 16.09 16.49 15.74 17.32 15.4 15.89 16.21 16.27 16.19 17.53 15.2 17.68 15.88 16.45 16.76 17.31 17.56 16.26 17.78 17.84 17.17 17.76 18.68 16.95 17.77 17.49 16.66 16.56 17.94 D4A040 Mrps11 1 132.7078741 499185 + 132.7078741 132.717253 mitochondrial ribosomal protein s11 None VVSATNTSLARASCGTEGFR None 611977 32554 17.17 16.56 16.46 17.49 17.69 14.5 17.09 16.57 16.57 16.58 16.58 16.74 16.43 16.4 17.68 16.53 16.98 15.67 16.68 15.25 16.62 15.05 15.44 16.87 17.46 16.64 15.68 15.53 18.11 17.02 17.26 D4A7Y1 Acan 1 132.9815831 58968 + 132.9815831 133.043627 aggrecan core protein None VFYATSPEKFTFQEAANECR None 155760 136028 18.3 18.1 17.01 17.99 18.54 18.09 16.93 17.7 17.77 18.87 17.52 17.74 17.18 17.01 17.38 18.37 17.92 17.51 16.68 19.17 17.01 17.03 17.66 17.45 16.82 17.86 17.15 17.28 19.54 17.53 17.08 P07897 Acan 1 132.9815831 58968 + 132.9815831 133.043627 aggrecan core protein None PIHTPREGCYGDKDEFPGVR None 155760 136028 18.3 18.1 17.26 17.98 18.5 17.5 16.93 17.72 16.92 18.45 18.12 16.52 17.18 17.04 17.4 18.38 17.92 17.52 16.69 19.1 16.97 17.05 17.66 17.45 19.01 18.24 17.15 17.28 19.54 17.53 17.08 D3Z956 Rlbp1 1 133.3088391 293049 - 133.3088391 133.322321 retinaldehyde binding protein 1, isoform cra_a None PCSQLPRHTLQKAKDELNER None 180090 68046 18.06 19.39 19.03 19.49 18.42 17.17 18.84 19.05 18.72 19.19 18.41 18.1 18.58 17.45 17.53 18.3 18.07 18.18 19.06 20.12 18.88 18.97 18.18 18.78 18.58 18.46 19.64 18.09 17.32 18.28 18.76 D3Z840 Fanci 1 133.3308721 100360594 + 133.3308721 133.38313 fa complementation group i None LMSLFFSLHVLYKSPVTLLR None None None 16.64 18.76 16.38 16.65 18.03 17.38 17.13 16.3 16.14 17.98 15.32 16.45 16.16 16.32 17.92 17.68 16.87 16.16 17.58 15.61 16.14 16.16 16.27 16.84 17.59 18.01 17.73 16.85 15.7 16.58 16.68 D4A9P0 Kif7 1 133.6405241 293047 - 133.6405241 133.656974 kinesin family member 7 None None None None 14.96 16.74 14.23 14.57 14.71 14.93 16.03 15.57 14.71 16.1 14.4 14.39 14.51 14.17 14.69 16.21 16.28 14.55 14.97 14.13 14.26 15.09 14.36 15.04 14.76 16.41 15.66 14.5 14.62 14.51 14.47 A0A0G2JVE6 Anpep 1 133.7673031 81641 - 133.7673031 133.810137 aminopeptidase None EWNFAWEQFRKATVVNEADK None 151530 68163 17.86 15.56 16.64 17.19 18.21 15.91 16.95 18.13 17.25 16.06 18.12 16.29 16.81 17.36 15.69 16.87 17.12 18.05 16.97 17.37 16.36 16.35 17.09 17.49 17.79 17.49 16.45 16.86 17.08 17.87 16.94 P15684 Anpep 1 133.7673031 81641 - 133.7673031 133.810137 aminopeptidase n None VTYRESALVFDPQSSSISNK None 151530 68163 17.82 15.53 16.6 17.16 18.18 15.87 16.78 18.09 17.21 16.02 18.09 16.26 16.77 17.33 15.72 16.84 16.88 18.07 16.98 17.41 16.32 16.31 17.05 17.4 17.76 17.45 16.73 16.74 17.08 17.83 16.9 A0A0G2K302 Ap3s2 1 133.8188281 683402 - 133.8188281 133.855184 adaptor-related protein complex 3 subunit sigma 2 None DDNICNFLEGGSLIGGSDYK None None None 18.71 18.01 18.9 18.81 17.26 18.22 18.33 17.9 19.42 19.31 18.25 16.94 18.53 19.1 18.58 16.71 17.67 18.04 19.02 16.82 18.7 18.29 18.31 17.51 17.51 16.93 18.23 18.31 17.98 17.81 17.49 D4A1B2 Arpin 1 133.8623491 308765 - 133.8623491 133.873145 arpin None LPGTWDPTTHQGGSGVLLEGELVDVSR None None None 17.88 15.21 17.39 17.7 17.78 16.93 18.09 18.44 18.23 16.54 16.98 17.38 17.37 16.91 17.98 16.18 15.82 17.02 17.1 17.61 16.13 16.63 17.47 16.27 16.65 16.31 16.76 16.67 17.91 17.7 17.6 P14604 Echs1 1 194.8950391 100911186 + 194.8950391 194.903886 enoyl-coa hydratase None RLTRAVGKSLAMEMVLTGDR None None None 21.79 22.76 21.85 21.63 21.53 20.6 21.31 21.69 19.69 21.34 21.62 19.86 20.47 20.7 20.36 21.67 20.77 20.7 20.55 22.98 20.28 20.7 20.71 21.04 22.52 21.0 20.58 20.76 21.37 20.96 21.35 D4ACG8 Fuom 1 194.8895521 100911225 + 194.8895521 194.893027 fucose mutarotase-like None DKEKGLQTPIWDHYEYLLLK None None None 13.27 15.25 14.96 15.27 15.98 14.01 15.05 13.59 12.78 13.32 14.97 15.32 14.12 14.35 13.82 14.85 14.34 13.78 15.12 14.92 13.58 14.16 14.82 12.92 14.33 14.46 13.85 14.42 15.1 13.93 14.65 P56574 Idh2 1 134.0305741 361596 - 134.0305741 134.058 isocitrate dehydrogenase [nadp] None HRGKLDGNQDLIRFAQTLEK None 147650 4037 20.27 22.22 20.2 22.35 21.61 20.8 22.33 21.98 20.48 20.24 20.83 21.56 21.24 20.76 21.43 20.95 20.08 21.66 20.62 22.29 20.54 20.39 20.75 20.79 22.34 22.21 20.73 20.26 21.98 20.53 21.3 F1LSV0 Sema4b 1 134.1495371 293042 + 134.1495371 134.177775 semaphorin 4b None KQQCSFKGKDPKRDCQNYIK None None 8426 16.57 15.71 17.96 17.26 15.72 16.97 18.15 16.54 16.51 16.79 17.46 15.87 16.83 16.71 16.89 16.08 17.35 16.67 15.48 18.07 17.62 16.96 17.71 15.81 16.31 16.74 16.08 17.37 16.72 17.14 16.78 Q63616 Vps33b 1 134.2239681 64060 + 134.2239681 134.246968 vacuolar protein sorting-associated protein 33b None RAGLLTEQASGDTLTAVENK None 608552 6531 19.53 16.83 18.33 19.61 17.33 17.59 18.47 18.88 18.31 18.05 17.61 17.16 18.72 17.74 19.44 18.84 18.81 17.73 18.46 16.88 16.92 18.48 17.8 18.36 18.93 19.78 18.55 18.6 17.44 18.43 19.04 Q32PZ3 Unc45a 1 134.2819381 308759 - 134.2819381 134.296647 protein unc-45 homolog a None GNDRLKLLVLYSGEDDELLR None 611219 32423 17.35 14.79 17.6 16.24 16.35 16.74 17.0 16.19 16.72 17.03 18.29 16.33 16.97 17.21 17.31 16.58 16.75 16.94 16.97 15.75 17.54 17.2 17.02 17.15 16.14 15.96 17.62 17.07 14.95 17.32 17.6 D4A500 Hddc3 1 134.2994731 308758 + 134.2994731 134.301757 hd domain containing 3, isoform cra_b None QRRKDPEGTPYINHPIGVAR None None 12279 17.45 16.14 17.86 17.18 17.6 16.68 18.17 17.05 16.7 16.4 18.12 17.14 17.42 17.32 16.41 16.69 16.76 18.38 16.64 18.6 18.55 17.59 17.56 16.03 18.57 16.74 17.51 17.57 17.55 18.46 18.19 A0A0G2JWG1 Man2a2 1 134.3068211 308757 - 134.3068211 134.327315 alpha-mannosidase None VDQLIEGHQWLERNLGATPR None 600988 55954 15.24 13.57 15.5 15.79 14.38 14.86 15.46 16.33 14.46 14.92 16.28 14.88 15.14 15.15 14.5 14.91 15.27 15.43 15.03 15.64 15.97 15.24 14.79 14.28 16.42 14.67 14.8 16.79 15.07 15.9 16.37 G3V7Q7 Iqgap1 1 134.6795871 361598 - 134.6795871 134.769755 iq motif containing gtpase activating protein 1, isoform cra_b None FQPGETLTEILETPATNEQEAEHQR None 603379 74514 17.65 15.67 18.35 17.71 17.02 16.63 18.55 18.94 17.59 17.32 19.38 17.2 17.67 17.93 18.12 17.0 17.18 17.9 18.39 16.64 18.11 17.51 18.29 17.55 17.39 17.37 18.23 17.88 15.93 17.66 18.73 P42667 Sec11a 1 134.881461 65166 - 134.881461 134.909535 signal peptidase complex catalytic subunit sec11a None DNNAVDDRGLYKQGQHWLEK None None 55536 18.65 16.57 17.79 16.7 16.41 17.31 17.42 16.36 18.38 17.72 17.1 16.7 17.46 17.35 18.05 17.3 17.48 17.11 17.29 16.1 18.4 17.95 16.41 17.3 16.6 16.61 17.16 17.16 17.28 16.88 16.87 Q76KC6 Pde8a 1 135.1662381 308776 + 135.1662381 135.288024 phosphodiesterase None QLDLPVVMPVFDRNTCSIPK None 602972 1957 16.46 15.73 14.91 14.31 15.36 15.77 14.7 14.9 15.0 15.15 17.09 14.61 14.76 16.63 14.13 14.0 15.75 15.33 15.14 15.74 16.24 15.8 15.14 15.92 16.16 15.13 15.42 14.89 15.98 16.17 14.29 D4AE00 Ap3b2 1 135.4125351 308777 - 135.4125351 135.445023 ap-3 complex subunit beta None KVTATANLGRVPCGASDEYR None 602166 55837 20.56 21.56 20.85 20.13 19.03 20.45 20.72 19.6 20.5 20.95 19.33 19.95 20.65 20.84 21.19 20.1 20.36 20.28 20.75 19.0 21.18 20.96 20.56 20.13 19.67 21.47 20.84 21.02 19.22 19.76 20.2 O88801 Homer2 1 135.5677061 29547 - 135.5677061 135.659779 homer protein homolog 2 None EYVSEKLEAAERDNQNLEDK None 604799 3560 16.06 18.25 17.76 17.21 16.36 17.34 17.54 16.84 17.86 18.8 17.46 17.03 17.6 17.42 18.96 18.44 18.11 17.48 16.76 16.86 18.94 18.09 18.13 18.01 17.34 17.81 18.47 18.16 15.98 16.37 18.62 D4AD33 Ramac 1 135.708531 293058 + 135.708531 135.71441 rna guanine-7 methyltransferase-activating subunit None QEYLKRPPESPPIVEEWNSR None None 12088 17.28 14.99 18.04 17.69 16.92 15.91 16.43 17.56 16.95 16.56 16.9 15.45 16.86 17.53 15.53 15.83 16.15 17.48 16.7 17.69 16.36 16.44 16.94 17.1 15.65 17.59 16.85 16.11 17.23 17.3 17.43 Q505I4 C15orf40 1 135.7258731 100363116 - 135.7258731 135.732028 upf0235 protein c15orf40 homolog None QTKEPETPPPPTGPVATDSK None None None 17.12 17.05 17.03 17.03 18.23 16.49 17.65 16.32 15.89 18.33 17.97 17.07 17.95 17.96 15.84 16.82 17.28 17.33 16.83 18.35 16.81 17.81 16.99 17.03 17.57 16.89 17.3 18.29 15.87 17.98 17.3 Q923W4 Hdgfl3 1 135.8275381 252941 - 135.8275381 135.876719 hepatoma-derived growth factor-related protein 3 None YTSKKSSKQSRKSPGDEDDK None None 32196 20.12 19.08 20.62 20.38 20.38 19.65 20.54 20.18 20.82 19.17 19.35 20.81 20.64 20.4 20.65 19.72 19.4 20.4 20.47 21.05 21.73 20.37 20.63 19.21 21.09 20.51 21.17 21.06 19.82 20.89 21.49 O35180 Sh3gl3 1 136.12451 81921 + 136.12451 136.255664 endophilin-a3 None MSVAGLKKQFHKASQLFSEK None 603362 37723 19.57 18.64 19.31 18.72 17.6 19.35 19.16 19.04 18.62 20.78 18.73 18.32 19.5 19.38 18.67 19.17 20.31 19.17 18.53 19.66 18.96 20.43 19.33 19.71 18.4 19.56 19.5 20.15 17.65 19.27 18.51 D3ZXJ5 Efl1 1 136.6385131 308789 + 136.6385131 136.763619 elongation factor-like gtpase 1 None ILVSRSEDFQSSVWSGPAGR None None 11599 18.14 15.64 17.48 16.34 18.12 16.7 17.64 18.31 16.02 16.91 18.69 17.08 17.71 17.42 16.22 17.4 17.45 17.89 18.12 17.8 17.28 17.58 17.85 17.46 18.73 17.28 18.44 17.75 15.7 17.95 17.75 D3ZN38 Stard5 1 137.6061521 502348 + 137.6061521 137.616017 similar to star-related protein 1-4e, isoform cra_a None PSAAMKLISPRDFVDLVLVK None 607050 11346 16.8 17.38 16.07 16.24 16.19 16.3 16.67 16.4 15.12 15.48 16.92 15.17 15.99 15.78 15.06 16.31 15.77 17.08 15.78 17.23 16.3 16.5 15.73 15.73 17.46 16.74 15.83 15.8 16.56 15.79 15.59 D4A4I9 Il16 1 137.6179451 116996 - 137.6179451 137.707593 pro-interleukin-16 None PQVSEQQLKEAVAQAVEGVK None 603035 18157 15.85 16.56 16.73 16.59 17.11 16.53 15.56 17.28 17.18 15.44 15.81 17.32 16.86 15.45 15.17 17.62 16.97 16.93 17.84 16.27 16.02 17.19 16.45 16.68 17.12 16.96 17.35 17.84 15.61 17.12 17.67 Q5BJV3 Tlnrd1 1 137.8643421 308795 - 137.8643421 137.866359 mesoderm development candidate 1 None CVLLTQCLRDLAQHPDGSAK None None 11209 14.57 14.65 15.07 15.23 14.36 16.09 14.91 15.43 16.28 15.75 15.05 15.49 15.67 15.26 14.92 15.14 15.67 16.54 13.98 16.36 16.79 16.65 15.59 14.34 15.19 14.98 15.71 16.49 16.12 15.72 15.56 Q5U2R7 Mesd 1 137.8743291 308796 + 137.8743291 137.879999 lrp chaperone mesd None ITPPRKKKDIRDYNDADMAR None 607783 11347 19.72 17.64 19.53 19.06 18.97 19.13 19.49 19.54 18.84 19.79 21.07 18.73 20.11 19.45 18.57 18.79 18.94 19.73 18.84 21.13 19.22 20.15 19.62 19.1 18.63 19.31 19.92 19.47 18.88 20.25 19.61 P25093 Fah 1 138.5488441 29383 - 138.5488441 138.571427 fumarylacetoacetase None PKPRIGVAIGDQILDLSVIK None 276700 110 18.74 20.48 17.31 17.8 19.4 18.42 17.49 19.74 17.08 19.35 19.47 18.76 18.24 18.93 17.01 19.09 18.8 18.8 18.89 19.96 17.66 18.5 18.62 19.14 19.64 18.85 19.44 17.97 18.5 19.22 17.77 Q6DGF4 Zfand6 1 138.5810121 293067 - 138.5810121 138.651946 an1-type zinc finger protein 6 None VDSTSVDKAVSETEDLQGPR None 610183 10372 14.64 16.7 15.48 15.67 15.56 16.14 16.8 15.65 16.22 14.64 17.51 16.46 16.09 16.45 16.51 15.53 15.34 16.03 15.7 17.04 17.52 15.3 15.84 15.09 15.84 16.07 15.69 16.21 16.31 15.92 16.06 M0RDU0 F8a1 1 150.9573571 501661 + 150.9573571 150.95887 40-kda huntingtin-associated protein None AASCQLLARDYTGALAVFTR None None 128316 17.48 18.32 17.05 16.65 17.23 15.23 16.93 18.27 16.96 17.73 16.11 15.62 15.72 15.89 16.64 16.64 17.11 16.68 16.33 15.87 16.49 15.89 15.96 17.7 17.2 16.86 16.07 17.1 16.06 15.97 16.98 M0R919 Vbp1 1 1.0 681825 - 1.0 1.0 prefoldin subunit 3 None RKRRLKSQIPEIKQTLEILK None None None 19.01 20.96 20.53 19.32 19.02 19.14 19.7 18.87 18.17 18.09 18.66 18.68 18.59 18.28 17.71 19.28 18.98 19.15 18.9 20.13 18.13 20.5 18.34 18.26 19.95 19.48 18.79 19.67 18.97 18.46 18.93 P70627 Folh1 1 140.4281021 85309 - 140.4281021 140.501379 glutamate carboxypeptidase 2 None GAKGIILYSDPADYFVPGVK None 600934 55826 20.25 19.39 20.17 20.55 20.06 19.43 19.06 18.68 19.48 19.38 19.16 18.32 18.94 20.08 19.7 18.98 19.08 19.08 18.66 20.52 18.95 19.29 18.9 19.68 19.41 19.86 18.99 19.12 20.56 20.1 20.33 A0A0H2UHW6 Grm5 1 141.5428651 24418 + 141.5428651 141.88097 metabotropic glutamate receptor 5 mGluR5; mGlur5 None None None None 19.06 19.67 18.25 18.6 17.75 18.62 18.1 17.72 19.3 19.03 17.4 18.36 17.94 18.63 18.71 19.26 18.94 18.5 19.34 16.94 19.2 18.63 18.3 19.42 17.67 19.07 18.63 18.91 17.45 17.04 18.5 P31424 Grm5 1 141.5428651 24418 + 141.5428651 141.88097 metabotropic glutamate receptor 5 None ISSEEEEGLVRCVDGSSSFR None None 37354 19.02 19.78 18.21 18.71 18.14 18.28 18.24 18.01 19.14 19.04 17.56 18.4 18.16 18.77 18.96 19.46 19.03 18.52 19.45 17.04 19.01 18.57 18.43 19.5 18.11 19.5 18.69 18.97 17.66 17.07 18.63 F1M5N4 Me3 1 143.534141 361602 + 143.534141 143.731994 malic enzyme None DSFSLDTYTWPKEAMSVQKV None 604626 100773 19.57 22.13 19.58 18.47 20.88 20.08 19.64 20.59 19.74 21.58 21.86 20.92 20.6 20.95 18.79 20.83 20.95 21.13 20.97 21.48 21.45 21.44 20.66 21.28 19.67 20.75 21.28 21.61 19.25 19.94 21.46 Q5M808 Hikeshi 1 143.8215261 293103 - 143.8215261 143.849344 protein hikeshi None GCLVAGRLVQTAAQQVAEDK None None None 16.51 18.21 16.17 16.88 17.03 17.2 16.61 15.72 16.68 15.84 16.32 16.23 16.38 16.19 17.94 15.95 15.87 16.25 17.02 15.78 17.63 16.07 16.7 16.34 17.9 15.98 16.8 16.97 15.76 16.65 16.6 A0A0G2JTT2 Picalm 1 144.0565041 89816 + 144.0565041 144.137557 phosphatidylinositol binding clathrin assembly protein, isoform cra_a None LSNFLDKSGLQGYDMSTFIR None 603025 111783 21.35 20.3 20.32 20.83 20.9 19.23 19.32 21.11 19.87 19.95 19.16 20.31 20.34 20.23 19.71 20.17 19.86 20.96 20.24 19.73 19.49 19.91 20.05 20.16 20.82 21.47 20.56 20.46 20.92 20.3 20.82 O55012 Picalm 1 144.0565041 89816 + 144.0565041 144.137557 phosphatidylinositol-binding clathrin assembly protein None TRMTRISEFLKVAEQVGIDR None 603025 111783 21.44 20.69 20.08 20.77 20.92 18.99 19.32 21.14 19.82 20.31 19.05 20.1 20.18 20.22 19.52 20.15 19.83 20.94 20.36 19.76 19.42 19.9 19.82 20.12 20.72 21.65 20.53 20.49 20.89 20.11 20.8 Q66SY1 Picalm 1 144.0565041 89816 + 144.0565041 144.137557 clathrin-assembly lymphoid leukemia protein None SLTDRITAAQHSVTGSAVSK None 603025 111783 21.06 21.86 19.65 20.89 20.82 18.92 19.27 21.14 19.97 20.92 19.1 19.99 19.99 20.05 19.77 20.34 19.8 21.06 20.25 19.67 19.54 19.74 19.64 20.16 20.71 21.59 20.48 20.44 21.06 19.71 20.51 Q5HZA9 Tmem126a 1 144.4227031 293113 + 144.4227031 144.430627 transmembrane protein 126a None RQYKLLIKALQLPEPDLEIQ None 612988 11939 17.46 14.36 18.0 17.94 15.26 17.53 17.23 16.11 17.31 15.71 15.66 15.21 15.95 15.56 18.09 15.46 15.46 15.76 15.84 15.72 16.13 15.71 16.38 15.63 16.04 15.35 15.02 15.72 17.38 16.45 16.34 B5DFB1 Sytl2 1 144.273361 361604 - 144.273361 144.366671 synaptotagmin-like 2 None ENRGEMKLALQYVPEPSPGK None 612880 131343 15.72 18.08 14.86 16.19 16.69 14.56 16.12 16.95 15.3 16.24 17.33 16.38 15.67 15.91 14.25 16.34 16.64 16.65 16.8 16.19 15.83 15.8 16.07 15.92 16.6 17.02 16.28 17.3 14.61 16.02 15.62 Q63622 Dlg2 1 145.7788361 64053 + 145.7788361 146.499475 disks large homolog 2 None ARRVILDGDSEEMGVIPSKR None 600723 1046 20.9 19.24 20.29 20.42 20.15 20.47 20.74 19.79 21.11 20.02 20.36 21.01 21.04 21.15 20.95 20.67 20.05 20.58 20.44 20.89 21.17 20.26 20.83 20.69 20.04 20.58 20.46 21.19 19.16 20.54 20.79 Q4V897 Ccdc90b 1 146.6327571 308820 + 146.6327571 146.646308 coiled-coil domain-containing protein 90b None TKSIISETSNKIDTEIASLK None None 23328 15.95 17.32 17.47 16.83 18.24 15.36 16.75 17.14 15.97 18.31 17.37 16.47 17.94 17.3 15.75 16.43 16.89 18.17 17.62 16.97 17.53 16.23 16.58 18.28 18.0 16.78 17.46 15.51 17.01 16.18 18.5 D3ZY40 Pcf11 1 146.698121 361605 - 146.698121 146.723442 pcf11 cleavage and polyadenylation factor subunit None EKSKSGERITKKELDQLDSK None None 21644 15.93 15.69 17.44 18.1 16.63 15.52 16.5 16.85 16.67 15.3 16.42 16.8 16.62 15.81 16.37 16.99 17.43 16.18 17.54 15.45 15.71 16.21 16.12 14.9 17.92 16.42 17.37 17.41 16.91 17.48 18.01 A0A0G2JTT4 Rab30 1 146.8036341 308821 + 146.8036341 146.890406 rab30, member ras oncogene family None EAQDMYYLETSAKESDNVEK None 605693 22815 20.72 22.84 20.58 20.33 20.49 20.76 21.1 21.2 21.46 21.91 19.66 21.19 20.27 19.78 21.76 21.92 20.73 20.63 20.97 19.64 20.24 20.87 20.08 20.42 19.13 21.22 20.28 20.87 21.31 19.9 20.65 D4AA31 Prcp 1 146.9314881 293118 + 146.9314881 146.983883 prolylcarboxypeptidase None SYSVHYFQQKVDHFGFSDTR None 176785 55867 15.18 14.58 15.3 14.69 15.35 15.31 15.93 15.45 14.23 14.94 15.6 15.35 16.47 15.5 14.63 15.73 15.81 15.45 16.19 15.59 16.23 14.84 15.52 16.03 17.2 16.1 14.59 14.63 16.43 15.47 15.49 F1LZ38 Tenm4 1 150.7803821 308831 + 150.7803821 151.259144 teneurin transmembrane protein 4 None LILWEKRTAVLQGYEIDASK None None None 18.14 18.64 18.81 19.34 17.13 17.35 17.35 17.26 18.1 18.34 17.86 17.16 17.5 17.46 19.09 17.65 18.08 17.89 16.97 17.7 18.02 19.16 17.88 17.97 17.58 18.3 17.88 18.66 17.92 16.73 17.4 A0A0G2K7D7 Nars2 1 151.3004511 293128 + 151.3004511 151.410952 asparaginyl-trna synthetase 2 None GFGMGFERYLQCILGVDNIK None 612803 57002 17.88 18.41 17.11 18.18 18.59 16.43 17.91 16.85 17.52 17.06 17.06 16.63 16.84 16.79 18.19 18.41 17.85 17.57 17.48 16.36 16.88 17.69 17.08 18.12 19.04 18.73 17.11 17.86 16.6 17.32 17.29 F1LNQ5 Nars2 1 151.3004511 293128 + 151.3004511 151.410952 asparagine--trna ligase None RQNVELKAEKIEVVGTCEAK None 612803 57002 17.38 18.23 17.33 18.29 18.58 16.69 17.3 17.64 17.31 16.65 17.53 16.74 17.13 16.95 18.61 17.78 17.19 17.53 17.17 16.78 16.78 17.12 16.94 18.88 19.06 18.26 17.58 17.39 16.38 17.48 17.71 Q9EQH1 Gab2 1 151.4299431 84477 + 151.4299431 151.593935 grb2-associated-binding protein 2 None HTKSSLTGSETDNEDVYTFK None 606203 69067 16.38 14.75 15.46 15.8 16.38 15.21 17.1 15.88 14.7 16.6 16.14 16.35 16.1 15.95 14.19 15.58 15.55 16.67 16.59 16.23 15.1 16.93 16.47 15.21 15.67 15.91 15.93 16.01 14.36 16.37 15.63 F1M8S4 Usp35 1 151.6271071 308834 - 151.6271071 151.642848 ubiquitin-specific peptidase 35 None EKEGDSLGPGTRKDAATPPR None None 35459 16.5 15.65 15.97 16.06 15.44 15.2 16.52 16.42 16.12 17.5 15.53 15.39 16.84 17.02 15.27 15.89 16.62 16.82 16.66 15.08 15.11 16.82 15.74 16.2 15.9 17.08 15.83 15.86 15.77 16.49 15.76 Q5PQZ9 Ndufc2 1 151.7119661 293130 + 151.7119661 151.718187 nadh dehydrogenase [ubiquinone] 1 subunit c2 None SFFFAGYFYLKRQNYLYAVR None None 3344 20.17 21.74 19.83 19.44 19.92 19.73 20.3 20.34 20.0 21.45 18.73 19.81 19.51 19.71 20.18 21.3 20.27 19.77 20.91 20.28 19.64 20.5 19.56 20.15 20.22 21.4 20.49 20.25 19.79 19.45 19.96 D3ZZQ6 Ints4 1 151.7900511 308837 + 151.7900511 151.853832 integrator complex subunit 4 None CCTNVSTKEGIHLALVELLK None None 69427 14.84 16.66 15.56 14.88 14.8 15.03 14.11 15.02 15.73 14.11 15.75 15.24 14.34 15.58 14.76 14.96 15.12 16.13 15.29 15.04 16.61 15.41 14.62 14.75 16.03 14.38 16.46 15.65 15.35 15.17 15.57 D3ZZQ4 Aamdc 1 151.8619991 361606 - 151.8619991 151.876366 adipogenesis-associated, mth938 domain-containing None QPADVKEVAEKGVQTLVIGR None None None 17.97 16.89 17.41 17.96 17.77 17.45 17.37 18.39 16.41 16.22 16.99 15.61 16.42 16.06 16.79 17.03 16.65 17.82 16.88 17.79 15.68 16.6 16.54 16.43 18.35 17.53 15.83 16.83 18.47 17.25 17.88 D3ZGQ8 Rsf1 1 151.892261 308839 + 151.892261 152.005293 remodeling and spacing factor 1 None PPPDIGHGEVPKELVELHLK None 608522 41142 16.12 14.98 17.09 16.59 16.38 15.76 16.49 16.12 16.72 15.07 15.63 16.69 16.73 16.62 16.97 16.0 15.63 16.15 16.05 17.22 17.71 16.64 16.45 16.69 17.36 16.42 17.34 16.94 14.59 16.89 17.87 Q04753 Clns1a 1 152.0193931 65160 + 152.0193931 152.039665 methylosome subunit picln None VSRDPNAYPQEHLYVMVNAR None 602158 990 16.26 14.17 15.98 15.78 15.84 16.59 16.82 15.97 16.22 15.98 15.4 16.01 15.93 15.1 14.61 15.29 15.66 16.08 15.34 17.04 15.2 15.77 16.16 15.24 14.2 15.03 15.27 14.72 16.23 16.35 15.98 P35465 Pak1 1 152.1112111 29431 + 152.1112111 152.226389 serine/threonine-protein kinase pak 1 None SKRSTMVGTPYWMAPEVVTR None 601032 1936 21.23 19.54 21.18 20.52 20.17 21.0 21.22 20.66 21.0 20.35 20.05 19.89 20.83 20.61 19.96 19.3 20.38 20.93 19.47 21.68 20.97 21.6 21.38 19.84 20.25 21.13 19.75 20.82 20.71 20.44 20.57 Q8CJE3 Myo7a 1 152.3444491 266714 - 152.3444491 152.414157 myosin viia None ITRGETVSTPLSREQALDVR None None None 18.68 16.84 17.14 18.56 18.89 17.31 18.99 19.23 17.58 17.99 17.66 17.69 18.31 17.45 19.55 19.04 18.81 17.55 17.6 17.38 17.18 17.33 18.34 17.59 19.04 19.81 17.11 18.06 19.43 17.82 19.27 G3V7U6 Capn5 1 152.4162431 171495 - 152.4162431 152.472828 calpain-5 None VQVWNHRVLKDEFLGQVHLK None 602537 31212 18.74 18.84 17.93 18.27 17.54 18.22 18.76 18.8 17.32 18.51 18.78 18.0 18.35 18.52 17.87 18.21 17.95 18.09 17.52 19.3 17.27 17.38 18.07 19.22 17.6 18.31 17.13 17.74 17.36 18.13 16.6 Q8R4C0 Capn5 1 152.4162431 171495 - 152.4162431 152.472828 calpain-5 None VQVWNNRVLKDEFLGQVHLK None 602537 31212 18.19 18.85 17.59 17.98 17.06 18.04 18.38 18.4 17.04 17.98 18.17 17.7 17.9 18.29 17.64 17.9 17.57 17.85 17.22 18.99 17.27 16.95 17.68 19.03 17.5 18.48 16.86 17.54 17.0 17.87 16.24 P08523 Omp 1 152.4402791 24612 - 152.4402791 152.440828 olfactory marker protein None PLVLDQDLTKQMRLRVESLK None 164340 36195 16.97 17.14 18.36 18.25 17.6 16.87 16.9 17.21 18.01 17.93 17.27 16.89 17.17 16.91 17.97 17.16 16.32 17.97 17.22 18.32 18.38 18.2 17.7 17.52 18.0 17.21 18.55 17.59 17.15 16.78 18.77 D3ZKE1 Uvrag 1 153.1853711 308846 - 153.1853711 153.442199 similar to uv radiation resistance associated, isoform cra_d None LDFGIMPDRLDTSVSCFVVK None None None 17.69 16.36 17.01 17.42 17.16 15.06 16.61 17.28 16.72 16.24 17.32 15.94 16.15 17.88 17.47 17.11 17.86 16.92 17.18 15.59 16.59 16.48 16.61 17.82 18.34 17.96 17.78 16.44 16.51 16.88 17.03 Q63560 Map6 1 153.568251 29457 + 153.568251 153.634414 microtubule-associated protein 6 None SGLGLGAASGSTSGSGPADSVMR None None 7850 21.84 23.23 21.49 22.03 23.02 20.74 21.12 22.1 21.01 22.86 22.17 21.64 22.23 22.04 20.4 21.73 21.99 21.8 22.17 23.31 21.46 21.57 21.45 21.85 22.34 22.88 21.74 21.32 23.68 22.53 21.31 P29457 Serpinh1 1 153.6435091 29345 - 153.6435091 153.650815 serpin h1 None AAAPGTAEKLSSKATTLAER None None 20331 19.72 19.78 19.56 19.26 18.86 18.51 19.7 20.6 18.69 18.5 21.01 19.24 19.02 19.98 19.97 18.98 19.55 19.8 19.27 18.21 19.31 19.07 18.24 20.02 20.0 18.64 19.96 19.32 17.68 18.8 20.31 Q5RJR9 Serpinh1 1 153.6435091 29345 - 153.6435091 153.650815 collagen-binding protein None TVGVTMMHRTGLYNYYDDEK None None 20331 19.53 20.04 19.56 19.41 19.07 18.33 19.73 20.72 18.67 18.5 20.96 19.22 19.02 20.05 19.9 18.89 19.57 19.79 19.41 18.16 19.01 18.89 18.33 19.92 20.17 18.73 20.0 19.36 17.68 18.8 19.96 G3V9L7 Gdpd5 1 153.7230631 499211 + 153.7230631 153.761088 glycerophosphodiester phosphodiesterase domain-containing 5 None KGNATLLLNLRDPPHDHPYR None 609632 32741 14.91 16.89 15.53 15.12 14.84 14.35 14.26 14.55 15.9 16.47 14.95 14.36 14.31 15.61 15.46 13.81 13.89 15.87 15.19 15.75 16.51 16.04 14.45 15.16 15.54 15.05 16.42 15.16 15.3 14.88 14.92 P62909 Rps3 1 153.7783741 140654 - 153.7783741 153.783663 40s ribosomal protein s3 None QNVLGEKGRRIRELTAVVQK None 600454 779 20.24 19.76 19.81 20.81 21.44 20.59 18.75 20.48 20.5 19.21 20.13 20.21 20.83 19.46 21.59 19.54 20.06 20.07 19.81 19.98 19.13 20.37 19.76 20.98 19.34 20.62 20.95 19.31 21.04 19.4 22.0 P29066 Arrb1 1 153.8380181 25387 + 153.8380181 153.928829 beta-arrestin-1 None RKVQYAPERPGPQPTAETTR None 107940 2981 19.89 17.22 19.93 20.5 18.44 19.69 20.47 18.23 18.8 18.83 19.9 17.84 19.39 18.45 18.71 19.05 20.26 18.95 19.05 19.68 19.4 20.33 20.1 18.08 19.92 20.26 18.37 19.73 19.46 19.62 19.65 Q9JHI3 Slco2b1 1 153.9592941 140860 - 153.9592941 154.007278 solute carrier organic anion transporter family member 2b1 None GGASIGSKGEELSSQHEPLK None None 21419 16.7 15.57 15.8 16.67 16.45 17.5 16.88 17.08 17.43 16.91 16.65 16.38 16.77 17.28 17.62 17.07 18.11 16.8 17.1 15.59 17.69 17.45 18.31 17.93 18.46 17.69 17.31 15.97 17.27 17.11 16.91 D3ZD11 Spcs2 1 154.1637251 293142 - 154.1637251 154.183152 microsomal signal peptidase 25 kda subunit None TSSSRSGLLDKWKIDDKPVK None None 8842 19.23 17.02 19.57 19.02 18.6 18.28 19.19 18.64 18.0 17.51 19.72 18.24 19.15 19.03 19.65 18.8 19.1 18.68 19.1 17.89 18.49 19.32 19.01 18.41 20.1 18.84 18.8 18.71 18.71 19.66 19.19 F6T1W7 Pold3 1 154.4179171 293144 - 154.4179171 154.45775 dna polymerase delta subunit 3 None NKDTKTEAREVTSASSAGGK None None 38202 14.25 13.95 15.22 16.84 15.18 15.05 13.87 14.77 14.96 14.34 13.61 15.83 14.92 15.12 15.34 14.36 14.79 14.23 16.52 14.41 14.38 14.4 14.89 15.16 15.45 15.53 16.38 14.89 14.78 15.12 16.37 D3Z955 Pgm2l1 1 154.5717671 685076 + 154.5717671 154.620902 phosphoglucomutase 2-like 1 None NDNLVDTSPLKKDPLQDICR None 611610 12374 20.88 19.43 19.65 19.07 19.99 21.23 20.6 21.14 19.89 20.24 19.46 20.16 21.23 19.99 18.96 21.64 20.17 21.77 20.34 20.5 20.26 19.48 20.6 20.0 20.71 22.07 20.36 20.83 20.06 20.1 20.02 Q4FZT2 Ppme1 1 154.66811 361613 - 154.66811 154.715079 protein phosphatase methylesterase 1 None YWDGWFRGLSNLFLSCPIPK None 611117 6099 19.06 17.49 17.32 18.14 19.54 18.65 18.53 18.12 18.45 18.64 18.21 18.95 19.29 18.72 17.52 17.92 18.01 19.67 19.79 18.56 19.87 18.48 19.08 18.12 19.1 19.61 20.42 18.97 17.77 19.16 19.31 D3ZDX7 Mrpl48 1 154.8966641 293149 - 154.8966641 154.939261 mitochondrial ribosomal protein l48 None HRLCNQLSIKVEESYAMPTK None 611853 32294 16.93 18.27 16.13 16.88 16.35 17.29 15.3 17.65 16.21 15.44 16.87 17.3 16.08 16.08 17.56 16.85 17.0 16.35 17.16 15.71 16.94 17.52 16.13 17.58 18.33 17.75 17.77 17.64 16.76 15.96 17.99 A0A0H2UHP9 Rab6a 1 154.9579561 84379 + 154.9579561 154.997085 rcg39700, isoform cra_d None RGSDVIIMLVGNKTDLADKR None 179513 55697 21.14 21.99 20.35 19.62 21.34 20.99 21.66 20.69 19.86 22.02 19.31 21.12 20.99 19.91 19.27 21.7 19.96 21.05 21.49 21.67 20.11 20.37 20.06 21.11 20.23 21.04 20.77 19.7 20.1 20.37 20.62 Q9WVB1 Rab6a 1 154.9579561 84379 + 154.9579561 154.997085 ras-related protein rab-6a None DSTVAVVVYDITNVNSFQQTTK None 179513 55697 21.13 22.14 20.4 19.71 21.44 20.97 21.8 20.7 19.76 21.99 19.31 21.19 20.92 19.86 19.29 21.63 19.89 21.14 21.54 21.62 20.07 20.37 20.02 21.03 20.27 20.98 20.69 19.79 20.15 20.3 20.62 Q6AZ73 Plekhb1 1 154.9988031 64471 - 154.9988031 155.013099 pleckstrin homology domain containing, family b (evectins) member 1, isoform cra_d None NVRDIKVGQECQDVQPPEGR None 607651 8449 18.13 15.13 17.37 17.07 17.75 16.28 16.22 17.49 16.35 16.44 17.68 16.26 16.57 15.68 17.46 16.9 15.85 16.88 16.3 17.61 16.3 16.43 16.62 17.33 17.47 16.14 17.41 15.91 16.61 17.62 16.63 Q9WU68 Plekhb1 1 154.9988031 64471 - 154.9988031 155.013099 pleckstrin homology domain-containing family b member 1 None VYSPYQDYYEVVPPNAHEATYVR None 607651 8449 17.05 14.65 17.22 17.06 17.72 15.89 16.33 17.52 16.2 16.29 17.53 16.11 16.77 15.68 16.78 16.72 15.52 16.56 16.59 17.58 15.89 16.22 16.89 17.24 17.32 15.99 17.2 15.47 16.4 17.3 16.21 A0A0G2JXT9 Arhgef17 1 155.2342881 - 155.2342881 155.289741 rho guanine nucleotide exchange factor 17 None GSEDFRLSSGSGSSSETVGR None None None 16.29 18.17 17.52 17.11 16.21 16.18 17.18 16.45 16.6 17.68 16.73 16.02 16.41 16.33 17.46 17.18 16.22 17.86 17.16 16.14 17.77 17.57 16.95 18.25 17.37 16.71 16.58 16.52 16.09 15.88 16.4 A0A0G2K219 Fchsd2 1 155.444461 308864 + 155.444461 155.685539 fch and double sh3 domains 2 None MEDWVKARNKVGQVGYVPEK None None 8887 15.79 16.69 17.22 16.83 16.09 15.49 17.06 16.84 15.46 15.36 15.31 14.75 15.11 14.89 16.75 15.72 17.05 15.11 15.1 14.71 14.78 15.68 16.18 14.94 15.79 16.57 14.81 16.31 15.33 15.18 14.91 A0A0G2KB11 Stard10 1 155.7183881 293150 + 155.7183881 155.747098 star-related lipid transfer domain-containing 10 None PKGSLPKWVVNKSSQFLAPK None None 4841 16.55 17.68 17.42 17.57 17.65 16.08 17.29 17.1 16.79 17.51 17.31 16.26 17.82 17.19 16.01 16.16 16.84 17.92 17.67 18.66 18.65 17.61 18.12 17.02 18.8 17.59 18.22 18.18 15.77 17.2 17.09 F1LM60 Arap1 1 155.7675961 361617 + 155.7675961 155.814241 arfgap with rhogap domain, ankyrin repeat and ph domain 1 None VAGTASGTQHAGDFICTVYLEEK None 606646 None 16.71 17.25 17.14 16.99 18.09 16.44 17.66 17.9 17.66 16.35 17.05 17.86 17.45 18.06 16.98 16.89 16.47 17.23 17.99 18.01 18.22 16.28 16.57 16.78 18.09 16.95 17.9 18.3 15.9 17.78 18.63 A0A0G2K876 Pde2a 1 155.823631 81743 + 155.823631 155.915444 phosphodiesterase None LQNMLGCELRAMLCVPVISR None None 1952 20.4 19.97 20.68 20.05 19.11 20.55 20.04 19.66 20.78 19.82 19.59 19.61 20.04 20.19 20.13 20.03 20.74 19.49 20.32 18.7 19.52 21.14 19.97 20.34 18.85 20.17 19.83 20.84 18.65 19.57 19.32 Q01062 Pde2a 1 155.823631 81743 + 155.823631 155.915444 cgmp-dependent 3',5'-cyclic phosphodiesterase None RMLDLMRDIILATDLAHHLR None None 1952 20.41 19.95 20.68 20.05 19.11 20.55 20.04 19.66 20.78 19.82 19.59 19.61 20.04 20.18 20.15 20.02 20.77 19.47 20.32 18.72 19.52 21.15 19.97 20.37 18.85 20.17 19.81 20.84 18.66 19.57 19.32 A0A0G2K3V9 Clpb 1 156.0288471 65041 + 156.0288471 156.151522 caseinolytic peptidase b protein homolog None RWLGVPVGVLVTREDDFNNR None None 32067 18.41 20.53 18.6 18.83 17.93 18.88 18.58 18.05 17.87 18.84 18.52 17.82 17.91 19.51 20.02 17.89 18.72 18.24 18.47 17.66 18.4 19.19 18.05 18.89 20.02 19.57 19.72 18.72 17.75 18.56 18.38 Q9WTT2 Clpb 1 156.0288471 65041 + 156.0288471 156.151522 caseinolytic peptidase b protein homolog None SVYKTANEQGVHSLEVLVTR None None 32067 18.5 20.04 18.35 18.75 17.76 18.39 18.24 17.9 17.31 18.87 18.54 17.91 17.95 19.18 19.9 17.87 18.7 18.13 18.37 17.57 18.95 19.61 18.0 18.89 19.9 19.44 19.81 18.69 17.53 18.85 18.33 Q9WVR3 Inppl1 1 156.1847611 65038 - 156.1847611 156.1975 phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 None SFPPTYRYERGSRDTYAWHK None 600829 1204 17.87 14.89 18.23 17.21 17.21 17.27 17.5 16.74 17.56 16.81 18.04 15.94 16.67 16.07 17.32 16.02 17.54 17.08 17.97 15.56 17.86 18.0 17.8 16.62 17.74 16.35 17.92 17.37 16.14 17.78 17.41 G3V8M6 Folr1 1 156.2194641 171049 - 156.2194641 156.228414 folate receptor 1 (adult), isoform cra_b None RILDVPLCKEDCVLWWEDCK None 136430 7322 14.19 14.31 13.99 14.49 14.71 15.79 16.08 14.14 14.67 14.5 15.43 16.65 16.17 15.31 15.42 15.36 14.91 15.68 15.84 13.82 14.94 15.26 15.97 14.61 14.02 15.11 15.28 14.53 14.49 15.26 14.31 Q6P791 Lamtor1 1 156.2721171 100361543 + 156.2721171 156.277687 ragulator complex protein lamtor1 None LPPLPSLTSQPHQVLASEPIPFSDLQQVSR None None None 17.45 15.16 17.61 17.96 17.3 15.09 16.6 17.09 17.11 17.87 16.7 15.94 16.68 16.84 15.68 16.18 16.95 17.46 16.9 15.85 15.7 16.47 17.0 16.37 16.29 15.56 15.65 17.16 16.96 17.21 16.77 F1LW91 Numa1 1 156.3332831 308870 + 156.3332831 156.372855 nuclear mitotic apparatus protein 1 None EWAEKQAHLESELSTALQDK None 164009 38150 18.69 17.47 19.7 18.63 18.9 18.43 17.97 18.87 19.11 17.6 18.67 18.75 18.66 18.83 20.05 17.92 18.94 18.96 18.73 17.73 20.41 18.83 18.8 19.87 19.86 18.49 19.54 17.7 19.18 19.4 20.29 F7FF45 Numa1 1 156.3332831 308870 + 156.3332831 156.372855 nuclear mitotic apparatus protein 1 None QWQQQQQQVEGLTHSLESER None 164009 38150 18.71 17.41 19.69 18.63 18.91 18.43 17.98 18.85 19.17 17.6 18.66 18.74 18.72 18.84 20.04 17.91 18.94 18.95 18.77 17.72 20.41 18.84 18.85 19.81 19.86 18.46 19.57 17.7 19.2 19.41 20.25 P49793 Nup98 1 156.4944241 81738 - 156.4944241 156.591415 nuclear pore complex protein nup98-nup96 None YGLNQLLEPRSITADPLDYR None 601021 35472 17.32 17.33 17.83 17.16 17.24 17.77 17.07 16.98 17.97 16.79 17.97 17.99 17.19 18.13 17.57 16.63 17.92 17.83 18.38 15.98 19.41 17.72 17.03 17.95 17.76 16.46 17.97 16.9 18.27 17.64 19.46 Q32PX6 Rhog 1 156.6178151 308875 - 156.6178151 156.630238 ras homolog family member g None RLKEQGQAPITPQQGQALAK None None 68196 21.11 19.26 19.75 19.54 20.79 20.85 20.28 20.78 19.4 20.59 21.68 19.34 20.37 20.08 20.21 20.62 20.31 20.17 19.24 21.24 19.55 20.2 20.63 20.04 21.28 19.81 20.27 18.89 21.62 21.51 19.04 P84903 Stim1 1 156.656031 361618 + 156.656031 156.818785 stromal interaction molecule 1 None VEVEKVHLEKKLRDEINLAK None 605921 20681 17.62 18.99 18.24 17.65 18.38 16.5 17.22 18.86 18.01 17.35 18.28 18.19 18.56 18.73 19.18 17.87 16.8 18.45 18.75 18.41 18.63 18.01 16.64 19.32 18.84 18.75 18.38 18.09 17.93 18.25 19.77 Q5U2Q5 Rrm1 1 156.8238371 685579 + 156.8238371 156.848262 ribonucleoside-diphosphate reductase None GAFIDQSQSLNIHIAEPNYGK None None None 16.56 15.12 16.26 16.86 17.61 17.07 16.9 17.16 15.39 15.83 16.54 17.38 17.08 15.85 15.56 15.96 16.68 17.93 16.42 16.41 16.17 17.0 17.19 17.39 17.64 16.23 17.14 15.7 16.03 16.75 17.44 D4ACF2 Trim21 1 156.9649221 308901 - 156.9649221 156.987459 ring-type e3 ubiquitin transferase None CAQSGKHRDHTKVPIEEAAK None 109092 2365 15.69 17.87 16.05 15.43 15.76 16.44 15.35 16.45 14.93 16.62 15.87 15.76 15.5 15.36 14.77 16.26 15.51 17.31 16.69 16.54 17.45 16.74 15.31 16.92 16.78 17.17 17.16 16.08 15.18 16.24 15.94 A0A0G2JTW9 Hbb-bs 1 158.2346731 103694857 + 158.2346731 158.247207 hemoglobin, beta adult s chain None HGKKVINAFDDGLKHLDNLK None None None 25.14 24.68 24.5 25.04 24.59 22.87 26.22 25.97 24.15 24.84 25.31 24.3 23.8 24.61 23.1 24.77 24.93 24.75 24.98 24.81 23.96 23.5 23.63 24.64 24.39 25.33 23.47 24.52 23.96 24.13 25.52 Q62669 Hbb-b1 1 158.2241711 103694855 - 158.2241711 158.23163 globin a1 None FGSLSELHCDKLHVDPENFR None None None 25.11 24.68 24.49 25.02 24.6 22.85 26.11 25.98 24.16 24.85 25.3 24.29 23.87 24.59 23.19 24.8 25.04 24.62 24.93 24.83 23.93 23.53 23.6 24.78 24.4 25.33 23.39 24.5 24.0 24.08 25.51 P11517 Hbb2 1 158.2443461 100134871 + 158.2443461 158.245073 hemoglobin subunit beta-2 None ATVSGLWGKVNADNVGAEAL None None 68066 26.26 26.09 25.68 26.23 25.6 24.37 27.29 27.09 25.53 25.81 27.05 25.75 25.13 26.1 24.17 25.83 26.1 26.2 26.07 26.03 25.29 24.63 25.29 26.18 25.28 26.04 24.88 25.57 24.87 25.3 26.19 A0A0G2JSW3 Hbb 1 158.2504271 24440 - 158.2504271 158.251877 globin a4 None RYFDSFGDLSSASAIMGNPK None 141900 68066 26.13 25.55 25.64 26.11 25.62 24.37 27.19 27.12 25.37 25.84 27.23 25.93 25.46 26.2 24.19 25.87 26.02 26.23 26.07 26.36 25.4 24.75 25.43 26.38 25.4 26.0 25.12 25.52 24.69 25.65 26.3 P02091 Hbb 1 158.2504271 24440 - 158.2504271 158.251877 hemoglobin subunit beta-1 None DDVGGEALGRLLVVYPWTQR None 141900 68066 26.13 25.54 25.64 26.15 25.65 24.37 27.2 27.13 25.36 25.84 27.23 25.93 25.47 26.17 24.19 25.88 26.02 26.23 26.07 26.36 25.34 24.73 25.45 26.36 25.41 26.0 25.11 25.53 24.7 25.65 26.3 O88752 Hbe1 1 158.2829411 293267 - 158.2829411 158.284342 epsilon 1 globin None KNLDNLKSALAKLSELHCDK None 142100 110794 21.69 23.9 21.47 21.41 20.85 21.0 23.29 22.15 21.84 22.44 22.59 22.33 21.3 22.55 20.25 22.05 22.09 22.3 22.12 22.25 22.37 21.88 21.24 22.26 20.49 21.69 21.36 21.48 20.73 21.24 21.4 Q6AYT1 Trim5 1 158.7204391 308906 - 158.7204391 158.808531 similar to 9230105e10rik protein None RTYWQNQIQKDVENVQSEFK None None None 14.85 16.71 14.62 14.91 15.69 14.2 14.9 16.26 15.63 15.77 16.56 15.98 15.45 16.44 16.13 16.16 14.92 16.08 16.18 15.06 16.33 15.73 15.1 15.29 15.58 16.08 16.01 16.69 15.36 15.29 15.99 Q66H54 Fam160a2 1 159.7223271 293343 - 159.7223271 159.748401 fts and hook-interacting protein None LIARGKLDWAEGPTAGPTPR None None 75329 16.13 14.97 16.59 15.57 15.09 14.92 15.99 15.87 16.8 16.52 15.76 16.06 16.2 17.11 15.26 14.95 15.69 16.77 16.82 14.48 16.55 16.33 16.33 16.24 14.87 16.13 15.78 15.77 16.1 16.27 15.92 Q9Z1H9 Cavin3 1 159.8265641 85332 - 159.8265641 159.828385 caveolae-associated protein 3 None EKLATMLEALRERQGGLAER None None 12490 16.9 15.12 17.43 15.84 17.24 16.96 17.09 17.8 17.45 17.24 18.54 16.34 17.08 18.09 16.02 15.41 17.73 17.06 17.66 16.5 16.91 16.62 16.9 18.52 16.58 15.4 16.56 15.87 16.28 17.58 18.39 Q5XIA6 Smpd1 1 159.8929471 308909 + 159.8929471 159.896788 sphingomyelin phosphodiesterase None LNYGLKKEPNVARVGSVAIK None 607608 457 17.87 17.7 18.43 18.45 16.32 17.86 17.24 16.82 18.18 16.32 16.11 15.58 16.12 16.11 17.28 16.73 18.21 16.18 16.24 15.99 16.27 17.06 16.35 15.83 16.82 16.41 15.99 16.68 18.44 16.1 16.7 P46933 Apbb1 1 159.8968741 29722 - 159.8968741 159.91332 amyloid-beta a4 precursor protein-binding family b member 1 None VQDTSGTYYWHIPTGTTQWEPPGR None 602709 898 17.28 17.72 18.07 17.17 18.56 17.22 17.77 17.99 16.6 17.27 17.41 17.89 17.68 18.44 18.4 18.69 18.17 18.07 17.91 16.45 17.01 17.74 17.41 17.89 19.19 19.18 18.24 18.21 17.21 17.82 18.62 P20059 Hpx 1 159.9327451 58917 - 159.9327451 159.940334 hemopexin None GNCTAALRWLERYYCFQGNK None 142290 511 20.24 19.23 20.07 21.36 20.45 20.27 21.29 20.78 20.69 20.76 20.96 20.95 20.67 20.23 20.92 20.21 20.54 20.04 19.7 20.55 21.19 19.01 21.07 21.04 18.89 19.93 19.29 19.83 20.34 19.5 19.89 G3V8D6 Trim3 1 159.9508991 83616 - 159.9508991 159.9736 tripartite motif protein 3, isoform cra_a None SPGQLQRPTGVAVDTNGDIIVADYDNR None 605493 21290 19.66 17.09 19.71 18.19 18.95 19.55 18.91 19.11 19.57 17.36 18.29 18.95 19.35 19.28 19.67 18.01 19.63 18.96 18.8 17.13 19.4 18.6 18.67 18.59 19.43 18.46 18.55 19.82 18.73 19.37 19.88 O70277 Trim3 1 159.9508991 83616 - 159.9508991 159.9736 tripartite motif-containing protein 3 None GRGATDRHFAGPHFVAVNNK None 605493 21290 19.7 17.09 19.61 17.91 18.86 19.52 18.37 19.08 19.24 17.25 17.91 18.58 19.05 18.49 19.66 18.95 19.34 18.8 18.6 16.94 18.46 18.36 18.18 18.65 19.29 18.49 18.63 19.45 18.55 19.02 19.8 Q6AY65 Arfip2 1 159.9756561 293344 - 159.9756561 159.980336 arfaptin-2 None ARLEYDAYRTDLEELSLGPR None None 8234 18.39 20.22 18.56 17.86 17.91 19.44 18.86 16.8 19.1 18.58 18.14 18.98 17.89 18.99 16.92 17.66 18.47 18.45 18.63 18.72 19.24 19.32 17.46 18.97 17.29 17.06 18.5 17.4 18.68 17.91 18.56 Q9R1B1 Timm10b 1 159.9804991 84384 + 159.9804991 159.983373 mitochondrial import inner membrane translocase subunit tim10 b None LHHRALDAEEEACLHSCAGK None 607388 8142 15.15 14.57 15.87 16.89 16.41 16.04 16.98 15.16 16.59 16.51 15.65 16.61 16.86 15.16 16.12 17.39 15.32 15.27 16.92 17.05 15.63 16.12 16.91 15.92 14.57 15.75 16.42 15.59 15.04 16.12 16.04 A0A096MJU2 Dnhd1 1 159.9805331 690115 + 159.9805331 160.075009 dynein heavy chain domain 1 None FSSLLVKAVTHRDIAQLLEK None None None 18.68 16.71 19.06 18.68 17.42 16.31 18.74 18.59 18.57 16.89 19.43 17.71 19.14 18.56 17.22 17.6 18.0 18.55 17.72 19.23 18.73 18.7 18.37 16.97 17.81 17.9 16.97 18.97 18.92 17.64 18.46 Q99J82 Ilk 1 160.0888371 170922 + 160.0888371 160.095137 integrin-linked protein kinase None ALDMARGMAFLHTLEPLIPR None 602366 3318 17.9 17.8 17.38 17.62 18.26 17.09 18.36 19.64 18.02 17.89 18.47 17.88 18.54 17.73 18.58 18.22 18.2 18.11 18.79 16.94 17.96 17.58 17.48 18.35 17.81 19.2 19.19 18.16 16.74 17.07 19.6 B4F7B2 Taf10 1 160.0951161 293345 - 160.0951161 160.096551 transcription initiation factor tfiid subunit 10 None ASPAGTAGGPGAGVATAGTGPVAAR None 600475 86923 14.71 14.03 14.03 14.69 14.2 14.44 14.77 14.71 15.04 15.18 14.17 15.25 14.74 15.53 14.12 13.87 14.67 15.69 14.71 14.54 15.72 13.86 14.91 13.71 13.02 14.12 14.43 14.58 14.55 14.75 15.2 Q642E6 Tpp1 1 160.0979841 83534 - 160.0979841 160.104117 tripeptidyl aminopeptidase Cln2 None None None None 15.96 17.34 16.04 17.7 17.35 15.55 16.16 18.35 16.38 16.89 16.9 16.52 16.39 16.35 17.08 16.86 15.82 17.23 16.61 18.17 15.53 16.14 16.28 17.33 17.5 17.37 18.33 15.88 16.78 18.3 16.8 Q9EQV6 Tpp1 1 160.0979841 83534 - 160.0979841 160.104117 tripeptidyl-peptidase 1 None DDEDSLSSVYIQRVNTEFMK None 607998 335 15.96 17.34 16.04 17.7 17.35 15.55 16.16 18.35 16.38 16.89 16.9 16.52 16.39 16.35 17.28 16.86 16.06 17.21 16.32 17.98 15.53 16.14 16.28 17.33 17.5 17.37 18.33 15.88 16.78 18.3 16.8 D4ACX8 Dchs1 1 160.1047721 308912 - 160.1047721 160.138864 protocadherin-16 None EVTVRVADINDHAPAFPQAR None None 2771 15.68 16.06 16.24 15.82 16.19 15.34 15.24 15.79 15.11 15.11 15.31 14.84 14.61 14.9 15.81 16.44 14.79 15.37 15.22 16.23 14.75 15.4 14.84 15.23 16.69 15.61 15.5 15.1 16.37 16.06 15.94 Q66H86 Olfml1 1 161.4782471 361621 + 161.4782471 161.502535 olfactomedin-like protein 1 None VESEEKTSAEKVLQEAEEEK None None 45688 14.96 14.68 14.52 14.35 14.83 15.08 15.84 16.41 15.04 15.46 16.9 15.28 14.91 16.01 15.56 15.21 15.34 16.27 15.36 14.44 15.36 15.74 16.04 14.06 15.75 15.63 15.72 16.19 15.21 15.39 15.52 Q6AY12 Cyb5r2 1 161.6558651 365345 - 161.6558651 161.664097 nadh-cytochrome b5 reductase 2 None RAYTPVSSDDDQGFVDLIIK None 608342 6182 16.85 15.45 16.93 16.29 16.29 16.74 17.1 16.72 15.23 16.91 17.63 16.2 16.67 16.19 15.9 16.7 15.55 17.54 16.75 17.8 16.41 17.75 16.32 16.49 17.21 16.26 17.75 15.5 16.15 17.85 17.6 D4AC36 Eif3f 1 162.9341981 293427 + 162.9341981 162.943245 eukaryotic translation initiation factor 3 subunit f None YDTERIGVDLIMKTCFSPNR None 603914 2783 18.76 20.15 18.33 19.21 19.49 16.11 17.6 19.09 18.12 18.07 18.54 18.04 18.11 18.51 19.47 18.33 18.78 18.75 18.55 17.07 17.18 17.65 17.75 19.83 19.59 18.67 19.16 17.47 18.27 17.48 18.85 O88808 Tub 1 163.0084931 25609 + 163.0084931 163.026953 tubby protein homolog None YLISVDPTDLSRGGDSYIGK None None 31147 17.23 16.45 17.54 17.74 15.51 16.77 15.68 15.2 16.11 16.23 15.85 16.08 16.11 16.65 16.52 16.23 15.73 16.75 15.7 17.9 16.53 17.48 16.93 15.62 16.71 17.53 17.29 16.34 17.7 17.17 15.94 F1LQ83 Tmem9b 1 163.7544911 293415 - 163.7544911 163.78388 tmem9 domain family, member b None KNISQKDCDCLHVVEPMPVR None None 23191 16.56 16.75 17.79 18.54 17.61 17.43 18.36 17.77 18.27 18.47 16.55 17.65 17.54 16.75 18.55 18.28 16.42 17.61 18.27 17.6 17.21 17.82 17.56 16.99 16.16 17.87 16.79 17.5 18.86 17.94 17.96 D4A2K5 Nrip3 1 163.7897391 361625 - 163.7897391 163.815036 nuclear receptor interacting protein 3, isoform cra_a None KALVDTGCQHNLISSACVDR None 613125 10764 16.17 14.41 15.97 16.58 16.26 17.87 15.75 15.42 16.82 16.54 16.84 16.86 16.62 15.56 16.52 16.78 15.87 16.8 17.19 15.76 17.7 16.84 17.0 15.81 15.63 15.99 16.92 16.66 17.09 16.58 17.06 G3V7Q0 Dennd5a 1 163.9281841 308942 - 163.9281841 163.994158 denn domain-containing protein 5a None AQTYYETLEQNDVVPEENWHTR None None 14584 18.64 16.1 17.52 18.15 17.46 16.57 17.36 18.22 17.27 17.21 16.9 16.56 16.7 16.67 18.19 17.53 17.39 17.3 18.07 16.22 16.95 17.14 17.31 17.71 18.96 18.19 17.74 17.25 17.16 18.03 17.46 Q5FVN2 Tmem41b 1 164.0125981 361626 - 164.0125981 164.026828 transmembrane protein 41b None GRVAERSQTEMLHSTPAGDR None None 42740 16.68 15.54 15.9 16.66 16.84 16.96 14.97 15.63 17.63 15.86 15.05 16.47 16.73 15.51 17.67 15.11 15.65 15.87 16.27 15.74 17.51 15.49 16.5 17.04 16.14 16.1 15.98 16.99 16.33 16.44 16.76 D4AE96 Ipo7 1 164.0627031 308939 + 164.0627031 164.102938 importin 7 None FCEVKFKSDQNLQTALELTR None 605586 4659 19.79 17.61 20.1 18.68 17.68 21.06 20.03 19.03 18.31 18.86 19.99 19.3 19.64 19.18 18.96 19.12 19.09 20.17 19.02 18.87 20.54 19.9 19.89 18.27 19.24 19.07 19.24 20.06 18.72 19.75 19.49 D3ZRE7 Swap70 1 164.2676121 293410 + 164.2676121 164.328773 swap complex protein, isoform cra_b None AQQQAIQTTEAEKQELEQQR None 604762 7557 16.38 17.22 17.69 17.24 16.56 17.08 16.88 16.9 18.17 17.83 18.21 17.27 16.95 17.6 16.61 17.76 16.12 18.41 17.8 18.24 18.89 17.71 17.55 18.15 16.39 17.37 18.69 17.07 16.3 16.28 18.78 B5DEJ9 Sbf2 1 164.3534441 691042 - 164.3534441 164.719807 loc691036 protein None PFPKINEARVQELIQENLAK None None None 18.48 16.29 19.12 18.86 18.31 18.07 18.1 19.66 18.01 17.5 18.08 18.25 17.79 17.47 19.07 18.18 18.13 17.45 18.57 16.57 16.84 17.01 17.62 18.03 18.02 17.68 17.95 18.12 18.0 18.29 19.35 F1M7Q5 Ampd3 1 164.8853211 25095 + 164.8853211 164.929887 amp deaminase None KQKFLGQNYYKEGPEGNDIR None 102772 408 18.34 20.37 18.28 17.7 18.11 17.82 18.49 18.72 18.19 19.54 19.41 17.79 18.35 19.03 17.64 19.06 17.83 19.26 18.79 20.18 18.44 19.56 17.69 19.66 18.6 19.31 19.61 17.78 17.74 18.82 18.53 O09178 Ampd3 1 164.8853211 25095 + 164.8853211 164.929887 amp deaminase 3 None FHYTKEALMEEYAIAAQVWK None 102772 408 18.34 20.36 18.35 17.68 18.09 17.76 18.5 18.73 18.14 19.35 19.57 17.76 18.34 19.01 17.66 19.05 17.81 19.25 18.8 20.17 18.43 19.55 17.69 19.64 18.78 19.3 19.62 17.79 17.72 18.82 18.52 Q6IV57 Rnf141 1 164.9339731 308900 - 164.9339731 164.957081 ring finger protein 141 None VVRVVCTKINKSSGIVEASR None None 9503 17.82 16.61 17.43 16.56 16.91 17.4 17.18 17.87 18.55 18.77 16.53 16.85 17.91 18.03 17.94 17.49 15.66 18.07 18.24 17.94 18.18 17.25 17.94 17.43 16.97 17.62 17.29 18.57 17.43 17.8 17.8 G3V897 Ctr9 1 165.1372461 293184 + 165.1372461 165.167301 ctr9 homolog, paf1/rna polymerase ii complex component None ALAYYKKALRTNPGCPAEVR None None 40668 14.93 15.97 16.77 15.66 14.87 15.51 15.04 15.47 15.28 14.61 15.17 15.99 14.81 15.57 16.47 13.97 15.31 14.97 15.5 14.56 17.16 15.86 14.95 15.22 16.18 14.11 14.64 15.7 16.52 15.54 15.9 F1LN59 Eif4g2 1 165.1814351 361628 - 165.1814351 165.193583 eukaryotic translation initiation factor 4, gamma 2 None PKLEVDIPLVKSYLAQFAAR None 602325 37477 18.34 17.21 19.68 17.82 17.72 18.21 18.63 18.46 19.4 19.1 17.96 18.04 18.11 19.01 18.92 17.55 18.52 18.37 19.22 16.94 20.15 18.3 18.3 18.86 16.79 18.54 18.83 18.77 17.36 18.3 20.37 A0A0G2JUX4 Usp47 1 166.15221 308896 + 166.15221 166.235312 ubiquitin-specific peptidase 47 None NSKTVNERITVNLPASTPVR None None 9929 18.69 16.5 19.0 17.8 17.25 18.77 18.16 17.54 16.82 18.94 18.38 17.25 18.43 18.16 18.69 18.05 18.05 17.75 18.22 17.69 19.16 19.11 18.55 18.56 18.33 18.69 19.02 18.51 16.35 18.68 19.15 F1MAA1 Usp47 1 166.15221 308896 + 166.15221 166.235312 ubiquitin-specific peptidase 47 None ENAAEEPRVLCIIQDTTNSK None None 9929 18.66 16.52 18.84 17.83 17.2 18.85 18.03 17.48 16.93 18.86 18.4 17.32 18.45 18.22 18.72 18.15 18.1 17.79 18.22 17.68 19.16 19.17 18.54 18.62 18.49 18.74 19.11 18.54 16.37 18.75 19.17 B1H219 Dkk3 1 166.2382391 171548 - 166.2382391 166.28059 dickkopf wnt-signaling pathway inhibitor 3 None TRDSECCGDQLCAWGHCTQK None None 8303 16.9 16.27 15.73 15.97 16.61 16.82 16.59 16.57 17.48 17.23 17.14 18.32 17.8 18.42 15.89 18.11 16.56 17.6 17.32 18.67 17.95 16.94 17.92 17.51 17.03 17.51 16.92 17.43 17.39 17.26 16.87 D4A1F2 Mical2 1 166.3458861 365352 + 166.3458861 166.471981 [f-actin]-monooxygenase mical2 None STAEAKVEEISGVAFIFNQK None 608881 8760 15.16 18.0 15.55 17.73 16.32 15.88 16.8 16.66 17.55 16.28 15.41 17.34 15.48 15.58 17.31 17.42 16.45 15.56 16.33 15.59 15.35 16.03 16.01 16.35 15.32 17.11 14.99 16.89 16.86 16.38 16.93 Q9HB97 Parva 1 166.5471271 57341 + 166.5471271 166.705003 alpha-parvin None DHAPDKLNVVKKTLITFVNK None 608120 10077 17.69 16.09 17.96 17.05 17.94 16.74 17.99 18.49 17.84 16.84 19.53 17.84 18.33 18.51 18.21 17.45 17.35 17.79 18.78 16.75 18.15 17.86 17.97 18.11 18.08 17.17 18.91 17.95 16.07 18.09 18.89 Q66H50 Far1 1 167.6446631 293173 + 167.6446631 167.724437 fatty acyl-coa reductase 1 None VRQKAGQTPQERVEEILSGK None None 41718 16.24 15.85 15.8 15.87 15.91 15.58 14.91 16.13 14.63 14.55 16.21 15.27 14.78 14.95 15.45 15.58 16.22 15.15 15.76 14.65 14.14 14.97 14.83 15.1 16.62 15.56 15.54 15.18 15.1 15.01 14.97 P35446 Spon1 1 167.9289731 64456 + 167.9289731 168.228229 spondin-1 None SRRSEQLREESDGEQFPGCR None 604989 4453 16.38 16.62 16.9 17.34 16.33 17.49 16.63 16.21 17.39 17.98 16.76 17.61 18.36 16.33 16.89 17.23 18.41 16.89 15.82 17.33 17.76 18.12 17.18 17.9 15.66 16.87 18.06 16.96 15.97 17.01 17.25 Q3B7D6 Spon1 1 167.9289731 64456 + 167.9289731 168.228229 f-spondin Sponf None None None None 16.38 16.62 16.9 17.34 16.33 17.49 16.58 16.21 17.39 17.98 16.76 17.61 18.36 16.33 17.11 17.23 18.29 16.81 15.57 17.62 17.76 18.12 17.18 17.84 15.66 16.87 18.1 16.97 16.0 17.01 17.25 Q5BJU0 Rras2 1 168.2336951 365355 - 168.2336951 168.303111 ras-related 2 None EEGQQLARQLKVTYMEASAK None 600098 6945 19.93 19.51 18.13 18.68 18.51 19.19 19.45 18.8 18.49 19.44 19.6 18.64 18.91 19.21 18.05 19.86 19.83 20.0 18.83 18.03 17.77 19.27 19.28 20.16 20.11 19.15 18.94 18.34 18.04 18.92 17.87 D3ZIV8 Ythdc2 1 37.2665891 307446 - 37.2665891 37.318326 rna helicase None TELLPKTERGNVFAVEAENR None None None 17.29 14.4 16.07 17.6 16.7 16.35 15.6 16.84 16.42 16.21 16.55 16.5 17.06 16.4 16.97 16.25 17.08 16.43 17.29 14.87 16.54 16.25 16.87 17.27 17.26 17.14 17.06 15.67 17.28 17.15 16.77 P23514 Copb1 1 168.4043361 114023 - 168.4043361 168.438423 coatomer subunit beta None RFLCKLKEAELLEPLMPAIR None 600959 5664 19.6 17.01 19.32 19.35 18.01 18.35 19.63 19.44 17.86 18.5 20.48 19.08 19.56 19.31 19.92 18.15 18.94 18.95 19.7 17.67 20.4 19.17 19.43 18.46 20.3 18.28 19.49 19.24 18.53 19.61 19.49 P18420 Psma1 1 168.4424221 29668 - 168.4424221 168.45344 proteasome subunit alpha type-1 None DLEFTIYDDDDVSPFLDGLEERPQR None 602854 2080 21.16 20.06 21.06 21.42 21.19 19.59 20.5 21.94 20.75 20.36 20.64 20.46 21.28 19.33 19.93 21.44 20.84 21.06 20.08 22.31 19.95 20.95 20.56 21.75 21.03 21.79 21.34 20.03 20.83 20.87 22.03 D3Z9R8 Atp5mj 1 168.4723761 - 168.4723761 168.472557 atp synthase subunit atp5mpl None MLQSFIKKVWVPMKPYYTQV None None None 16.3 18.9 16.11 16.71 17.51 15.95 16.58 18.33 16.18 16.54 15.78 16.24 16.19 15.68 18.0 17.13 16.51 15.5 17.13 15.93 16.15 15.85 16.14 16.74 17.93 18.27 16.4 17.74 16.07 16.33 16.78 G3V8R1 Nucb2 1 170.7508551 59295 - 170.7508551 170.789472 nucleobindin 2, isoform cra_b None VPIDVDKTKVHNVEPVESAR None 608020 3676 17.36 18.56 17.82 18.66 15.88 17.4 18.18 18.0 16.7 17.86 19.05 17.47 17.71 16.82 17.04 18.05 16.89 18.34 16.73 18.22 17.37 17.97 16.38 16.96 17.21 17.54 17.76 16.69 17.75 16.77 17.36 Q9JI85 Nucb2 1 170.7508551 59295 - 170.7508551 170.789472 nucleobindin-2 None DEYLKQVIEVLETDPHFREK None 608020 3676 17.36 18.56 17.82 18.66 15.88 17.4 18.18 18.0 16.7 17.86 19.05 17.47 17.71 16.82 17.04 18.05 16.89 18.34 16.73 18.22 17.37 17.97 16.38 16.96 17.21 17.54 17.76 16.69 17.75 16.77 17.36 D3ZTF6 Pik3c2a 1 170.5779421 361632 + 170.5779421 170.683471 phosphatidylinositol-4-phosphate 3-kinase None EKLTQAELEKILLDDNFETR None None 20581 19.07 16.27 18.85 17.95 16.43 19.42 18.29 16.87 17.56 17.52 18.44 17.71 17.65 17.85 18.48 18.37 18.86 16.89 18.05 16.8 18.61 18.09 18.52 17.26 17.33 17.91 17.89 18.69 17.29 17.55 17.52 A0A0G2K6Z8 Plekha7 1 170.3654471 499249 + 170.3654471 170.546958 pleckstrin homology domain-containing a7 None PGDLGSWKREQEFDLQLLER None None None 14.93 14.97 15.27 14.74 16.2 15.97 16.3 15.91 15.68 15.71 16.66 15.31 15.81 16.93 15.65 15.88 14.97 15.73 16.78 16.44 14.95 15.72 15.25 16.22 16.58 16.08 16.68 15.11 14.62 17.34 16.64 G3V8R0 Rgd1311703 1 170.334951 293160 - 170.334951 170.346104 small acidic protein None EESAEELHAAAHPDDTEDPK None None 8606 16.9 14.96 17.79 16.87 16.64 16.49 16.45 16.2 17.27 15.96 16.31 17.94 17.36 17.08 16.22 16.45 16.4 16.99 17.81 17.93 18.21 17.16 17.36 16.2 16.9 16.52 17.68 16.13 18.1 17.52 17.72 Q7TMZ5 Arl6ip1 1 172.4304761 293551 - 172.4304761 172.43999 adp-ribosylation factor-like 6 interacting protein 1 None NKWTTEQQQRFHEICSNLVK None None 41008 16.83 17.49 18.28 18.34 18.49 16.89 17.85 19.55 17.99 18.79 17.1 17.37 19.12 17.31 18.58 18.79 18.27 17.96 17.64 18.0 17.59 18.14 18.95 18.64 18.78 19.52 17.33 18.04 18.69 17.98 17.84 Q62807 Syt17 1 172.6951571 192189 - 172.6951571 172.761885 synaptotagmin-17 None QKPVFEERYTFEIPFLEAQR None None 9553 17.95 18.28 17.19 17.53 16.15 18.06 18.09 17.56 16.89 17.46 16.69 18.23 17.22 16.98 18.35 18.71 18.34 17.1 17.33 16.13 18.23 17.77 17.04 17.53 17.21 18.36 17.28 18.22 16.39 16.04 17.52 G3V879 Coq7 1 172.8351741 25249 - 172.8351741 172.851158 5-demethoxyubiquinone hydroxylase None IRMLMEEDAEKYEELLQVIK None 601683 6953 16.81 15.27 16.74 17.07 17.31 16.5 16.91 16.59 16.42 15.94 17.44 17.38 17.87 16.13 17.32 17.69 15.75 17.48 18.32 16.3 16.68 18.14 16.86 17.48 18.01 16.8 18.04 16.6 16.01 17.15 18.33 Q63619 Coq7 1 172.8351741 25249 - 172.8351741 172.851158 5-demethoxyubiquinone hydroxylase None IRMLMEEDAEKYEELLQVIK None 601683 6953 16.91 15.06 15.55 16.82 17.35 16.15 16.58 16.36 16.68 15.81 16.23 16.54 17.4 15.92 17.41 17.53 15.8 17.03 17.9 15.9 16.19 17.78 16.78 17.17 18.1 17.27 17.87 16.36 15.87 16.88 18.0 Q9JL55 Gde1 1 173.0200481 60418 - 173.0200481 173.032403 glycerophosphodiester phosphodiesterase 1 None LCGISAFLMQKDFVSPDYLK None 605943 41149 18.12 15.25 16.78 18.19 18.74 15.98 17.73 17.46 17.66 16.97 16.87 17.3 17.82 17.12 17.86 18.42 17.45 17.32 18.28 16.35 17.26 17.33 17.85 16.36 18.76 19.2 16.87 17.79 19.16 18.05 18.1 D4A3J9 Ccp110 1 173.0457751 361634 + 173.0457751 173.072873 centriolar coiled-coil protein 110 None TDLPVGTGPPTVPDAESDFK None 609544 8810 16.94 14.77 16.24 15.68 16.95 16.31 16.92 16.83 16.53 16.75 17.47 15.19 16.8 17.03 15.88 16.24 16.36 16.87 16.6 16.5 16.7 16.74 16.89 15.98 17.22 17.28 16.46 15.51 17.88 17.85 16.15 A0A0G2JUM2 Vps35l 1 173.07611 361635 + 173.07611 173.179662 vps35 endosomal protein sorting factor-like None SEKVRTRLEELDDFEEGSQK None None 10659 18.54 15.85 18.44 18.29 17.2 17.02 18.5 19.48 17.82 17.05 18.22 17.29 18.09 16.82 18.24 18.05 17.65 18.1 18.53 16.45 18.13 16.91 17.85 16.48 17.55 19.22 17.93 18.75 17.37 18.12 18.84 Q5XI83 Vps35l 1 173.07611 361635 + 173.07611 173.179662 vps35 endosomal protein-sorting factor-like None SAFRAEFIATRSMDFIGMIK None None 10659 18.54 15.85 18.55 18.29 17.14 17.26 18.5 19.61 18.34 17.41 18.0 17.03 18.09 16.71 18.24 17.91 17.66 18.1 18.52 16.45 18.17 16.87 17.85 16.48 17.18 18.95 17.93 18.75 17.37 18.12 18.84 A0A0G2K4B0 Gprc5b 1 173.3163991 293546 - 173.3163991 173.340933 g protein-coupled receptor, class c, group 5, member b None PRAYMENKAFSMDEHNAALR None 605948 9435 17.78 15.79 17.73 17.93 18.22 17.58 17.46 16.67 16.73 16.17 17.57 16.96 16.73 18.36 16.73 17.05 16.03 17.72 18.51 17.15 17.26 16.46 17.75 16.25 18.66 17.64 17.03 17.61 17.85 18.4 17.49 F7FA68 Thumpd1 1 174.0788771 - 174.0788771 174.082137 thump domain-containing protein None SENKVDLTNPEYTVVVEIIK None None None 18.03 15.86 19.05 17.69 17.71 18.12 18.07 17.79 18.39 17.83 16.58 18.46 18.58 18.03 18.98 17.46 16.74 18.21 18.56 18.2 19.76 18.4 18.35 17.28 17.93 17.62 18.27 18.86 18.09 18.52 18.82 Q4V8B2 Dcun1d3 1 174.2471931 309035 - 174.2471931 174.285647 dcn1-like protein 3 None EFFDGCKAISADSIDGICAR None None None 14.13 15.79 15.78 15.29 14.89 16.09 16.7 16.05 14.92 16.55 14.71 15.16 16.66 15.98 16.45 15.25 16.68 15.08 16.25 14.29 16.45 16.37 16.62 15.2 16.95 16.99 14.91 16.94 15.08 15.51 15.17 B2RYU8 Lyrm1 1 174.2851841 365361 + 174.2851841 174.305053 lyr motif-containing protein 1 None NKNLTDPDLIKQCIDECTAR None None 10707 17.76 16.09 16.95 17.02 17.85 16.24 16.97 17.44 17.14 16.06 17.52 16.37 17.66 16.63 17.02 18.15 18.24 16.52 16.84 16.54 15.54 16.62 16.58 17.76 17.82 17.89 17.77 16.98 15.76 17.66 17.78 A0A0G2K568 Crym 1 174.5604241 117024 - 174.5604241 174.575602 ketimine reductase mu-crystallin None EKTTVFKSLGMAVEDLVAAK None 123740 1424 21.13 22.29 21.72 20.58 20.56 21.44 22.65 21.77 20.77 22.06 20.85 21.03 21.99 21.22 20.5 22.81 22.14 21.86 20.65 21.59 20.09 21.94 21.04 21.52 20.97 21.59 21.54 20.66 19.9 20.55 20.58 Q9QYU4 Crym 1 174.5604241 117024 - 174.5604241 174.575602 ketimine reductase mu-crystallin None LRSSSLLIPPLEAALANFSK None 123740 1424 21.04 22.62 21.65 20.57 20.74 21.65 22.67 21.62 20.61 22.21 20.71 20.97 21.63 21.07 20.51 23.03 22.15 21.86 20.6 21.6 20.07 21.73 20.93 21.52 21.12 21.7 21.33 20.71 19.95 20.58 20.51 A0A0G2JZB6 Thumpd1 1 174.0832851 - 174.0832851 174.084899 thump domain-containing protein None QSPPSVGGKRKGKSQFLPAK None None None 16.12 16.38 15.84 15.3 15.77 14.88 16.35 15.78 16.05 15.81 15.09 15.18 15.92 17.05 15.24 15.26 15.16 15.99 16.03 17.0 17.7 16.05 15.25 16.13 16.67 17.39 16.64 14.28 16.41 15.18 17.41 P32551 Uqcrc2 1 175.1679341 293448 + 175.1679341 175.198492 cytochrome b-c1 complex subunit 2 None NQVKAVAQGNLSSADVQAAK None 191329 37764 22.62 21.96 21.01 21.84 22.8 23.36 22.57 20.61 22.47 21.23 22.04 22.92 22.59 22.18 23.4 21.27 21.66 21.47 22.26 21.93 21.84 23.07 22.2 21.56 21.87 21.57 21.95 21.33 23.07 21.27 23.54 D3ZZ04 Mettl9 1 175.5780191 100302453 + 175.5780191 175.623065 methyltransferase-like 9 None PDWKTHRLLDLGAGDGEVTK None None None 15.29 16.73 14.52 14.89 15.94 15.16 15.86 15.39 15.52 15.02 15.73 15.78 14.16 16.15 15.83 15.28 15.68 15.1 15.67 15.05 15.67 16.4 14.35 15.32 16.22 15.97 15.73 16.29 13.98 16.26 15.96 A0A0G2K2V3 Usp31 1 176.215891 308959 - 176.215891 176.277667 ubiquitin-specific peptidase 31 None LQNMVKFPLTGLDMTPHVVK None None 44504 17.31 16.52 16.75 15.95 16.7 16.71 15.86 16.85 16.0 15.66 17.4 16.29 15.97 16.98 17.03 15.71 16.25 16.51 16.66 14.82 15.55 16.54 15.64 16.86 16.39 16.86 16.24 15.76 17.1 15.87 15.79 Q3T1G7 Cog7 1 176.4580791 293456 - 176.4580791 176.549445 conserved oligomeric golgi complex subunit 7 None NMPKVLRDVEALKQEASFLK None 606978 33431 15.63 16.1 16.76 16.66 15.97 14.76 16.51 16.44 16.67 15.6 17.73 15.78 16.39 17.25 17.35 16.43 17.06 16.34 16.78 14.92 16.79 16.14 17.61 16.59 17.18 16.55 17.18 16.61 15.66 16.24 16.86 G3V8F7 Gga2 1 176.552051 293455 - 176.552051 176.585332 golgi associated, gamma adaptin ear containing, arf binding protein 2, isoform cra_a None CGEKFHNEVAKFRFLNELIK None None 22860 17.47 18.71 17.73 17.81 17.61 15.91 18.29 18.29 15.99 17.52 18.43 17.01 16.88 16.35 17.15 17.86 18.09 17.46 16.72 15.74 15.65 16.54 16.37 16.51 16.62 17.2 16.93 16.91 16.41 16.46 17.33 G3V8E4 Ubfd1 1 176.6258441 293454 + 176.6258441 176.637512 similar to d7wsu128e protein None WNKTKHDVKVPLDSTGSELK None None 10430 17.84 19.31 18.72 18.63 18.81 18.42 18.91 18.85 16.92 18.78 19.15 17.5 17.68 17.51 17.0 18.23 18.58 18.76 17.73 19.56 17.28 18.91 18.4 18.32 18.61 18.86 18.46 18.08 18.23 19.21 17.66 D3ZF13 Ndufab1 1 176.6447041 293453 - 176.6447041 176.658099 acyl carrier protein None GIRDRVLYVLKLYDKIDPEK None None None 17.44 17.44 18.07 18.23 18.51 18.68 19.08 16.9 19.24 19.3 18.25 19.39 19.47 18.48 17.76 19.81 18.43 18.77 19.12 19.44 19.5 19.29 19.49 17.3 17.22 18.19 18.6 18.35 19.69 18.57 18.41 G3V8C0 Dctn5 1 176.6891581 308961 + 176.6891581 176.705914 dynactin subunit 5 None GSQNIVLNGKTIIMNDCIIR None 612962 10998 18.81 17.13 17.96 18.64 17.4 19.7 17.4 17.25 18.67 18.68 16.88 18.02 18.66 18.44 19.06 18.64 19.09 17.64 17.33 18.21 17.86 18.19 18.41 18.42 17.86 18.35 17.52 18.08 19.53 18.59 18.47 F1LS42 Prkcb 1 176.8328161 25023 + 176.8328161 177.163031 protein kinase c None RDAKNLVPMDPNGLSDPYVK None None 56424 20.81 22.18 21.22 21.44 21.61 22.66 22.02 21.29 22.5 22.57 21.88 22.51 21.84 22.38 22.04 21.83 22.77 21.31 22.33 20.63 22.76 22.35 23.31 21.37 20.95 21.69 21.06 23.3 21.84 21.32 21.12 P68403 Prkcb 1 176.8328161 25023 + 176.8328161 177.163031 protein kinase c beta type None LTSRNDFMGSLSFGISELQK None None 56424 20.7 21.8 21.15 21.38 21.57 22.82 21.96 21.28 22.47 22.66 21.76 22.55 21.94 22.37 22.09 21.76 22.93 21.27 22.07 20.67 23.03 22.27 23.34 21.47 20.87 21.68 21.09 23.28 21.77 21.46 21.25 Q8VHX0 Cacng3 1 177.2015971 140724 + 177.2015971 177.29718 voltage-dependent calcium channel gamma-3 subunit None FTLSRDPSKLTMGTLLNSDR None 606403 4767 19.04 16.86 17.45 18.37 17.46 17.94 17.96 17.93 18.32 17.64 18.64 18.36 18.17 18.84 17.95 17.92 18.81 17.99 18.75 16.86 18.57 17.68 18.62 17.89 18.2 18.29 17.73 18.53 18.51 17.65 17.77 G3V953 Rbbp6 1 177.5042021 308968 + 177.5042021 177.535676 rb-binding protein 6, ubiquitin ligase None GREKLKAADSDLQITNAQTK None 600938 136812 15.76 14.05 15.64 16.13 15.64 16.09 14.45 15.06 15.66 14.7 15.27 16.14 16.29 15.99 16.86 15.22 17.02 15.2 15.66 14.83 17.52 16.31 16.48 16.78 16.92 16.9 16.39 15.19 16.82 16.41 16.73 Q99N37 Arhgap17 1 177.8075841 63994 - 177.8075841 177.896853 rho gtpase-activating protein 17 None DSSPPKPKDSVSAAAPVAGR None 608293 9984 17.45 16.9 16.92 17.12 16.84 15.37 17.13 16.89 16.54 17.13 15.86 15.48 16.06 15.53 17.18 16.29 15.85 16.53 16.98 15.73 16.54 16.72 16.17 16.26 16.65 16.97 16.96 16.4 15.0 15.82 16.86 G3V7V9 Lcmt1 1 177.904131 361643 + 177.904131 177.960129 leucine carboxyl methyltransferase 1 None None None None 19.78 21.19 18.69 18.42 18.28 20.37 20.52 18.76 18.65 18.63 19.12 18.8 18.82 19.5 18.75 18.89 19.05 19.93 18.59 20.05 20.21 20.15 18.47 18.15 19.7 21.08 19.79 19.43 18.37 18.63 19.14 Q6P4Z6 Lcmt1 1 177.904131 361643 + 177.904131 177.960129 leucine carboxyl methyltransferase 1 None QIDSHMLDSKRYAIIGADLR None 610286 41123 19.78 21.19 18.69 18.42 18.28 20.37 20.52 18.76 18.65 18.63 19.12 18.8 18.82 19.5 18.75 18.89 19.05 19.93 18.59 20.05 20.21 20.15 18.47 18.15 19.7 21.08 19.79 19.43 18.37 18.63 19.14 F1M8P6 Gapdhs 1 85.9790961 + 85.9790961 85.99364 gp_dh_n domain-containing protein None PDGRGAVQKNIIPASTGAAK None None None 23.85 23.06 23.43 24.41 24.87 24.26 24.14 25.43 24.12 24.37 23.43 24.58 24.08 23.35 23.91 25.3 25.37 24.73 23.7 24.37 23.24 24.21 24.64 23.83 25.03 26.21 25.45 25.71 23.12 25.21 24.88 A0A0G2K6I0 Rps15a 1 179.2679591 691716 + 179.2679591 179.268341 40s ribosomal protein s15a None None None None 17.16 16.32 16.62 18.93 17.47 17.34 16.4 17.85 17.03 16.64 18.58 17.94 18.8 17.44 18.51 18.14 17.63 17.83 17.35 17.14 16.33 17.33 18.23 18.79 18.1 18.85 18.26 16.7 18.48 16.94 18.76 Q63505 Gtf3c1 1 180.2039971 171063 - 180.2039971 180.270174 general transcription factor 3c polypeptide 1 None LAKVVSLPLQEIHPECGPCK None None 31040 16.2 15.02 17.03 15.87 16.3 16.33 14.96 16.54 17.17 15.31 15.94 16.15 16.12 16.17 16.68 15.31 17.14 16.1 16.75 14.73 18.25 16.17 16.47 16.58 17.3 15.79 16.51 16.15 17.24 16.9 17.57 D3ZK93 Gsg1l 1 180.4429431 - 180.4429431 180.654134 germ cell-specific gene 1-like protein None IKYFRERIEKGDVSEEEDFR None None None 16.45 14.59 15.37 16.09 15.9 16.25 15.4 15.85 16.09 16.05 15.58 16.67 16.63 16.65 16.45 15.94 15.68 16.67 16.72 14.62 16.44 15.89 16.6 16.54 15.95 16.04 15.8 16.6 16.07 16.03 15.76 G3V858 Xpo6 1 180.672121 293476 - 180.672121 180.761543 exportin 6 None DDQQTEWQRYLRQSLEVVAK None 608411 12544 16.09 16.75 15.37 15.91 15.44 15.36 16.22 14.95 15.18 14.99 15.62 15.64 14.88 15.16 16.75 15.79 15.41 14.98 16.3 14.4 16.53 15.37 15.61 15.4 16.53 15.99 15.77 15.6 14.53 14.73 14.76 Q5EBC7 Rabep2 1 181.0101531 80754 + 181.0101531 181.027008 rab gtpase-binding effector protein 2 Fra; MP13 None None None None 18.43 16.81 18.27 17.03 18.12 16.31 17.36 18.62 18.35 16.77 18.67 16.24 17.52 18.38 17.33 17.04 16.24 17.92 17.54 18.9 16.8 17.59 16.55 18.21 18.03 17.39 16.94 18.26 16.87 16.86 18.54 Q62835 Rabep2 1 181.0101531 80754 + 181.0101531 181.027008 rab gtpase-binding effector protein 2 None ELSRLRAELAGALAEMETMK None 611869 23489 18.43 16.81 18.27 17.03 18.12 16.31 17.36 18.62 18.35 16.77 18.67 16.24 17.52 18.38 17.32 17.04 16.22 18.03 17.78 18.75 16.8 17.59 16.55 18.21 18.03 17.39 16.94 18.26 16.87 16.86 18.54 Q64578 Atp2a1 1 181.0266091 116601 - 181.0266091 181.044821 sarcoplasmic/endoplasmic reticulum calcium atpase 1 None SVIRQLMKKEFTLEFSRDRK None 108730 7635 21.2 20.05 20.25 20.15 21.18 21.04 21.17 20.01 21.57 20.42 20.62 21.66 21.34 21.3 21.57 21.07 20.68 20.56 22.02 19.46 21.62 20.94 20.74 19.99 20.33 20.76 20.46 20.9 21.92 21.09 21.91 M0R617 Sh2b1 1 181.0486241 89817 - 181.0486241 181.056542 sh2-b ph domain containing signaling mediator 1, isoform cra_a Sh2-b; Sh2b; Sh2bpsm1 None None None None 17.76 15.12 17.72 17.06 16.19 16.78 17.97 16.69 17.1 15.97 17.16 16.61 16.68 16.78 16.45 17.21 16.05 17.84 17.86 17.92 18.48 17.49 17.34 16.4 18.59 17.59 17.21 17.56 16.04 17.56 17.95 Q62985 Sh2b1 1 181.0486241 89817 - 181.0486241 181.056542 sh2b adapter protein 1 None VHPIPLESGGSSDVVLVSYVPSQR None None None 17.76 15.12 17.72 17.06 16.19 16.78 17.97 16.69 17.1 15.97 17.16 16.61 16.68 16.78 16.24 17.21 15.98 17.64 17.85 18.13 18.48 17.49 17.34 16.4 18.59 17.59 17.21 17.56 16.04 17.56 17.95 P85834 Tufm 1 181.0737891 293481 + 181.0737891 181.077395 elongation factor tu None STAARHYAHTDCPGHADYVK None 602389 2490 21.78 22.97 21.49 21.13 22.91 19.94 21.51 22.12 22.1 22.46 20.77 20.24 21.98 21.78 22.08 21.98 22.08 21.4 21.95 20.09 20.71 21.1 20.62 21.82 22.52 22.0 21.76 20.52 22.28 21.37 22.01 A0A0G2JYE0 Atxn2l 1 181.0783011 361649 - 181.0783011 181.089766 ataxin 2-like None YGVKTTYDSSLSSYTVPLEK None 607931 16513 20.22 18.13 19.23 19.15 19.62 19.57 18.57 20.65 20.88 20.31 19.54 19.04 20.26 21.17 19.88 18.46 19.81 19.59 20.44 19.24 20.01 19.1 20.11 20.04 20.46 19.02 19.86 19.95 21.09 20.16 20.45 B3DMA1 Atxn2l 1 181.0783011 361649 - 181.0783011 181.089766 ataxin 2-like None TLSSPNNRPSGEASVPPTSAVGR None 607931 16513 20.21 18.15 19.2 19.16 19.64 19.56 18.52 20.61 20.91 20.28 19.46 19.1 20.26 21.16 19.88 18.43 19.71 19.52 20.48 19.34 20.03 19.1 20.11 20.15 20.45 19.06 19.94 19.95 20.99 20.15 20.47 B5DFC8 Eif3c 1 181.1346061 293484 - 181.1346061 181.152489 eukaryotic translation initiation factor 3 subunit c None LRVRGCILTLVERMDEEFTK None 603916 2781 19.22 19.58 19.2 18.04 17.82 18.78 17.92 18.67 18.63 18.83 18.84 17.78 18.5 19.35 18.94 18.58 18.95 18.78 18.96 18.42 20.81 18.63 18.0 19.87 19.76 19.3 19.87 19.11 17.94 18.19 19.79 P17988 Sult1a1 1 181.2720241 83783 - 181.2720241 181.275546 sulfotransferase 1a1 None EDIKENPKREIKKILEFLGR None 171150 128224 17.67 16.57 18.33 18.49 16.96 17.04 18.05 17.78 16.74 16.26 16.98 17.87 15.91 16.27 17.6 16.24 17.47 16.44 17.06 15.44 17.13 15.69 17.36 16.2 15.67 16.56 17.98 16.41 15.97 15.77 17.5 D4A9P7 Bola2 1 181.2917781 502367 + 181.2917781 181.292836 bola family member 2 None KLRQDLEAEHVEVEDTTLNR None None None 17.63 17.64 19.09 18.59 19.02 18.46 19.12 19.54 18.15 19.7 18.19 17.04 19.48 18.59 17.68 18.11 18.57 18.97 18.14 18.97 18.36 18.12 19.57 18.34 19.21 19.32 18.01 18.65 19.0 18.04 18.02 Q91ZN1 Coro1a 1 181.2955631 155151 - 181.2955631 181.300535 coronin-1a None LTAEEWLSGRDAGPLLISLK None 605000 6545 21.86 22.96 20.99 20.86 20.68 22.34 22.07 21.04 21.79 21.35 21.02 22.36 21.27 21.78 21.05 22.33 22.22 21.81 21.3 20.87 22.01 21.17 21.26 21.85 20.8 22.09 20.98 22.06 20.42 20.45 21.39 P21708 Mapk3 1 181.3666571 50689 + 181.3666571 181.372858 mitogen-activated protein kinase 3 None VAWAKLFPKSDSKALDLLDR None 601795 55682 20.32 21.65 21.41 19.07 19.65 20.83 21.64 21.01 19.99 19.93 21.17 18.9 19.62 19.96 19.26 20.74 20.12 20.37 19.71 21.18 19.71 20.27 19.17 19.73 19.77 19.95 20.23 20.06 18.9 20.29 19.68 Q5BJ92 Ppp4c 1 181.3929421 171366 - 181.3929421 181.399468 serine/threonine-protein phosphatase 4 catalytic subunit None GNHESRQITQVYGFYDECLR None 602035 2038 15.88 15.84 16.49 16.14 16.51 17.42 16.8 16.34 17.57 17.56 16.72 17.72 17.82 17.46 16.55 17.01 15.94 17.49 16.72 18.36 18.61 17.27 17.93 16.42 15.59 16.47 17.94 15.88 17.72 16.8 16.79 P05065 Aldoa 1 181.4022761 24189 - 181.4022761 181.407476 fructose-bisphosphate aldolase a None LDGLSERCAQYKKDGADFAK None 103850 123896 26.21 26.4 25.49 24.34 25.84 24.81 26.24 26.2 25.25 26.58 25.46 24.29 25.08 25.58 23.89 25.51 24.89 26.13 25.04 26.54 23.84 25.67 25.3 24.36 25.67 25.59 24.59 25.64 25.47 24.91 23.57 P70611 Doc2a 1 181.4583911 65031 + 181.4583911 181.46203 double c2-like domain-containing protein alpha None RISVCDEDKLSHNEFIGEIR None None None 16.74 17.92 17.65 17.16 17.31 18.69 18.26 17.12 18.39 19.2 18.33 18.58 18.78 19.04 16.76 18.2 18.51 18.93 18.36 17.29 18.97 18.19 19.24 18.72 16.48 17.97 17.05 18.88 17.31 17.52 17.07 F1LSD5 Taok2 1 181.4758571 64666 - 181.4758571 181.493994 serine/threonine-protein kinase tao2 None KHRFVLRERPPTVIMDLIQR None 613199 74531 17.17 17.24 17.73 18.47 17.43 16.28 17.37 17.29 17.72 18.21 16.79 17.76 17.91 18.03 18.53 18.15 18.39 17.33 18.28 16.08 18.27 17.9 17.58 18.52 18.44 18.74 18.11 17.97 17.24 17.06 17.98 Q9JLS3 Taok2 1 181.4758571 64666 - 181.4758571 181.493994 serine/threonine-protein kinase tao2 None LQSGHWSEYFRNFVDSCLQK None 613199 74531 16.86 17.87 17.47 18.1 17.39 16.57 17.41 17.84 17.36 18.25 16.43 17.59 17.55 17.08 18.15 18.41 18.32 17.21 18.32 16.05 17.99 17.67 17.36 18.46 18.25 18.78 17.92 17.85 17.04 17.03 17.66 Q7TQ24 Kctd13 1 181.5345351 293497 + 181.5345351 181.552842 pdip1 None FGTILNYLRDGSVPLPESTR None 608947 27800 15.76 14.9 14.93 17.05 14.53 16.95 16.72 14.4 14.41 14.67 15.6 16.22 15.67 15.18 14.62 15.04 16.65 15.22 15.49 14.97 15.75 16.08 16.05 14.92 15.68 16.34 15.03 14.98 16.29 14.3 14.92 D4A6P1 Sez6l2 1 181.557111 308988 + 181.557111 181.577456 rcg40132, isoform cra_a None YEELLDNRKLEVTQTTDPSR None None 8237 17.86 15.83 18.26 17.86 16.77 16.56 17.81 17.16 18.16 17.74 17.84 17.91 18.4 17.58 18.07 17.09 17.5 17.36 16.96 18.03 18.84 17.15 18.11 16.58 17.68 17.17 17.53 17.03 18.88 17.49 18.01 P70500 Cdipt 1 181.5832731 192260 + 181.5832731 181.587409 cdp-diacylglycerol--inositol 3-phosphatidyltransferase None APIALLKSIISVIHLVTAAR None None 7159 18.71 16.64 18.62 17.68 18.02 17.89 18.1 18.9 19.12 19.13 17.91 18.65 18.95 18.34 19.05 18.03 17.95 18.82 19.2 16.74 19.06 18.95 18.67 18.62 16.2 18.88 18.42 18.73 18.34 18.83 18.95 A0A140TAE0 Mvp 1 181.594721 64681 - 181.594721 181.623965 major vault protein None VRMVTVPPRHYCIVANPVSR None 157700 3752 17.86 17.34 18.81 17.79 18.48 17.26 17.34 19.53 18.13 17.05 19.47 18.73 18.47 18.45 19.52 17.79 17.41 17.46 17.77 18.96 18.61 17.76 18.11 18.53 18.56 17.24 19.54 18.36 17.39 19.06 19.3 Q62667 Mvp 1 181.594721 64681 - 181.594721 181.623965 major vault protein None ALGPGTIRDLAVAGPEMQVK None 157700 3752 17.86 17.32 18.81 17.79 18.48 17.26 17.34 19.53 18.13 17.05 19.47 18.73 18.45 18.45 19.52 17.79 17.41 17.46 17.77 18.96 18.61 17.76 18.08 18.53 18.56 17.24 19.54 18.36 17.39 19.05 19.34 D3ZFB6 Prrt2 1 181.6252441 361651 - 181.6252441 181.628833 proline-rich transmembrane protein 2 None AYAVMSRNSLQQGDVDGAQR None None None 18.3 16.79 16.51 17.91 17.98 17.33 17.79 17.14 19.12 18.58 18.54 17.41 18.48 18.81 16.83 17.4 17.19 18.84 19.04 18.37 19.37 17.92 18.67 17.83 18.09 18.4 18.13 17.18 19.46 18.65 18.55 Q5I0M2 Qprt 1 181.718191 293504 - 181.718191 181.733498 nicotinate-nucleotide pyrophosphorylase [carboxylating] None EALQAAEAGADLVMLDNFKPEELHPTAATLK None 606248 8623 15.36 16.97 15.97 15.42 16.11 15.42 15.12 16.02 15.38 15.84 15.82 14.08 14.82 14.25 14.75 16.12 13.98 16.39 15.7 16.19 15.45 14.65 14.81 15.66 16.29 15.37 15.43 16.19 14.64 14.67 15.27 B4F786 Cd2bp2 1 181.8094021 293505 - 181.8094021 181.812898 cd2 antigen (cytoplasmic tail) binding protein 2, isoform cra_a None KVTFQGVGDEDDEDEISVPK None None 4455 15.61 16.6 16.88 16.36 17.1 14.97 15.72 16.79 17.11 16.63 14.57 15.78 15.66 15.37 16.08 16.42 16.34 15.89 16.15 17.4 16.06 16.3 15.42 16.49 16.64 16.23 15.78 16.74 16.99 16.15 17.65 D3ZSY8 Tbc1d10b 1 181.8149731 365372 - 181.8149731 181.826628 tbc1 domain family, member 10b None ELLEQNPGKFEELERAPGDPK None None None 19.63 17.34 19.11 18.28 17.72 20.4 19.39 18.11 19.63 19.9 18.88 18.46 18.85 19.2 18.88 19.47 19.07 19.13 19.77 17.75 19.88 19.98 19.89 18.42 18.05 18.99 18.93 19.59 18.59 18.79 18.44 P31325 Phkg2 1 182.1843581 140671 + 182.1843581 182.197123 phosphorylase b kinase gamma catalytic chain, liver/testis isoform None MFLVFDLMRKGELFDYLTEK None 172471 47915 15.69 16.69 15.81 16.21 16.52 16.1 16.32 17.52 16.31 16.84 17.5 17.14 16.88 15.78 15.19 16.14 16.77 16.54 16.29 16.84 15.2 16.5 15.91 16.05 16.27 15.27 15.8 17.54 16.05 15.93 16.05 Q8CJB9 Rnf40 1 182.2026161 266712 + 182.2026161 182.217241 e3 ubiquitin-protein ligase bre1b None KGDAQRYKRKLREVQAEIGK None None 8856 16.77 15.35 17.02 16.68 16.72 16.57 16.32 16.45 17.55 15.52 16.15 17.33 17.17 17.25 17.63 16.3 15.94 16.5 16.9 17.47 18.45 16.92 16.98 16.62 17.71 16.89 17.4 17.25 16.61 17.39 18.13 P61265 Stx1b 1 182.4155471 24923 - 182.4155471 182.434325 syntaxin-1b None ELHDMFVDMAMLVESQGEMIDR None 601485 69375 23.43 21.74 23.14 22.83 22.97 22.86 24.08 22.91 23.83 22.92 22.31 23.6 23.71 23.73 22.58 22.12 22.71 23.04 23.05 24.43 24.07 23.57 23.46 22.03 23.3 23.18 22.86 23.98 22.9 24.05 24.1 Q08850 Stx4 1 182.4514161 81803 + 182.4514161 182.458685 syntaxin-4 None KAIEPQKEEADENYNSVNTR None 186591 105435 17.59 16.24 16.83 16.19 18.13 17.01 15.87 17.76 16.2 17.23 18.46 16.19 16.63 17.63 16.07 17.37 16.74 17.5 16.8 18.34 16.04 16.92 16.76 18.41 17.85 17.11 16.95 16.58 17.77 18.67 16.93 Q6TEK4 Vkorc1 1 182.5008451 309004 - 182.5008451 182.505008 vitamin k epoxide reductase complex subunit 1 None ARNEDYRALCDVGTAISCSR None 608547 11416 14.08 16.36 15.11 15.08 15.52 15.94 15.88 16.78 15.88 16.11 15.32 16.29 15.69 15.29 16.29 15.03 15.5 15.34 15.75 14.58 16.04 15.15 15.8 16.06 13.94 15.45 14.91 15.4 14.97 14.89 15.06 Q00972 Bckdk 1 182.5153361 29603 + 182.5153361 182.520589 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase None DQADEAQYCQLVRQLLDDHK None None 37642 16.59 16.17 17.93 16.43 17.03 17.42 17.39 17.15 17.5 16.48 16.63 17.1 17.59 17.64 18.11 16.03 15.96 17.63 17.53 16.87 18.5 17.31 16.84 16.71 16.62 17.09 17.79 16.95 17.36 17.06 18.85 Q5PQK2 Fus 1 182.5765461 317385 + 182.5765461 182.590414 fus rna-binding protein None TVSFDDPPSAKAAIDWFDGK None 137070 32617 19.57 18.29 20.28 19.43 20.04 19.16 18.71 18.47 19.96 18.98 18.66 19.06 19.94 20.19 20.91 19.42 18.99 19.47 19.92 19.97 21.12 19.67 19.98 19.96 20.33 20.44 20.78 19.09 19.85 20.3 20.72 G3V8L1 Pycard 1 182.6015441 282817 - 182.6015441 182.602921 pyd and card domain-containing None GRARDAILDALENLTADEFK None 606838 8307 16.15 14.86 15.98 15.02 15.0 15.76 15.83 16.03 15.03 15.42 17.25 14.95 15.66 15.47 15.78 15.04 15.27 16.26 15.17 14.35 16.32 15.61 15.94 14.65 15.08 15.08 14.8 16.3 15.2 15.8 15.86 A0A0G2K4L8 Itgam 1 182.6590481 64350 + 182.6590481 182.788451 integrin alpha-d None TFQENARGFGQSVIQLGETR None 602453 526 17.28 16.65 16.89 16.26 14.66 15.67 16.13 15.48 15.18 16.4 17.47 15.4 15.75 16.42 17.8 16.45 15.5 16.47 16.03 15.03 16.91 17.81 15.47 16.43 16.89 16.33 14.88 17.51 16.43 16.1 17.37 G3V8L7 Itgam 1 182.6590481 64350 + 182.6590481 182.788451 integrin alpha m None FGDPLNYEDVIPEAEEAGIIR None 602453 526 17.94 15.55 17.44 15.76 17.06 17.4 16.56 17.51 16.23 17.63 18.11 15.38 16.79 15.72 18.41 16.11 16.17 16.96 16.55 15.54 16.79 18.46 16.63 17.29 16.56 16.27 15.39 18.02 16.98 16.9 18.23 Q99PD6 Tgfb1i1 1 182.8286691 84574 + 182.8286691 182.835456 transforming growth factor beta-1-induced transcript 1 protein None EHFLCRGCSTTLGGSSFFEK None 602353 7572 15.25 16.05 15.74 14.81 15.47 14.58 16.17 16.56 15.41 15.73 15.83 15.47 14.85 15.36 15.69 15.18 16.44 15.42 14.77 14.12 14.81 15.53 14.95 15.71 14.74 14.72 16.11 14.67 14.29 15.22 14.69 G3V8P5 Rgd1310127 1 182.8522761 361654 - 182.8522761 182.880701 similar to cdna sequence bc017158 None DTASLRAPLCTEQFGSGAPR None None 11232 16.69 17.73 16.46 16.0 16.81 16.07 16.22 17.5 16.57 16.75 18.05 15.2 17.0 17.05 15.97 17.42 15.64 16.92 18.14 16.75 15.39 15.96 15.23 17.08 17.58 16.93 15.76 18.48 16.37 16.96 16.8 A9UMW3 Ahsp 1 182.8845351 293522 + 182.8845351 182.885506 alpha hemoglobin-stabilizing protein None GALKELQQELSTLGSQFLAK None 605821 None 14.45 14.79 15.55 16.29 16.03 15.02 15.69 16.5 14.82 15.07 17.01 15.2 17.26 14.25 14.73 16.26 15.81 15.23 14.49 17.22 14.42 15.07 15.81 15.8 15.71 15.0 16.52 14.72 14.76 15.33 15.55 P49806 Rgs10 1 182.9463371 54290 - 182.9463371 182.987641 regulator of g-protein signaling 10 None STAKWASSLENLLEDPEGVK None None 37710 17.15 16.34 16.25 16.09 17.59 15.58 16.61 15.64 16.24 16.48 16.62 15.03 16.34 16.25 16.18 16.98 16.84 17.23 16.06 15.65 16.51 15.45 16.31 15.83 17.58 16.58 17.12 16.43 15.32 15.38 17.01 Q5BJN3 Tial1 1 183.0108121 361655 - 183.0108121 183.031397 tia1 cytotoxic granule-associated rna-binding protein-like 1 None QETNTKQLRFEDVVNQSSPK None 603413 87796 17.78 15.75 16.87 17.24 17.67 16.33 16.03 16.97 18.18 16.5 15.85 17.67 17.26 17.32 17.68 17.0 17.45 17.32 17.2 17.12 18.11 16.8 17.11 18.16 17.74 17.65 18.27 16.31 17.5 17.87 18.61 Q5U2U8 Bag3 1 183.1029421 293524 + 183.1029421 183.126862 bag cochaperone 3 None SPAPAEAASLKSGDAEAPHK None 603883 3162 19.73 17.27 17.98 18.12 18.98 17.73 18.19 18.48 17.44 17.68 19.79 17.38 17.85 17.43 17.8 18.68 18.83 17.58 17.2 18.77 17.07 17.55 17.63 18.11 18.44 17.47 17.89 18.46 17.41 18.44 17.57 D3ZKG7 Inpp5f 1 183.1904811 309008 + 183.1904811 183.270276 inositol polyphosphate-5-phosphatase f None DRTNVVQAAIARVVMEQQLK None None 8962 19.32 18.72 18.26 17.93 18.03 18.74 18.16 18.55 18.26 16.59 18.43 17.39 17.11 17.8 18.22 17.4 18.96 17.62 18.23 17.49 18.03 19.04 17.11 17.91 19.34 18.32 18.52 17.23 18.8 18.16 18.22 G3V8Q8 Sec23ip 1 183.3210391 309010 + 183.3210391 183.363959 rcg40648, isoform cra_b None LLLLKEIYRTMNISPEQPQH None None 38288 19.12 16.22 19.64 18.08 17.38 19.42 18.5 17.2 18.2 17.4 18.44 18.9 18.57 18.58 18.82 17.25 19.69 18.14 17.15 17.62 19.82 18.79 18.95 16.76 17.39 17.37 19.36 17.73 19.21 18.16 18.61 F1LSG7 Fgfr2 1 184.7454211 25022 - 184.7454211 184.850626 fibroblast growth factor receptor None IKHVEKNGSKYGPDGLPYLK None 176943 22566 16.51 17.0 16.69 16.38 16.32 16.33 17.09 17.6 15.28 15.47 15.33 16.45 14.99 14.81 15.61 16.31 17.21 15.09 16.58 15.81 15.18 15.63 15.47 15.75 15.54 17.06 16.11 16.3 15.17 15.8 16.06 A0A0G2JX45 Ate1 1 184.9112311 103690122 - 184.9112311 185.140636 arginyl-trna--protein transferase 1 None KVHVGPKPGKGADLSKPPCR None None None 18.12 15.94 19.14 18.07 16.54 18.0 18.89 17.29 17.13 16.93 17.98 17.51 18.11 17.32 18.6 17.6 18.63 16.54 17.04 17.51 18.44 19.04 18.33 17.75 18.08 17.71 18.27 17.02 16.71 18.6 17.76 A0A0G2K598 Tacc2 1 185.0555471 309025 + 185.0555471 185.327891 transforming, acidic coiled-coil-containing protein 2 None VQQLVLEKEQALADLNSVEK None 605302 5087 17.86 15.55 18.49 18.38 17.06 17.51 17.61 17.41 17.23 17.73 16.67 17.49 17.73 16.8 17.22 17.99 18.18 17.34 15.83 18.41 17.35 16.61 17.64 16.19 17.29 16.75 17.92 16.52 18.4 18.24 17.34 D3ZXK3 Tacc2 1 185.0555471 309025 + 185.0555471 185.327891 transforming, acidic coiled-coil-containing protein 2 None IEYMEKLGSSLPQDDDTPKK None 605302 5087 17.89 15.55 18.49 18.38 17.06 17.51 17.61 17.41 17.23 17.73 16.67 17.49 17.74 16.8 17.22 17.99 18.18 17.34 15.83 18.41 17.35 16.61 17.64 16.19 17.29 16.75 17.92 16.52 18.4 18.16 17.36 A0A0G2K1A8 Plekha1 1 185.4280491 361659 + 185.4280491 185.479156 pleckstrin homology domain-containing a1 None SPEEMHSWIKAVSGAIVAQR None 607772 11001 17.28 15.12 16.45 17.43 16.57 16.43 16.87 16.46 16.58 16.93 16.55 16.29 16.58 17.14 17.05 15.82 16.21 16.72 16.92 15.29 16.57 16.52 16.86 16.64 16.93 16.49 16.86 15.96 16.06 17.35 16.53 Q9QZK5 Htra1 1 185.4977771 65164 + 185.4977771 185.547385 serine protease htra1 None GISRSAPAATVCPEHCDPTR None 602194 31114 14.1 15.94 14.73 15.4 15.91 16.51 14.12 15.11 15.78 15.96 14.77 16.12 15.84 14.36 16.43 16.41 16.16 14.62 14.99 14.42 15.8 14.24 15.76 16.09 14.03 15.44 15.74 14.64 16.6 14.73 14.57 P70584 Acadsb 1 186.1889421 25618 + 186.1889421 186.228618 short/branched chain specific acyl-coa dehydrogenase None AKIGTIYEGTSNIQLNTIAK None 600301 1216 16.94 16.69 16.62 16.98 17.13 15.71 18.02 17.29 14.98 17.42 16.37 16.79 16.63 17.05 16.38 16.81 16.38 16.12 18.1 16.67 15.97 16.52 16.49 15.86 17.58 17.34 17.5 17.01 15.78 16.71 18.26 D3Z9L5 Wdr11 1 184.1652571 309016 + 184.1652571 184.21083 wd repeat domain 11 None FASKAGAAGRDLLNELGSPK None 606417 None 18.16 15.97 19.58 17.49 16.61 17.26 18.23 17.98 18.14 17.4 17.56 17.39 18.32 17.54 18.87 17.6 18.11 17.96 18.21 16.29 19.51 18.73 17.9 18.48 17.94 17.73 18.4 18.01 16.39 18.71 18.55 D4A567 Bub3 1 186.3279321 361662 + 186.3279321 186.360848 bub3 mitotic checkpoint protein None VKLWDPRTPCNAGTFSQPEK None 603719 3470 16.96 16.91 17.78 17.0 16.88 16.88 16.2 16.87 18.1 16.22 16.16 17.86 17.42 17.38 17.48 16.7 16.5 17.09 17.13 18.17 18.95 17.3 17.12 17.68 17.5 16.96 18.01 16.93 17.26 17.58 18.4 Q4FZS2 Bub3 1 186.3279321 361662 + 186.3279321 186.360848 bub3 mitotic checkpoint protein None EHPEDGIFIRQVTDAETKPK None 603719 3470 17.4 17.06 18.54 17.5 17.35 17.53 16.48 17.33 18.48 16.33 17.18 18.02 17.95 18.05 18.47 17.08 17.16 17.37 17.53 18.71 19.58 17.94 17.78 18.33 18.65 17.47 18.53 17.51 18.01 18.25 18.92 P04182 Oat 1 187.3478631 64313 - 187.3478631 187.367644 ornithine aminotransferase None PSDVVTAVRGKGLLNAIVIR None 613349 231 20.11 21.87 19.8 21.03 18.59 18.27 20.31 18.7 19.31 19.85 21.3 19.3 19.63 20.5 18.33 19.85 19.6 20.84 20.2 20.42 20.35 20.37 19.72 20.33 20.17 20.25 18.83 20.23 19.5 19.41 19.25 Q5I0D5 Lhpp 1 187.4034521 361663 + 187.4034521 187.494577 phospholysine phosphohistidine inorganic pyrophosphate phosphatase None ALEYACGIEAEVVGKPSPEFFR None None 41469 19.56 19.72 20.58 20.3 20.2 19.32 20.39 18.56 17.44 18.8 18.81 18.86 18.72 17.72 18.12 18.57 19.56 18.05 20.56 18.52 19.04 18.44 20.14 17.64 18.96 19.3 19.52 18.2 19.14 18.46 17.35 D4A415 Abraxas2 1 187.6468771 293570 + 187.6468771 187.67269 abraxas 2, brisc complex subunit None YQVYNALQEKVQAVCADVEK None 611144 12970 17.84 16.77 17.11 16.43 16.48 17.6 17.37 16.87 17.67 17.69 17.2 17.53 17.47 18.11 18.52 16.1 17.77 16.9 17.09 16.47 18.2 17.44 17.58 17.82 15.39 17.05 17.51 17.16 16.76 16.69 16.91 Q9EQH5 Ctbp2 1 187.7826831 81717 - 187.7826831 187.821804 c-terminal-binding protein 2 None LVNAARGGLVDEKALAQALK None 602619 75187 18.74 20.02 19.93 19.63 19.85 20.4 20.4 19.87 21.15 19.85 18.83 20.86 21.14 20.68 21.55 19.63 20.51 19.87 20.87 19.0 22.17 20.57 20.62 20.67 20.01 21.29 20.3 21.39 19.07 20.14 20.58 Q5XIF2 Uros 1 188.4917111 309070 - 188.4917111 188.512237 hydroxymethylbilane hydrolyase [cyclizing] None LSGGSFDQIKFVAIGPSTTR None 606938 37296 15.99 13.94 16.84 15.45 15.72 16.07 16.75 16.44 15.02 15.52 15.93 16.05 16.17 14.6 16.15 15.93 15.49 14.56 16.52 15.39 16.12 16.36 16.05 15.12 15.23 15.76 16.28 15.39 15.08 16.49 15.71 D3ZGJ0 Dhx32 1 188.5245131 361667 - 188.5245131 188.5775 deah-box helicase 32 (putative) None QASGHLPTTAMDKDQDVCDK None 607960 56798 15.4 16.45 15.48 14.09 14.98 15.35 14.69 16.15 15.24 15.3 15.45 13.85 15.33 16.29 15.59 14.97 15.77 15.8 14.53 15.1 15.35 16.15 15.1 17.03 16.46 16.25 15.83 15.26 14.43 14.42 15.62 D3ZZW1 Dock1 1 189.4671441 309081 + 189.4671441 189.983768 dedicator of cyto-kinesis 1 None EIIHYFDKGKMWEEAIALGK None 601403 55575 17.72 17.99 17.62 16.88 18.08 17.48 18.18 17.33 16.6 16.44 18.45 17.18 16.43 17.38 18.27 17.31 17.45 16.77 18.28 16.39 18.37 16.84 17.25 16.58 18.26 17.74 18.32 17.41 16.49 17.58 17.21 B2GV87 Ptpre 1 190.407141 114767 + 190.407141 190.489558 receptor-type tyrosine-protein phosphatase epsilon None TLHGTATHFDKIGLEEEFRK None 600926 31387 18.22 15.95 17.8 17.87 18.44 17.58 17.99 18.28 16.1 16.73 16.82 17.11 17.66 16.14 18.23 18.04 18.06 16.84 18.23 16.01 16.16 17.02 17.96 16.57 18.35 18.97 19.15 16.81 16.86 17.17 17.04 Q9JLZ1 Glrx3 1 192.2417821 58815 + 192.2417821 192.272005 glutaredoxin-3 None PTYPQLYVRGDLVGGLDIVK None 612754 4769 20.27 19.96 19.23 18.97 19.95 18.57 18.9 20.63 18.82 19.77 19.94 17.73 18.87 19.1 18.5 19.65 18.65 20.04 18.79 20.87 17.72 19.0 18.39 20.01 20.56 19.57 20.13 18.59 18.81 19.48 19.11 P56932 Ppp2r2d 1 193.6659641 246255 + 193.6659641 193.699949 serine/threonine-protein phosphatase 2a 55 kda regulatory subunit b delta isoform None GEYNVYSTFQSHEPEFDYLK None None 2035 20.45 20.26 19.06 19.43 19.42 19.77 19.1 19.84 19.33 19.58 19.89 19.31 20.13 19.99 19.66 20.39 20.46 20.4 19.4 19.96 19.18 21.23 20.02 20.44 21.27 21.49 20.73 19.5 19.36 20.29 19.88 Q9ET45 Bnip3 1 193.7081651 84480 - 193.7081651 193.725348 bcl2-interacting protein 3 None DTHSFGEKNSTLSEEDYIER None None 2990 17.38 15.74 16.91 16.6 17.12 16.28 16.42 15.8 17.7 17.01 17.67 17.19 17.49 18.01 17.17 17.3 16.93 16.4 16.71 17.82 16.79 17.68 17.36 17.97 16.15 16.39 15.58 17.58 17.19 17.23 17.3 D3ZXX4 Jakmip3 1 193.811431 365380 + 193.811431 193.881104 janus kinase and microtubule-interacting protein 3 None KLDILGDNANLTNEEQVVVIQAR None None None 18.19 18.6 18.17 17.27 17.48 19.01 17.18 17.12 16.49 17.55 18.18 16.4 17.21 17.96 18.11 18.19 18.72 16.65 17.11 16.95 16.35 18.02 17.54 17.19 18.49 17.64 17.85 16.96 18.94 17.56 16.24 Q62951 Dpysl4 1 193.8831071 25417 + 193.8831071 193.898914 dihydropyrimidinase-related protein 4 None NIFEGVECRGMPTVVISQGR None 608407 4691 19.72 19.87 21.11 20.28 20.36 20.27 21.28 20.31 21.03 19.52 19.75 20.58 20.97 21.31 19.59 19.87 19.33 20.95 21.1 21.94 21.55 20.5 20.2 19.88 21.55 20.73 20.45 21.11 20.7 21.47 21.7 D4A3D9 Stk32c 1 193.9007191 365381 - 193.9007191 193.981723 serine/threonine kinase 32c None GGDLRYHLQQNVQFSEDTVR None None 75157 17.82 18.39 17.99 18.28 16.53 18.31 18.6 17.3 18.09 17.98 18.53 17.61 17.32 18.42 16.2 17.92 17.64 18.17 18.72 18.05 18.06 18.65 17.71 17.59 16.81 18.22 16.67 18.78 17.91 17.3 17.14 D3ZZX1 Inpp5a 1 194.1906371 365382 + 194.1906371 194.380685 inositol polyphosphate-5-phosphatase a None LCTKATMQTVRAADTNEVVK None 600106 4045 18.72 18.39 18.96 18.62 19.37 18.78 19.36 18.88 19.52 18.46 18.35 19.88 19.54 19.59 20.17 18.38 17.94 18.59 19.56 19.53 20.29 18.98 18.75 18.11 19.29 18.98 19.64 19.59 18.92 19.53 20.64 D4A8Q2 Kndc1 1 194.6903971 361672 + 194.6903971 194.736796 kinase non-catalytic c-lobe domain-containing 1 None MRNGENPGQEGLANLVLDAR None None 45138 17.71 17.37 16.75 17.31 17.32 17.28 17.84 16.73 16.46 18.41 17.44 16.42 16.82 16.46 17.65 17.69 17.97 16.36 17.4 15.95 16.17 16.72 17.48 16.33 16.66 17.2 16.7 16.5 17.69 16.81 15.64 B2RYP8 Tubgcp2 1 194.7921431 309098 - 194.7921431 194.812676 gamma-tubulin complex component None IEKAFNYASKVLLDFLMEEK None None 55980 19.53 20.85 19.81 19.5 19.03 19.79 19.59 19.82 19.13 20.45 21.03 18.14 19.03 20.18 20.62 19.12 20.38 18.93 19.14 18.72 19.14 19.83 18.62 20.0 19.71 18.91 19.37 19.51 19.34 19.75 19.15 D3Z8W0 Paox 1 194.9032741 293589 + 194.9032741 194.928311 polyamine oxidase None TNCILASLPKEVMVFDKPVK None None None 18.99 17.0 17.9 17.07 16.96 17.11 18.06 17.7 16.39 16.7 18.35 16.94 17.22 17.32 15.89 18.0 17.55 17.24 16.58 18.74 15.65 16.81 17.37 17.87 17.82 16.14 17.31 16.85 16.02 17.21 16.85 B1H241 Ric8a 1 195.9351631 293614 + 195.9351631 195.941468 protein ric-8a None TGRVEEKPPNPMEGMTEEQK None None 23331 17.69 15.7 17.45 17.19 16.06 18.23 17.74 17.11 16.8 17.69 18.63 16.49 17.91 18.43 17.19 16.79 17.78 18.34 17.61 16.81 18.14 18.34 18.23 18.07 18.78 17.54 17.21 18.05 16.74 18.22 17.79 Q80ZG1 Ric8a 1 195.9351631 293614 + 195.9351631 195.941468 synembryn-a None ARMHRPARKFLKAQVLPPLR None None 23331 17.69 15.7 17.45 17.19 16.06 18.23 17.7 17.11 16.8 17.69 18.63 16.49 17.91 18.43 17.82 16.79 17.32 18.26 17.74 16.45 18.14 18.34 18.23 18.2 18.78 17.54 16.94 17.97 16.99 18.22 17.79 C6ZII9 Sirt3 1 195.9420781 293615 - 195.9420781 195.964004 nad-dependent protein deacetylase None RLYTQNIDGLERASGIPASK None 604481 81827 17.66 18.74 17.74 16.38 16.77 18.03 15.93 17.1 18.04 18.74 17.28 17.26 17.06 17.59 16.75 16.87 17.38 16.85 16.31 18.85 17.02 18.0 16.44 17.01 15.69 16.26 17.4 18.59 17.65 16.37 17.98 B0BN93 Psmd13 1 195.9645521 365388 + 195.9645521 195.976884 26s proteasome non-atpase regulatory subunit 13 None FLEKTREKVKSSDEAVILCK None None 2110 20.27 21.86 20.89 19.3 19.29 20.31 19.57 19.44 20.49 21.19 20.13 20.31 19.82 20.61 21.33 18.74 20.09 19.97 20.05 18.62 21.5 20.77 19.17 21.34 18.84 18.46 20.56 19.37 19.3 19.27 20.56 D3ZY02 Pgghg 1 196.0391081 309103 + 196.0391081 196.043957 protein-glucosylgalactosylhydroxylysine glucosidase None PEAARAILEYRIRTLGGALK None None 16023 15.93 16.14 16.62 15.6 15.98 13.58 16.31 16.02 15.52 15.23 15.59 14.85 14.69 14.51 14.61 15.25 15.3 16.12 15.74 16.13 16.44 15.26 14.54 14.76 16.32 15.83 15.96 15.39 14.96 15.3 16.68 D3ZVI9 Gatd1 1 196.5067461 100911365 - 196.5067461 196.51252 parkinson disease 7 domain containing 1, isoform cra_a None ELIRAPGFARLSLIVEDFVK None None None 17.31 19.0 18.01 17.19 16.69 17.0 16.26 17.77 18.49 18.11 17.59 17.74 16.89 17.49 17.16 16.76 16.13 18.34 17.61 18.4 17.94 18.0 17.09 18.64 16.95 16.82 17.18 17.7 17.62 16.69 17.42 Q5FVI4 Cend1 1 196.5251621 100911402 - 196.5251621 196.528152 cell cycle exit and neuronal differentiation protein 1 None ADPVLLNNHSNLKPAPTVPAAPSSPDTTSEPK None None None 22.53 24.9 21.44 22.5 23.28 23.07 22.03 22.06 23.76 22.77 22.95 22.64 22.21 22.88 22.16 24.24 23.08 22.72 21.9 23.95 21.42 23.19 22.38 22.75 22.94 23.83 22.21 23.04 24.21 22.5 22.29 P02401 Rplp2 1 196.5466121 140662 + 196.5466121 196.5486 60s acidic ribosomal protein p2 RP2 None None None None 20.97 18.96 20.63 21.12 20.45 19.51 19.42 21.25 20.36 20.61 21.87 20.04 21.06 20.41 19.81 20.2 21.53 20.72 19.84 20.71 20.75 20.3 20.99 20.75 21.41 19.22 21.27 19.57 21.83 21.0 20.98 A0JPQ9 Chid1 1 196.5944751 100911881 - 196.5944751 196.629656 chitinase domain-containing protein 1 None TYDDFRSVLDSEDEIEELSK None None None 18.73 18.24 18.18 18.25 17.85 17.71 18.15 18.74 18.9 19.34 19.24 17.47 19.13 19.87 17.68 17.86 19.39 19.05 17.12 19.49 17.71 19.65 18.54 18.63 19.3 17.88 17.19 19.57 19.05 19.44 17.35 B2GV22 Ptdss2 1 196.2414951 293620 + 196.2414951 196.267685 phosphatidylserine synthase 2 None DGRQFLKYVDPRLGVPLPER None 612793 8462 16.77 14.86 16.09 16.56 17.37 16.43 17.23 15.3 16.53 16.32 15.82 16.38 17.25 17.06 16.26 16.87 17.09 16.41 17.62 16.32 17.14 16.48 17.03 15.53 17.69 18.14 17.05 17.1 16.75 17.52 17.21 A0A0G2K9E0 Rnh1 1 196.2692951 100360501 - 196.2692951 196.281764 ribonuclease inhibitor None VLWLGDCDVTDSGCSSLATVLLANR None None None 18.34 18.69 19.19 19.45 19.97 19.76 20.66 19.65 20.11 20.1 19.24 20.33 20.35 19.25 18.87 19.38 18.47 19.57 20.03 21.12 20.15 19.5 20.43 18.29 18.11 19.29 19.25 19.6 19.98 19.55 19.46 P29315 Rnh1 1 196.2692951 100360501 - 196.2692951 196.281764 ribonuclease inhibitor None ACQLESLKLENCGITSANCK None None None 18.26 18.63 19.11 19.4 19.9 19.67 20.69 19.6 20.04 20.03 19.16 20.27 20.28 19.16 18.84 19.33 18.46 19.38 20.02 21.03 20.07 19.42 20.36 18.37 18.04 19.23 19.08 19.46 19.84 19.47 19.39 P20171 Hras 1 196.2963931 293621 - 196.2963931 196.299671 gtpase hras None EQIKRVKDSDDVPMVLVGNK None 190020 55890 20.47 18.77 19.66 19.75 19.04 20.16 19.37 19.47 20.43 21.43 18.92 19.72 20.37 20.3 19.08 19.91 19.96 19.91 19.79 20.52 19.62 20.46 20.4 19.7 18.82 20.12 19.86 19.54 21.23 20.08 19.93 Q63625 Phrf1 1 196.3339811 245925 + 196.3339811 196.366892 phd and ring finger domain-containing protein 1 None VIHRDGSLSAKRAAPVSLQR None None 16377 17.11 15.17 16.7 16.66 16.05 17.09 14.88 15.71 17.95 15.35 15.09 17.19 17.1 17.4 16.25 15.87 15.28 16.95 16.97 16.82 17.38 16.17 16.07 17.05 16.78 16.71 17.0 16.28 17.48 16.28 17.94 F7DLY1 Eps8l2 1 196.4461471 361674 + 196.4461471 196.471537 eps8-like 2 None AGNKEELIHHMDEVNDELMK None None 69358 17.06 15.81 16.36 16.78 17.53 16.88 17.38 16.88 17.93 16.66 16.58 18.16 17.77 17.57 16.56 16.55 15.78 17.24 17.85 18.14 18.04 16.83 17.05 16.61 16.66 16.97 16.89 18.24 16.49 17.43 18.25 Q9EQS0 Taldo1 1 196.4935951 83688 + 196.4935951 196.503964 transaldolase None SSKLAPTLSVKAAQTSDLEK None 602063 4916 21.4 21.37 20.66 20.82 21.99 20.55 21.82 21.5 20.16 19.87 19.64 21.41 20.35 19.35 21.42 21.31 19.19 19.92 21.67 21.34 20.31 19.66 20.07 19.73 20.39 22.13 21.14 19.72 21.09 19.79 22.12 A0A0G2K5L2 Slc25a22 1 196.5285011 100911440 - 196.5285011 196.53298 mitochondrial glutamate carrier 1-like None SMSDCLIKTIRSEGYFGMYR None None None 19.05 22.04 19.43 19.54 19.69 19.96 19.69 20.51 20.29 20.72 18.54 19.51 19.98 20.77 21.1 18.82 20.42 20.19 19.79 18.43 19.93 19.59 19.56 20.19 19.88 20.89 19.68 20.29 20.18 19.16 19.8 Q9QZA6 Cd151 1 196.5647451 100911730 + 196.5647451 196.568751 cd151 antigen None CGKREHASNIYKVEGGCITK None None None 16.6 16.75 17.46 18.18 18.6 18.57 18.2 17.6 17.96 18.19 17.12 18.73 18.19 16.51 19.19 19.38 16.91 16.96 18.26 17.32 17.75 16.77 19.0 17.19 16.34 17.84 18.34 16.21 18.9 17.38 17.35 P18484 Ap2a2 1 196.6523811 81637 + 196.6523811 196.724275 ap-2 complex subunit alpha-2 None LSVKLLRLLQCYPPPDPAVR None 607242 5335 20.85 23.14 22.0 21.96 21.75 23.06 21.79 21.72 22.82 23.68 21.37 22.81 23.21 23.0 22.0 22.67 22.47 22.71 22.98 21.79 23.07 22.99 23.24 21.43 21.27 22.95 21.93 23.42 23.86 21.75 22.0 Q66HM2 Ap2a2 1 196.6523811 81637 + 196.6523811 196.724275 ap-2 complex subunit alpha None LVAGDTMDSVKQSAALCLLR None 607242 5335 20.87 23.13 22.0 22.12 21.94 22.92 21.81 22.21 22.91 23.64 21.48 22.91 23.22 22.61 22.02 22.97 22.52 22.63 22.95 21.77 22.69 22.73 23.25 21.4 21.13 22.76 21.92 23.37 23.9 21.75 22.0 A2RUW1 Tollip 1 196.9615691 361677 - 196.9615691 196.982448 toll-interacting protein None AFSMDDRIAWTHITIPESLK None 606277 10375 19.97 20.54 20.35 20.22 19.13 18.92 18.92 18.76 18.77 20.7 18.8 18.86 18.63 18.78 19.08 20.05 18.73 18.72 18.59 20.42 17.82 19.67 18.43 17.83 18.5 18.19 20.53 19.14 18.91 18.72 18.97 D3ZML2 Brsk2 1 197.0656531 + 197.0656531 197.086604 serine/threonine-protein kinase brsk2 None ERKSMEVLSVTDGGSPVPAR None None None 19.53 17.57 18.09 19.16 18.73 18.65 18.94 19.32 19.15 19.65 18.06 19.31 19.66 18.8 18.64 19.63 19.27 19.41 19.81 17.59 18.02 18.72 19.48 19.34 18.39 20.24 18.85 19.27 18.76 19.58 18.97 M9MMM8 Brsk2 1 197.0656531 + 197.0656531 197.086604 serine/threonine-protein kinase brsk2 None QKVAIKIVNREKLSESVLMK None None None 19.11 16.81 17.56 18.3 18.05 17.91 18.35 18.6 18.3 18.96 17.38 18.57 18.93 18.32 17.97 18.99 18.5 18.71 19.29 17.04 17.4 18.18 18.67 18.74 18.01 19.66 18.07 18.61 18.09 18.72 18.58 D3ZLX3 Mob2 1 197.0935341 499288 - 197.0935341 197.110911 mob kinase activator 2 None NGKKPAAEEKKVYLEPEHTK None 611969 None 18.25 19.82 19.36 16.59 17.54 18.82 18.77 17.96 18.29 18.94 18.83 16.67 17.28 18.32 18.5 17.31 18.27 17.48 18.11 18.37 19.06 18.99 17.54 17.78 17.68 16.75 18.31 18.93 16.57 17.27 17.59 M0R805 Shank2 1 199.5611621 103690160 + 199.5611621 199.586047 sh3 and multiple ankyrin repeat domains protein 2-like None FSLDSEDVYSRSPAPQAAFR None None None 18.59 17.95 18.07 18.05 17.99 18.28 18.48 18.14 18.98 17.8 18.07 19.52 19.14 19.18 18.1 18.47 18.14 18.78 19.55 17.81 19.37 18.13 18.48 18.99 18.31 18.58 18.79 19.22 16.83 17.87 18.93 D3ZRB1 Ppfia1 1 199.6424941 103689951 - 199.6424941 199.654352 liprin-alpha-1-like None QARAVLEREFNNLLVTGTDR None None None 17.05 15.12 18.17 16.76 15.33 17.08 15.52 16.77 16.56 15.19 16.7 16.77 17.31 17.5 16.36 16.83 16.26 16.54 17.93 16.27 16.25 17.81 17.02 17.3 17.69 17.54 17.48 17.46 16.37 17.42 17.66 P24268 Ctsd 1 197.527441 171293 - 197.527441 197.539348 cathepsin d None TSIRRTMTEVGGSVEDLILK None 116840 55616 20.83 22.99 19.69 21.56 21.72 20.55 20.64 21.87 20.3 21.85 20.64 21.9 20.75 20.25 20.38 21.66 20.82 20.4 21.49 22.36 20.19 20.7 20.36 21.33 20.68 21.9 22.48 20.35 20.69 20.66 20.76 Q6P6T6 Ctsd 1 197.527441 171293 - 197.527441 197.539348 cathepsin d None None None None 20.83 22.99 19.69 21.56 21.72 20.55 20.64 21.87 20.3 21.85 20.64 21.9 20.75 20.25 20.38 21.66 20.82 20.4 21.49 22.36 20.19 20.7 20.36 21.33 20.68 21.9 22.48 20.35 20.69 20.66 20.76 Q4QQV6 Lsp1 1 197.6146881 361680 + 197.6146881 197.648411 lymphocyte specific 1, isoform cra_a None QLQDQDKDEEDEGGHFLEQPGQQALVSLK None 153432 1750 15.88 13.63 15.78 15.1 16.37 16.26 14.57 15.52 14.42 15.16 16.21 15.08 14.56 13.39 15.69 15.71 16.19 13.85 14.85 14.47 14.97 15.39 15.69 13.64 14.36 15.06 15.8 15.93 15.99 15.6 16.4 Q63750 Mrpl23 1 197.6874531 64360 + 197.6874531 197.695222 39s ribosomal protein l23 None RVDLRNYLEQIYNVPVAAVR None 600789 7922 16.15 15.25 15.75 15.75 15.83 15.72 15.02 15.68 14.15 14.92 14.51 16.41 15.15 15.59 15.04 16.57 15.49 15.63 14.96 16.03 13.93 16.0 16.25 16.42 16.59 15.83 16.56 14.87 15.27 16.17 16.08 P04177 Th 1 198.0715041 25085 - 198.0715041 198.078759 tyrosine 3-monooxygenase None AVVFEERDGNAVLNLLFSLR None 191290 307 19.54 18.78 19.02 18.71 18.62 19.16 17.65 18.52 19.06 19.36 18.33 17.84 18.22 19.23 17.82 18.17 19.13 18.24 17.67 20.03 17.61 20.08 18.84 18.69 18.58 17.81 18.18 18.78 19.52 18.96 18.08 Q62745 Cd81 1 198.2358961 25621 + 198.2358961 198.251511 cd81 antigen None QFYDQALQQAVMDDDANNAK None 186845 20915 19.89 17.3 18.67 18.62 19.01 21.54 19.23 18.65 18.21 19.04 19.58 18.93 19.17 18.8 18.86 18.96 18.64 19.2 18.52 20.14 18.93 18.55 19.7 19.05 19.1 18.21 20.2 17.45 19.01 19.78 18.63 Q6P9V1 Cd81 1 198.2358961 25621 + 198.2358961 198.251511 tetraspanin None QFYDQALQQAVMDDDANNAK None 186845 20915 19.71 17.26 18.51 18.63 19.05 21.64 19.26 18.64 18.3 19.19 19.41 19.26 19.22 18.82 18.87 18.96 18.55 19.26 18.45 20.09 18.92 18.53 19.81 19.02 18.82 18.07 20.02 17.31 19.16 19.78 18.59 Q5U2Z3 Nap1l4 1 198.7097091 361684 - 198.7097091 198.745166 nucleosome assembly protein 1-like 4 None EFITGDVEPTDAESAWHSENEEDDK None 601651 133933 19.56 17.73 20.45 19.45 19.22 19.3 19.75 18.49 19.11 17.98 19.41 19.69 19.66 19.46 18.24 18.67 19.02 19.22 19.27 20.68 20.98 19.64 19.83 18.55 19.64 18.83 19.9 19.28 18.4 19.8 19.78 G3V9K0 Cars 1 198.7536891 293638 - 198.7536891 198.795976 cysteinyl-trna synthetase None RKIAREKKVLEVLQLSDALR None 123859 1328 19.27 18.11 18.53 18.75 17.43 18.52 17.55 19.65 19.58 19.27 20.85 18.6 19.48 19.86 18.48 17.93 19.3 19.82 17.67 20.18 19.22 20.12 19.66 19.62 18.69 18.36 19.27 19.91 18.62 18.77 18.95 Q7TN40 Mrgpre 1 198.9661041 404660 - 198.9661041 198.967032 mas-related g-protein coupled receptor member e None PLRLVLQRALGDEAELGAVR None None None 15.74 17.2 16.03 16.05 14.8 15.28 15.97 16.21 15.14 16.74 16.16 14.73 15.9 15.78 16.22 15.91 16.01 15.5 14.99 15.63 14.63 16.09 15.21 16.42 15.64 16.2 15.47 16.24 14.94 15.2 15.02 Q812E8 Nadsyn1 1 198.9815641 353255 - 198.9815641 199.009866 glutamine-dependent nad(+) synthetase None FSAHGGSSRENLALQNVQAR None 608285 6098 16.94 14.03 16.85 16.11 16.52 15.94 16.52 15.07 14.47 14.01 15.18 15.98 14.67 14.98 16.57 15.75 14.39 14.91 16.6 14.68 15.79 13.74 16.42 14.39 15.47 16.59 15.66 14.43 16.56 15.61 15.2 Q9Z2Z8 Dhcr7 1 199.0150821 64191 + 199.0150821 199.031069 7-dehydrocholesterol reductase None FLPGYVGGVQEGAITPAGIVNK None 602858 1042 15.4 16.93 16.74 16.66 16.19 16.79 16.21 17.3 16.45 17.34 17.69 15.15 17.32 16.8 17.05 17.04 17.23 16.67 16.81 15.36 15.35 16.64 16.98 17.2 16.57 16.24 16.64 17.15 16.32 15.94 15.46 A0A0U1RS17 Shank2 1 199.1473941 171093 + 199.1473941 199.589775 sh3 and multiple ankyrin repeat domains protein 2 None SVYERQGIAVMTPTVPGSPK None 603290 105965 17.98 17.77 17.45 17.64 17.74 17.86 18.14 17.76 18.87 17.43 17.52 19.2 18.75 18.87 17.97 18.08 17.72 18.48 19.24 17.38 18.98 17.76 18.13 18.71 17.91 18.3 18.32 18.79 16.63 17.48 18.78 M0R5T5 Shank2 1 199.1473941 171093 + 199.1473941 199.589775 sh3 and multiple ankyrin repeat domains protein 2 None EELVDKDKPEEIVPASKPSR None 603290 105965 18.45 18.03 17.99 18.1 18.14 18.19 18.54 18.23 19.15 17.72 17.99 19.65 19.18 19.18 18.27 18.51 18.34 18.65 19.6 17.73 19.38 18.11 18.45 19.01 18.38 18.66 18.79 19.27 16.89 18.02 19.19 Q9QX74 Shank2 1 199.1473941 171093 + 199.1473941 199.589775 sh3 and multiple ankyrin repeat domains protein 2 None SNALYQDTLPEEDTDGFVIPPPAPPPPPGSAQAGVAK None 603290 105965 18.52 17.97 18.05 18.1 18.12 18.21 18.54 18.21 19.05 17.74 18.09 19.62 19.18 19.2 18.17 18.49 18.21 18.75 19.62 17.82 19.37 18.13 18.45 19.01 18.36 18.64 18.81 19.25 16.86 18.02 19.14 D3ZGE6 Cttn 1 199.5997111 60465 - 199.5997111 199.635168 cortactin, isoform cra_c None ASAGHAVSITQDDGGADDWETDPDFVNDVSEK None 164765 3834 21.43 22.06 21.22 20.24 20.82 21.32 20.26 20.45 21.5 20.54 19.57 21.57 20.52 21.48 21.38 21.18 20.79 20.92 21.43 20.61 21.6 20.46 20.36 21.11 20.37 21.38 21.62 20.79 21.25 20.0 21.45 Q66HL2 Cttn 1 199.5997111 60465 - 199.5997111 199.635168 src substrate cortactin None EHINIHKLRENVFQEHQTLK None 164765 3834 21.39 22.13 21.19 20.27 20.8 21.29 20.24 20.48 21.51 20.56 19.58 21.56 20.5 21.48 21.44 21.18 20.88 20.95 21.36 20.49 21.59 20.46 20.35 21.08 20.37 21.38 21.51 20.94 21.26 19.98 21.43 A0A1B0GWS0 Ppfia1 1 199.6412431 293645 - 199.6412431 199.718402 ptprf-interacting protein alpha 1 None RQREKMNEEHNKRLSDTVDK None 611054 20802 18.44 16.86 20.32 18.3 17.91 18.1 18.5 17.77 19.01 17.87 17.68 18.27 19.54 19.68 19.57 18.56 18.78 17.97 19.56 17.49 20.04 19.03 18.75 18.2 19.22 19.22 19.62 19.6 17.89 19.31 19.44 Q8R2E7 Fadd 1 199.7399541 266610 - 199.7399541 199.745653 fas-associated death domain protein None EALMAQGSVSKSDDTSSALR None 602457 2836 15.24 13.86 16.5 15.81 15.62 16.45 16.77 14.59 15.65 15.39 15.68 15.46 15.81 15.2 14.79 13.94 14.3 15.61 16.39 15.33 16.82 15.6 15.83 14.15 14.44 14.19 15.22 15.14 15.27 14.69 16.54 Q9EQN5 Ighmbp2 1 200.5063181 29532 - 200.5063181 200.529513 dna-binding protein smubp-2 None SLSSHDRLRVHQLAEEFGLK None 600502 1642 16.56 15.75 16.28 15.88 15.47 16.96 16.26 15.88 17.73 15.82 17.1 15.32 16.4 16.51 17.18 16.82 17.29 16.47 16.58 15.11 17.86 17.48 15.32 16.72 16.29 17.43 16.33 15.74 17.95 17.16 17.18 D3ZMR9 Mrpl21 1 200.5294171 309140 + 200.5294171 200.537896 mitochondrial ribosomal protein l21 None TSLSSPPWQEVVLPDPAEETR None 611834 32936 16.4 15.55 16.67 16.51 18.1 17.94 15.4 16.86 16.27 15.77 16.69 17.96 16.69 16.65 16.83 18.31 16.87 16.75 17.23 16.62 16.05 16.23 18.11 17.48 18.78 17.53 17.95 17.66 17.36 17.88 17.67 P32198 Cpt1a 1 200.5668891 25757 + 200.5668891 200.627058 carnitine o-palmitoyltransferase 1, liver isoform None CRQTYFARGKNKQSLDAVEK None 600528 1413 19.28 18.25 18.28 18.3 18.41 17.16 17.74 18.02 17.5 18.07 19.59 18.36 17.06 17.78 19.19 18.48 18.08 18.15 18.23 16.67 18.21 18.09 17.11 18.84 17.91 17.8 18.5 18.42 17.06 18.37 18.38 F1MAH5 Ppp6r3 1 200.6931261 309144 - 200.6931261 200.807546 protein phosphatase 6, regulatory subunit 3 None EEDGAKQDLFESSSANTEDK None None None 18.74 16.32 19.58 17.82 17.7 18.44 17.6 17.42 18.36 17.21 18.25 17.85 18.56 18.57 17.06 17.54 17.65 18.58 19.78 18.3 20.13 18.97 18.57 18.15 19.57 18.18 18.19 18.06 19.53 19.07 18.99 B0BNE6 Ndufs8 1 201.1405891 293652 - 201.1405891 201.144462 complex i-23kd None TETHEELLYNKEKLLNNGDK None 602141 1867 20.36 22.48 19.92 19.82 21.12 21.13 20.52 19.31 20.0 21.78 18.9 21.07 19.61 20.31 20.26 21.52 20.72 20.27 20.96 20.82 20.4 20.73 19.82 20.81 20.91 21.18 21.0 20.71 19.75 20.29 20.95 Q5XI42 Aldh3b1 1 201.1419331 309147 - 201.1419331 201.181272 aldehyde dehydrogenase family 3 member b1 None QGLLGCGRVAIGGQSDEGER None 600466 73890 17.11 17.78 17.43 17.12 16.17 15.7 16.12 17.51 15.07 15.75 17.29 15.57 15.34 16.24 16.03 16.56 14.93 17.37 16.33 17.44 16.58 14.9 15.32 17.13 17.58 16.45 16.75 15.33 16.0 16.81 15.88 Q5XIH3 Ndufv1 1 201.3003571 293655 - 201.3003571 201.305526 nadh dehydrogenase [ubiquinone] flavoprotein 1 None HAGGVLGGWDNLLAVIPGGSSTPLIPK None 161015 5151 19.86 22.25 20.6 20.73 21.29 21.69 21.13 20.99 21.78 22.26 20.84 22.16 21.97 21.79 21.46 21.64 21.58 21.1 21.69 21.73 22.56 21.6 22.03 22.08 20.26 21.49 21.75 21.4 20.95 20.87 20.91 P04906 Gstp1 1 201.3377631 24426 - 201.3377631 201.34023 glutathione s-transferase p None LYQSNAILRHLGRSLGLYGK None 134660 660 21.84 19.86 20.88 20.74 21.02 20.41 21.59 21.76 19.67 20.37 22.06 19.37 20.31 20.24 19.1 21.01 20.4 21.22 20.65 21.67 19.28 20.49 20.85 19.16 21.56 20.35 20.64 20.21 21.16 21.61 20.29 Q5U2N3 Pitpnm1 1 201.394151 361694 + 201.394151 201.407522 membrane-associated phosphatidylinositol transfer protein 1 None WNSNDFIDAFASPTEVEGVPDPAIMATK None None 3608 19.96 19.62 18.91 19.66 18.64 19.55 19.15 19.6 19.64 20.02 18.7 20.09 19.66 19.23 19.59 19.05 20.72 18.58 18.94 18.97 18.96 19.48 18.69 19.55 18.5 18.58 19.98 19.59 18.47 19.42 19.85 Q5FWY5 Aip 1 201.4072891 282827 - 201.4072891 201.419253 ah receptor-interacting protein None LVAKSLRNIAEGKDPLEGQR None 605555 2959 19.17 18.94 19.69 18.76 18.71 18.99 19.21 18.71 18.61 17.74 19.48 18.47 18.86 19.28 19.02 18.2 19.03 18.14 19.04 20.03 19.86 18.99 18.81 18.08 20.09 18.9 18.97 18.83 19.08 19.97 19.17 G3V940 Coro1b 1 201.4430131 29474 + 201.4430131 201.448423 coronin None GNLAGSGEAGKLEEVMQELR None 609849 40790 20.5 22.2 19.32 19.42 19.81 21.48 21.54 19.78 20.2 20.42 19.34 20.14 19.93 21.15 20.17 20.11 19.87 20.86 20.23 21.47 21.89 20.57 19.99 20.38 20.85 21.72 20.0 20.9 19.44 19.83 20.03 O89046 Coro1b 1 201.4430131 29474 + 201.4430131 201.448423 coronin-1b None ARFYKLHERKCEPIVMTVPR None 609849 40790 19.2 21.44 19.31 19.06 19.42 21.38 20.62 19.42 20.55 20.77 19.41 20.72 20.06 20.78 20.05 19.81 20.14 20.25 19.6 21.21 21.64 20.37 20.28 20.67 18.92 20.01 19.77 20.62 19.05 19.23 19.51 D3Z945 Carns1 1 201.460081 309150 - 201.460081 201.467432 carnosine synthase 1 None GKEGQETLVKEEVEAFVHSK None None None 16.05 16.3 15.0 14.45 15.31 14.45 15.17 15.77 15.92 16.66 15.23 14.52 14.33 15.21 15.95 16.24 14.66 15.15 15.61 15.94 15.08 15.2 14.81 14.43 15.96 16.01 15.5 15.75 15.86 15.46 15.05 P62138 Ppp1ca 1 201.4851181 24668 + 201.4851181 201.488734 serine/threonine-protein phosphatase pp1-alpha catalytic subunit None FGAEVVAKFLHKHDLDLICR None 176875 105262 18.99 18.98 19.38 19.77 19.38 20.21 20.56 19.43 20.56 20.78 19.63 20.68 20.85 20.79 18.85 19.7 19.24 19.8 21.19 20.59 21.04 20.63 21.01 19.45 18.56 19.78 19.17 20.54 19.88 19.84 19.78 D3ZUJ7 Ankrd13d 1 201.5653361 361699 - 201.5653361 201.577869 ankyrin repeat domain 13 family, member d None EEHVASRLTSPIVSTHLDTR None None 27612 18.31 16.31 16.35 17.49 16.79 16.15 17.2 17.04 15.89 16.15 18.13 16.24 17.08 17.16 14.91 16.59 16.9 17.1 17.17 17.39 16.8 16.23 16.25 15.33 16.93 17.67 16.44 17.53 17.64 17.02 16.19 F1LMA4 Grk2 1 201.5814811 25238 - 201.5814811 201.589589 g protein-coupled receptor kinase None FDEEDTKGIKLLDSDQELYR None 109635 1223 19.0 18.55 19.07 18.71 18.13 17.96 19.12 19.56 18.73 18.64 18.31 19.46 19.49 19.94 19.33 18.61 18.36 20.73 18.49 18.61 19.81 18.47 18.49 18.71 18.91 20.59 19.71 20.13 17.52 19.09 20.14 P26817 Grk2 1 201.5814811 25238 - 201.5814811 201.589589 beta-adrenergic receptor kinase 1 None EIFDSYIMKELLACSHPFSK None 109635 1223 19.03 18.66 19.03 18.71 18.13 17.93 19.02 19.56 18.85 18.68 18.22 19.38 19.44 19.94 19.82 18.61 18.1 20.29 18.71 18.5 19.81 18.47 18.53 18.82 18.9 20.59 19.79 20.05 17.47 19.12 20.06 D3ZTJ7 Kdm2a 1 201.6124541 361700 - 201.6124541 201.680787 f-box and leucine-rich repeat protein 11 None MVREKENNPSGKKELSEVEK None 605657 None 15.58 17.48 16.82 15.72 16.54 17.07 17.11 15.61 16.74 15.04 16.67 16.97 15.67 16.43 15.63 15.65 16.69 16.81 17.22 15.95 17.84 16.38 16.35 14.71 16.21 17.21 16.15 16.87 17.16 16.23 17.04 P97610 Syt12 1 201.7287991 191595 - 201.7287991 201.759522 synaptotagmin-12 None VKAKNLIWTNDKTTADPFVK None 606436 15895 19.07 18.97 18.99 18.59 19.56 19.04 18.84 18.93 20.35 18.96 18.52 20.03 19.37 19.98 20.32 18.67 18.2 18.95 20.26 18.9 20.56 19.35 18.93 18.69 19.3 19.08 19.91 20.65 18.99 19.92 20.88 P52873 Pc 1 201.7994491 25104 + 201.7994491 201.89838 pyruvate carboxylase None ELGIRTVAVYSEQDTGQMHR None 608786 5422 21.27 21.35 20.23 21.64 21.98 18.98 21.16 20.24 20.07 20.84 20.73 20.37 20.27 20.23 21.21 20.34 20.87 20.17 20.41 20.22 20.08 19.53 19.6 19.27 21.78 20.04 20.34 20.88 20.99 20.54 21.32 F1MA36 Sptbn2 1 202.0029711 29211 + 202.0029711 202.043605 spectrin beta chain None AQLQGSSAARRQLLLDTTDK None 604985 48482 22.26 21.91 22.03 21.88 22.22 21.99 22.4 21.86 22.75 21.41 21.73 23.32 22.61 23.15 23.47 22.52 21.64 21.71 22.96 21.56 22.94 21.67 22.65 22.33 22.23 22.57 22.19 23.12 21.37 22.07 22.82 Q9QWN8 Sptbn2 1 202.0029711 29211 + 202.0029711 202.043605 spectrin beta chain, non-erythrocytic 2 None RHMQAVAEAWAQLQGSSAAR None 604985 48482 22.21 21.97 22.03 21.88 22.21 21.97 22.42 21.87 22.75 21.42 21.72 23.31 22.62 23.14 23.47 22.53 21.64 21.7 22.96 21.57 22.94 21.67 22.65 22.32 22.24 22.59 22.17 23.14 21.36 22.02 22.8 Q64LC9 Rbm4b 1 202.0479351 474154 + 202.0479351 202.058023 rna-binding protein 4b None YGPVIECDIVKDYAFVHMER None None 57033 16.04 17.47 18.26 17.52 17.6 17.4 16.88 17.7 17.84 17.14 16.54 17.3 17.66 16.95 19.15 16.99 17.12 17.07 17.54 16.78 18.77 17.24 17.46 18.38 17.77 16.96 18.18 16.2 17.53 17.37 18.22 D4A1W5 Rbm4 1 202.0782721 293663 - 202.0782721 202.087506 rcg48334, isoform cra_b None VKDYAFVHMERAEDAVEAIR None None None 16.45 18.27 18.26 17.54 17.58 16.96 16.48 17.79 18.03 16.96 16.32 17.32 17.18 16.9 19.09 17.03 17.19 17.1 17.58 16.7 18.71 17.24 16.94 18.39 17.81 17.32 18.35 16.52 17.31 17.03 18.3 M0R9Q1 Rbm14 1 202.0874141 170900 - 202.0874141 202.105665 rcg48334, isoform cra_e None ASLGVGYRTQPMTAQAASYR None 612409 4614 17.88 19.64 17.72 18.4 18.54 17.72 17.99 18.61 19.1 18.62 16.92 18.77 17.63 18.42 18.44 17.47 17.62 18.47 19.23 18.03 19.16 18.1 17.43 18.95 17.43 18.75 19.05 18.39 17.63 17.96 19.26 Q9JK72 Ccs 1 202.1137891 84485 - 202.1137891 202.134947 copper chaperone for superoxide dismutase None VWDVIGRSLVVDEGEDDLGR None 603864 3762 17.27 15.8 18.34 17.23 17.6 16.54 18.47 15.94 17.51 18.15 17.49 16.83 17.51 17.1 16.17 17.75 17.88 17.11 16.71 18.37 18.84 17.12 17.65 17.12 17.18 16.62 17.83 17.39 15.86 17.5 18.12 Q499S6 Ctsf 1 202.1527781 361704 + 202.1527781 202.158525 cathepsin f None DKMDKACMGGLPSNAYTAIK None 603539 31194 18.05 16.35 17.29 18.59 18.45 16.2 18.04 18.53 17.54 17.5 17.99 19.65 18.11 16.74 17.91 18.08 18.46 16.77 18.43 17.82 17.54 17.17 17.45 16.08 17.14 17.72 17.57 18.28 18.62 18.1 18.94 Q8R4I6 Actn3 1 202.1590831 171009 - 202.1590831 202.175022 actinin alpha 3 None QDISVEETSAKEGLLLWCQR None 102574 862 20.25 18.06 19.62 19.58 19.49 19.79 18.67 19.21 19.86 19.53 20.93 19.66 20.45 20.43 19.76 19.94 18.86 20.41 19.77 19.41 19.68 20.64 20.35 20.4 19.22 19.32 19.57 20.67 19.44 19.73 19.62 D4A4U2 Bbs1 1 202.1858861 309156 - 202.1858861 202.204237 bardet-biedl syndrome 1 None YGREDNTLIMTTRGGGLIIK None 209901 11641 15.15 16.42 17.03 16.53 13.77 14.25 16.16 16.29 15.87 15.59 15.47 14.56 15.15 14.96 16.45 15.44 15.45 15.56 15.0 15.1 15.94 15.24 14.18 15.17 14.87 15.27 16.13 14.72 14.77 15.45 16.21 O55096 Dpp3 1 202.2046871 114591 - 202.2046871 202.227366 dipeptidyl peptidase 3 None MVRAGLLALEFYTPETANWR None 606818 40210 20.17 21.77 19.18 18.45 20.13 20.31 20.97 19.85 19.61 19.78 22.03 19.18 19.19 19.43 18.51 20.56 19.41 20.6 19.59 21.25 20.08 19.32 19.14 18.32 19.76 19.87 20.18 19.73 19.99 19.05 20.05 A0A0G2JYU2 Mrpl11 1 202.2644211 293666 + 202.2644211 202.267294 mitochondrial ribosomal protein l11 None AVFLAAQKEADLAAQAEAAK None 611826 6768 17.65 16.68 16.35 17.86 17.86 17.25 15.86 17.97 16.51 15.92 17.05 17.51 17.8 16.75 17.75 18.18 16.72 16.9 18.05 16.22 15.4 16.92 16.82 18.16 18.92 18.23 17.06 18.13 17.68 16.83 18.64 Q5XIE3 Mrpl11 1 202.2644211 293666 + 202.2644211 202.267294 39s ribosomal protein l11 None GIEKGARQTGKEVAGLVSLK None 611826 6768 17.32 17.53 15.96 17.67 17.69 16.97 15.6 17.83 16.37 15.89 16.8 17.3 17.32 16.5 17.56 17.99 16.52 16.7 17.85 16.02 15.19 16.77 16.43 17.73 18.65 18.04 16.96 18.05 17.54 16.49 17.9 O54699 Slc29a2 1 202.3279491 108348052 + 202.3279491 202.334589 equilibrative nucleoside transporter 2 None FARYYLTKKPQAPVQELETK None None None 16.83 16.12 17.0 17.53 17.13 16.73 18.07 15.87 17.25 18.2 16.95 18.16 17.0 17.62 18.72 17.41 17.65 16.23 17.79 16.59 18.7 18.11 17.81 17.11 16.66 18.51 17.27 17.98 16.74 18.74 17.76 G3V8P7 Rin1 1 202.3556671 108348044 + 202.3556671 202.362709 ras and rab interactor 1 None QTERLPPRQLLQRESSVGYR None None None 17.67 17.61 17.19 17.09 16.66 18.41 17.04 16.81 17.57 17.4 17.51 17.68 17.16 17.95 17.12 17.99 18.15 17.58 17.88 15.96 17.51 17.73 17.92 17.8 16.78 17.72 17.49 17.78 16.95 16.44 16.76 M0RAG0 Tmem151a 1 202.3061371 108348045 - 202.3061371 202.392094 transmembrane protein 151a None TQRARFFSANEGLDDYLEAR None None None 17.14 13.83 15.1 15.46 15.22 16.36 15.56 16.14 15.33 15.22 15.82 14.87 15.3 14.94 15.36 15.83 17.12 15.47 15.08 14.57 15.12 15.34 15.83 15.83 17.25 15.48 14.34 14.99 16.97 16.28 14.75 D3ZHA1 B4gat1 1 202.3432691 108348085 + 202.3432691 202.34549 beta-1,4-glucuronyltransferase 1 None PAYVVPWRDPWEPFYVAGGK None None None 16.29 14.59 15.97 15.62 15.68 16.18 15.99 14.81 14.91 15.93 16.07 14.87 15.95 16.0 17.03 14.87 15.9 14.88 15.16 15.24 15.54 16.81 15.85 16.15 15.82 16.63 14.97 16.58 14.84 16.32 15.88 Q5BJU5 Cnih2 1 202.3994251 361705 - 202.3994251 202.405063 protein cornichon homolog 2 None AFDELRTDFKNPIDQGNPAR None None 7671 16.88 15.01 16.34 15.76 15.93 17.02 16.04 15.38 15.99 17.66 15.66 16.76 16.65 16.83 17.28 17.0 16.62 16.31 16.85 15.22 16.39 16.42 17.44 16.94 16.6 17.04 15.6 17.31 16.6 16.57 16.23 G3V6H0 Rab1b 1 202.4057661 100126191 - 202.4057661 202.41385 rcg48149, isoform cra_b None SAKNATNVEQAFMTMAAEIK None 612565 128838 22.4 24.32 21.79 21.72 21.63 22.07 22.58 22.64 22.33 23.14 21.21 21.83 21.88 21.54 21.09 23.33 22.17 23.02 22.41 22.33 21.97 22.5 21.57 21.72 21.52 23.95 21.71 22.74 22.34 21.34 22.13 B2GV74 Klc2 1 202.4145581 309159 - 202.4145581 202.424657 kinesin light chain None ALLAPLASHEAGEAEPGSQER None 611729 22468 20.57 18.47 21.18 19.55 19.64 19.71 19.03 19.47 20.43 19.22 19.17 19.12 19.82 19.36 19.19 18.22 18.81 19.69 20.76 20.11 20.1 20.29 19.85 20.39 20.25 18.66 20.57 19.9 18.46 20.11 20.31 O88588 Pacs1 1 202.4387021 171444 - 202.4387021 202.569373 phosphofurin acidic cluster sorting protein 1 None KYLGSVDSRYSSTFLDSAWR None None 9970 20.35 21.72 19.47 20.89 19.43 20.31 20.16 19.72 19.43 19.41 19.08 20.27 20.06 20.14 20.53 20.77 21.03 19.83 20.76 18.59 18.86 20.58 19.57 20.58 20.72 21.84 20.32 20.61 19.29 19.08 20.23 D3ZMS1 Sf3b2 1 202.570411 293671 - 202.570411 202.590751 splicing factor 3b, subunit 2 None RPKMGKIDIDYQKLHDAFFK None 605591 6678 21.27 19.94 21.97 21.3 21.71 21.04 20.41 21.01 21.81 20.32 21.84 21.94 21.78 22.02 22.31 20.96 21.41 21.27 21.56 22.24 23.2 21.68 21.62 22.46 22.76 21.13 22.48 20.38 22.29 22.24 22.95 Q9R1T1 Banf1 1 202.6721711 114087 - 202.6721711 202.674199 barrier-to-autointegration factor None LEERGFDKAYVVLGQFLVLK None 603811 2866 14.8 16.02 16.4 16.71 16.11 17.35 16.44 16.33 16.79 16.5 17.1 17.45 16.96 15.86 17.39 15.38 15.84 15.39 17.13 16.75 18.09 16.36 16.85 15.09 14.75 15.8 17.07 17.33 16.7 16.33 16.52 Q5RKI6 Eif1ad 1 202.6743631 293673 + 202.6743631 202.679659 probable rna-binding protein eif1ad None NIWIKRGDFLIVDPIEEGEK None None 41860 17.2 14.64 15.03 14.44 15.25 15.0 14.85 14.2 15.22 13.91 15.05 14.45 14.92 15.66 14.13 15.29 15.36 15.62 16.01 14.57 16.89 14.43 15.11 15.34 17.17 15.57 14.75 16.18 15.08 15.06 14.81 Q5XIW8 Sart1 1 202.6903261 29678 - 202.6903261 202.699159 u4/u6.u5 tri-snrnp-associated protein 1 None GRGRRRVPEVEEEALEDEEK None 605941 133770 17.21 16.86 17.89 17.6 17.63 16.77 16.46 17.71 18.25 16.42 17.22 17.73 17.63 17.9 17.27 17.01 16.9 17.86 18.2 18.11 19.39 17.0 17.51 17.79 18.78 17.74 18.27 17.06 18.95 18.13 19.24 A0JPP1 Drap1 1 202.7317891 293674 - 202.7317891 202.734425 dr1-associated corepressor None DLVASVPDMQGDGEDNHTDGDK None None 4703 15.34 16.18 16.88 16.3 15.48 15.5 16.13 15.97 17.08 15.83 15.26 16.3 15.98 16.12 15.69 15.49 14.9 17.33 16.56 16.28 17.41 15.85 16.25 15.68 15.81 16.08 16.33 16.13 16.29 15.75 17.89 Q566Q8 Bles03 1 202.7344661 266609 + 202.7344661 202.736796 upf0696 protein c11orf68 homolog None WLVFDARTTPATELDAWLAK None None 12869 18.04 18.99 17.74 16.98 18.76 17.56 17.94 18.4 17.79 17.84 17.06 19.0 17.78 17.56 17.54 18.56 16.6 18.5 18.71 18.69 18.93 16.54 16.86 17.2 18.07 17.84 18.1 18.4 18.72 17.64 19.35 Q6P775 Fibp 1 202.7681121 282837 + 202.7681121 202.772398 fgf1 intracellular-binding protein None SGILEQTGATTGVLQSDTMDHYR None 608296 3106 17.88 17.59 18.79 17.21 17.15 17.93 18.56 18.08 18.28 18.42 18.48 16.91 17.84 17.85 18.94 17.0 18.48 17.52 17.79 16.42 19.06 18.25 16.98 17.81 16.34 17.05 18.07 18.32 16.81 17.41 19.7 P45592 Cfl1 1 202.79781 29271 + 202.79781 202.801331 cofilin-1 None VIKVFNDMKVRKSSTPEEVK None 600607 99735 24.14 25.94 24.35 23.86 24.34 24.11 25.67 24.44 23.87 24.81 22.73 24.22 23.75 23.91 23.88 25.19 24.77 24.36 24.41 23.53 24.18 23.64 23.72 23.05 24.35 25.09 24.27 24.68 23.31 23.66 23.75 F1LU14 Snx32 1 202.8027121 361708 - 202.8027121 202.806054 sorting nexin None TVQTKSGLPHFAQPEFSVVR None None 62637 17.16 16.08 18.76 16.56 16.27 17.8 18.12 16.6 17.0 18.46 17.08 16.48 17.06 17.67 17.68 16.09 17.21 16.89 18.1 15.78 18.72 18.04 17.97 16.67 15.8 17.04 17.18 17.59 16.5 18.36 17.49 Q7TQN4 Rela 1 202.9250021 309165 + 202.9250021 202.93548 nuclear factor kappab subunit p65 None QNLGIQCVKKRDLEQAISQR None 164014 32064 16.49 14.46 16.17 17.04 16.03 15.84 17.13 15.85 15.89 15.38 17.42 15.88 15.99 15.44 15.49 15.12 14.93 16.72 16.38 15.94 16.58 15.93 16.65 15.11 16.05 15.17 16.17 15.85 15.54 16.52 16.43 A0A0G2K6R8 Ehbp1l1 1 202.9943851 309169 - 202.9943851 203.014008 eh domain-binding protein 1-like 1 None AQQHREQLLLEELVSLVNQR None None 9072 14.48 17.13 15.58 16.2 16.17 14.97 15.8 15.52 15.72 15.31 13.76 14.77 14.78 14.57 13.51 14.74 15.79 16.17 15.33 14.81 14.84 14.59 14.91 15.44 15.61 15.9 15.69 14.38 14.45 14.63 14.98 D3ZG88 Znrd2 1 203.0176831 689397 - 203.0176831 203.019465 mammary tumor virus receptor 2, isoform cra_a None GYRMLGDTCADCGTILLQDK None None 4663 18.15 15.72 17.39 16.81 17.67 17.82 16.49 17.51 18.34 18.22 17.29 18.36 18.08 17.65 16.96 18.02 17.99 17.73 17.53 18.15 18.73 17.8 18.21 17.8 16.22 16.99 17.04 17.95 18.69 18.07 17.99 Q5M9F8 Scyl1 1 203.045741 293684 - 203.045741 203.059533 n-terminal kinase-like protein None VGKFLSAEEYQQKIIPVVVK None 607982 6947 18.17 15.93 17.18 17.57 17.4 18.1 18.41 16.95 17.79 17.16 18.51 18.4 18.28 18.35 18.2 16.41 18.18 17.27 17.9 16.55 18.15 17.98 18.11 17.2 17.01 17.48 18.25 17.73 17.15 18.52 17.88 Q5U2R3 Frmd8 1 203.1432171 309172 - 203.1432171 203.16387 ferm domain-containing protein 8 None VCRVQLGPYQPGQPAACTVR None None 32653 14.59 14.31 15.87 15.9 16.09 14.72 15.9 16.75 16.77 14.85 16.31 14.96 16.06 15.5 14.72 15.09 16.08 16.0 16.11 14.72 15.78 14.68 15.98 17.1 16.07 14.87 15.62 14.78 15.04 16.17 16.35 A0A0G2K948 Dpf2 1 203.1836581 361711 - 203.1836581 203.198996 double phd fingers 2 None KINKKTGQPEELVSCSDCGR None 601671 21265 16.24 14.04 16.24 16.71 15.75 14.79 14.81 15.82 16.78 15.43 17.27 15.1 16.43 16.53 16.24 15.16 16.4 16.6 16.27 15.15 17.15 16.26 16.7 16.53 16.92 15.74 17.4 15.37 15.81 16.49 16.64 Q5PQP4 Cdc42ep2 1 203.2020051 309175 - 203.2020051 203.210831 cdc42 effector protein 2 None SPQPSPKSSPQEAGNVDIWR None 606132 4933 16.99 14.08 15.5 15.02 16.27 16.71 15.06 16.12 14.63 14.18 15.72 14.87 14.9 15.28 15.51 15.99 15.86 14.09 15.45 15.92 13.9 14.69 15.65 15.93 16.75 15.35 16.48 15.58 13.68 16.2 14.75 P97571 Capn1 1 203.2758981 29153 - 203.2758981 203.300198 calpain-1 catalytic subunit None DNFKTLFSKLAGDDMEISVK None 114220 3800 18.55 15.94 17.04 17.15 18.24 17.25 18.82 18.36 16.9 16.87 19.38 17.07 17.54 17.34 16.71 17.39 17.19 18.0 17.14 18.78 17.21 16.59 17.12 17.58 17.98 17.04 16.97 17.33 16.65 18.07 18.19 F7FG68 Syvn1 1 203.3391841 361712 + 203.3391841 203.347798 ring-type e3 ubiquitin transferase None PAGFAGLTPEELRALEGHER None 608046 32700 16.69 14.73 16.59 16.88 16.29 16.84 16.95 16.74 17.33 18.19 17.26 17.1 17.57 16.11 17.56 17.77 17.44 17.07 17.31 15.77 16.91 17.01 17.2 16.57 14.97 16.82 16.31 16.93 17.98 17.41 17.33 Q7TP77 Mrpl49 1 203.3472491 309176 - 203.3472491 203.350029 39s ribosomal protein l49 None GNRQMTLIRKVEGDIWALQK None 606866 37982 16.27 15.01 16.86 17.02 16.74 17.59 15.4 15.53 16.31 15.85 15.95 16.36 16.21 17.34 16.04 16.2 16.04 16.74 16.66 16.99 16.79 16.31 17.9 16.45 18.61 16.66 17.11 17.39 16.95 17.36 17.05 Q5BK21 Tm7sf2 1 203.3559021 293688 - 203.3559021 203.361627 transmembrane 7 superfamily member 2 None KNPSDPSVAGLETIPTATGR None 603414 68305 16.63 14.46 16.39 16.62 15.84 16.02 16.94 15.55 15.59 15.77 16.93 15.17 16.55 16.29 15.93 16.95 16.45 15.67 16.89 15.61 16.08 16.57 16.64 15.09 17.12 15.17 15.99 16.09 15.84 16.47 16.19 F1M4I4 Vps51 1 203.3605631 - 203.3605631 203.370383 vacuolar protein sorting-associated protein 51 homolog None TDTIRKMKNDFRKMEDEMDR None None None 19.2 16.25 17.8 18.67 18.2 18.49 18.47 16.73 17.55 18.34 18.29 16.69 17.48 17.33 19.31 17.73 17.8 17.33 18.0 16.49 17.22 19.04 17.64 18.35 19.1 17.8 17.34 17.46 17.79 18.47 17.84 M0RCA3 Zfpl1 1 203.3738181 684755 - 203.3738181 203.378486 zinc finger protein-like 1 None YDTRDDDRTAGVHGDCDDDK None None None 14.85 16.03 15.0 15.56 15.75 15.32 15.5 15.83 16.63 16.72 15.4 16.17 16.39 15.81 15.34 16.53 16.4 16.56 14.41 16.25 16.08 15.77 16.45 16.22 14.8 15.39 15.46 15.2 16.83 15.43 14.67 Q4V896 Snx15 1 203.4170231 293691 - 203.4170231 203.426279 sorting nexin-15 None EDLLRFTVPIPALNNSPQLK None 605964 12294 17.8 16.48 15.98 15.79 17.04 18.25 17.19 15.48 15.25 16.84 16.21 16.45 15.33 16.68 16.07 17.12 17.34 15.94 15.83 16.82 15.75 15.99 16.16 17.17 16.85 16.2 16.01 16.77 14.73 16.89 15.33 O08697 Arl2 1 203.434151 65142 - 203.434151 203.446089 adp-ribosylation factor-like protein 2 None KKFNGEDVDTISPTLGFNIK None 601175 1260 18.74 18.32 16.67 17.94 17.43 18.03 17.81 17.73 16.68 15.93 17.48 18.14 17.26 16.48 17.45 17.8 17.84 17.85 17.46 16.45 16.39 17.86 16.55 17.74 18.3 17.74 16.97 18.1 16.14 16.74 18.0 Q80W83 Ppp2r5b 1 203.5272711 309179 - 203.5272711 203.535374 serine/threonine-protein phosphatase 2a 56 kda regulatory subunit beta isoform None SSQFRYQSNQQELTPLPLLK None 601644 38157 19.34 17.38 19.88 18.39 18.42 18.62 18.73 19.02 19.49 19.99 18.26 18.77 19.21 19.58 19.12 17.55 19.32 19.27 18.35 18.54 19.69 19.13 19.25 19.39 18.64 17.87 19.11 19.81 17.65 19.83 19.42 D3ZT64 Atg2a 1 203.542561 689688 + 203.542561 203.562242 autophagy-related 2a None KVTFLNTVVRVEHSLGDEER None None 86985 16.16 16.08 17.36 16.04 16.02 18.67 17.09 17.32 16.93 17.21 17.27 17.28 16.92 17.62 17.18 15.7 17.23 17.16 17.13 15.42 17.79 16.71 17.6 16.71 15.69 15.66 16.16 16.77 17.76 16.6 16.6 Q641Z6 Ehd1 1 203.5798511 293692 + 203.5798511 203.602223 eh domain-containing protein 1 None VVRVYIGSFWSHPLLIPDNR None 605888 81678 20.46 18.85 21.25 19.35 20.09 20.54 21.03 20.6 21.02 19.44 19.97 20.61 20.92 21.09 21.2 19.84 20.27 20.37 21.14 19.11 21.4 20.29 20.5 20.25 20.52 20.1 20.57 21.16 19.12 21.19 21.35 D3Z837 Cdc42bpg 1 203.6085751 293693 + 203.6085751 203.628502 non-specific serine/threonine protein kinase None QKMEASARLELQSALEAEIR None None None 16.83 16.71 16.05 16.44 15.52 17.05 16.5 16.3 16.84 15.42 17.25 17.03 16.57 15.88 16.59 16.41 16.42 16.96 16.35 14.87 16.12 16.99 16.32 16.08 15.58 16.02 16.58 16.74 15.06 16.6 16.9 Q9WVR8 Men1 1 203.6390221 29417 + 203.6390221 203.644859 menin None EEIYKEFFEVANDVIPNLLK None 613733 7418 15.18 14.6 16.08 15.49 15.58 15.18 14.61 14.02 16.98 14.9 15.02 15.39 15.36 16.58 17.02 14.44 15.24 14.97 15.19 14.74 16.01 15.61 15.15 16.03 15.36 14.93 16.41 14.82 15.06 16.15 16.8 D3ZXB1 Map4k2 1 203.6451991 293694 + 203.6451991 203.66016 mitogen-activated protein kinase kinase kinase kinase 2 None GKELPQVCVGAEGPEGPGCR None 603166 3370 15.84 14.13 15.35 16.13 16.38 16.56 16.1 15.66 14.79 15.29 16.21 15.34 16.28 15.84 15.73 15.48 16.02 15.29 16.49 14.32 15.08 15.14 16.24 14.4 16.57 15.41 15.64 15.77 16.06 16.69 15.91 F1LSC3 Sf1 1 203.6700221 117855 + 203.6700221 203.683302 splicing factor 1 None DGQMLPGEDEPLHALVTANTMENVK None 184757 134065 17.92 17.23 18.63 18.24 18.26 17.52 17.75 17.86 18.49 17.19 17.27 18.89 18.41 18.63 17.17 17.26 17.12 18.69 18.42 18.96 19.51 17.59 18.25 17.3 18.42 18.1 18.6 17.92 19.15 18.68 19.36 G3V8V3 Pygm 1 203.6905121 24701 + 203.6905121 203.70537 alpha-1,4 glucan phosphorylase None GNPWEKARPEFTLPVHFYGR None 608455 2145 21.61 23.84 22.41 21.98 22.74 20.19 21.76 22.66 21.28 22.99 21.93 21.65 21.73 21.48 20.97 22.0 21.45 22.25 22.39 22.94 22.42 20.81 21.32 22.15 22.03 22.02 22.09 23.45 20.74 21.65 22.57 P09812 Pygm 1 203.6905121 24701 + 203.6905121 203.70537 glycogen phosphorylase, muscle form None ENVSDLKKNFNRHLHFTLVK None 608455 2145 21.34 23.68 22.13 21.79 22.56 19.97 21.6 22.46 21.13 22.79 21.85 21.58 21.63 21.35 20.8 21.84 21.28 22.18 22.27 22.75 22.42 20.68 21.22 21.95 21.9 21.96 21.93 23.35 20.6 21.5 22.42 P0C643 Rasgrp2 1 203.7074821 361714 + 203.7074821 203.722993 ras guanyl-releasing protein 2 None HSSISRLKETHSHVSPDTIK None 605577 4250 17.22 14.76 16.28 16.81 16.38 17.39 16.69 16.36 17.19 17.23 16.75 15.45 16.52 16.86 16.88 16.04 17.35 15.75 17.02 15.74 16.54 17.95 17.45 16.84 16.94 16.64 16.11 16.19 17.1 17.32 16.97 Q63374 Nrxn2 1 203.726451 116595 + 203.726451 203.842301 neurexin-2 None YAMYKYRNRDEGSYQVDQSR None 600566 86984 19.32 17.76 19.81 19.56 18.3 18.93 18.79 18.78 19.09 20.3 17.94 18.33 19.94 18.85 18.21 18.65 19.86 19.25 18.17 20.11 19.62 20.5 19.21 20.1 18.6 20.0 18.18 19.53 19.17 19.33 19.65 D3ZSB7 Rps6ka4 1 204.0218041 361715 - 204.0218041 204.032774 ribosomal protein s6 kinase None EGHIVLTDFGLSKEFLTEEK None None 49992 16.78 15.96 16.59 17.2 17.69 16.31 16.93 17.93 17.62 15.62 16.5 16.76 16.95 16.34 17.85 16.69 16.89 16.48 17.69 15.56 16.79 16.19 16.86 17.09 17.62 17.5 17.2 16.05 17.25 17.3 18.39 D3ZTC4 Ccdc88b 1 204.0369151 293698 - 204.0369151 204.052835 coiled-coil domain-containing 88b None TLATAIPEEQALRDEVAQLR None None None 17.4 15.31 17.53 17.29 17.48 17.93 17.91 16.94 17.06 16.73 18.12 16.35 17.43 16.7 16.3 16.53 17.01 17.22 17.06 18.39 17.09 17.5 17.64 17.73 16.81 17.27 16.69 16.81 16.97 18.21 17.37 Q9R063 Prdx5 1 204.0998341 113898 - 204.0998341 204.102818 peroxiredoxin-5 None SVEVFEGEPGKKVNLAELFK None 606583 8076 22.66 23.76 22.43 22.24 23.36 22.21 23.16 22.75 21.46 22.28 22.78 22.1 21.87 22.47 20.88 22.49 21.74 22.44 22.14 23.71 20.81 21.62 21.86 21.21 23.08 21.42 22.28 22.01 22.39 21.86 21.73 B2RYS9 Trmt112 1 204.1032991 293700 + 204.1032991 204.104147 multifunctional methyltransferase subunit trm112-like protein None MHHVLLEVDVLEGTLQCPESGR None None None 15.68 17.51 15.49 15.63 16.69 16.34 16.38 17.53 15.83 15.51 15.7 16.59 15.32 15.16 14.68 15.83 15.93 16.28 15.77 16.84 15.78 15.31 15.25 14.95 16.28 16.26 14.8 16.32 16.76 15.53 15.64 G3V8V5 Kcnk4 1 204.1186481 116489 - 204.1186481 204.124976 potassium channel subfamily k member 4 None DQFLKDHPCVSQKNLEGFIK None 605720 7391 16.6 14.62 14.54 16.05 15.01 15.75 15.15 14.8 16.35 16.73 16.44 15.44 16.3 15.3 14.95 16.35 16.65 15.72 15.31 15.79 15.67 16.15 16.82 15.63 15.5 15.19 15.14 16.67 16.42 15.76 14.53 Q45QJ4 Plcb3 1 204.1449461 29322 - 204.1449461 204.160283 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase None MTTEVPLRDVLEAIAETAFK None 600230 47960 17.5 16.0 17.55 17.04 17.99 17.09 18.13 16.94 17.75 16.28 17.52 18.18 18.01 17.82 16.52 16.83 16.37 18.4 18.15 18.29 18.81 17.41 17.24 17.52 18.12 17.1 17.48 17.73 16.58 18.32 18.12 Q99JE6 Plcb3 1 204.1449461 29322 - 204.1449461 204.160283 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 None SEAKTREKHKKEVELTEINR None 600230 47960 17.67 16.05 17.55 17.04 17.99 17.09 18.13 16.94 17.75 16.28 17.52 18.18 17.92 17.82 16.52 16.83 16.37 18.4 18.15 18.29 18.81 17.41 17.1 17.52 18.12 17.1 17.48 17.73 16.58 18.35 18.19 Q8K3F3 Ppp1r14b 1 204.1652111 259225 + 204.1652111 204.167319 protein phosphatase 1 regulatory subunit 14b None VYFQSPPGAAGEGPGGADDDGPVRR None 601140 7483 13.82 14.95 15.32 15.65 15.87 15.96 16.32 13.69 16.17 15.89 15.13 16.08 15.95 16.6 14.28 15.05 14.91 16.2 15.56 16.57 16.71 15.16 16.3 14.51 14.28 15.0 15.19 15.41 15.47 15.41 15.59 D3ZZR9 Fkbp2 1 204.1677271 293702 - 204.1677271 204.170399 peptidylprolyl isomerase None TGQVIKGWDQGLLGMCEGEK None 186946 9581 17.37 17.69 18.11 17.95 18.92 19.04 18.94 18.73 19.04 19.2 18.32 19.24 19.1 17.94 17.69 19.13 18.07 19.45 17.67 19.78 18.4 18.35 19.09 18.93 17.0 18.16 18.2 17.62 18.87 18.28 18.26 B2GVB9 Fermt3 1 204.1894851 309186 - 204.1894851 204.207587 fermitin family member 3 None QWLLQTHWTLDKYGILADAR None 607901 12877 17.45 15.72 15.99 15.91 15.8 16.07 17.36 16.7 16.42 15.89 18.04 16.23 16.09 16.23 16.74 14.8 15.64 17.1 16.09 16.07 16.64 17.56 16.02 16.08 15.76 16.08 16.45 16.3 15.17 16.34 15.78 O35814 Stip1 1 204.2094361 192277 - 204.2094361 204.228461 stress-induced-phosphoprotein 1 None AIHFYNKSLAEHRTPDVLKK None 605063 4965 23.15 22.32 22.4 22.16 22.83 21.42 21.84 22.72 21.63 22.79 21.27 20.98 21.98 21.36 22.04 21.88 22.4 21.84 20.95 23.69 21.24 22.08 21.81 22.29 22.61 23.14 21.75 21.69 22.83 22.37 22.51 Q8K4G6 Macrod1 1 204.2462251 246233 + 204.2462251 204.387025 adp-ribose glycohydrolase macrod1 None QAAELRSCYLSSLDLLLEHR None None 8549 16.41 16.91 18.73 17.67 17.39 17.61 18.66 17.72 17.49 17.19 17.74 16.71 18.46 17.61 17.73 17.45 16.89 17.71 18.94 17.34 19.06 17.57 18.26 17.55 18.6 17.83 17.9 18.07 16.32 17.69 17.69 D4AC39 Flrt1 1 204.2800191 499308 - 204.2800191 204.28548 fibronectin leucine-rich transmembrane protein 1 None LHLDDNSVSTVSIEEDAFADSK None None None 16.2 14.18 17.16 17.17 16.25 14.74 15.49 16.57 16.22 15.74 15.75 15.23 15.8 15.13 15.73 16.11 15.75 15.14 15.94 16.05 14.59 15.83 16.45 15.46 16.46 15.6 15.47 16.17 15.95 16.03 16.22 B2RYG6 Otub1 1 204.3872161 293705 - 204.3872161 204.395495 ubiquitin thioesterase otub1 None QEPLGSDSEGVNCLAYDEAIMAQQDR None 608337 9772 20.53 22.35 20.07 19.09 19.59 20.46 21.56 20.09 19.95 22.0 20.71 19.97 19.87 20.3 18.88 21.0 20.03 20.85 20.27 21.42 20.95 21.04 19.84 19.65 19.47 20.53 19.84 20.84 19.56 19.53 19.98 O08679 Mark2 1 204.4614731 60328 - 204.4614731 204.525715 serine/threonine-protein kinase mark2 None QRRSSDQAVPAIPTSNSYSK None 600526 69013 18.21 18.29 18.05 19.49 18.14 18.07 18.31 18.81 18.38 17.77 17.81 18.64 19.16 18.34 19.29 19.0 19.04 18.78 18.88 16.8 18.45 18.02 17.74 19.43 18.99 20.3 18.74 18.26 18.39 17.99 20.39 A0A0H2UHX1 Rtn3 1 204.6126821 140945 - 204.6126821 204.669187 reticulon None ALGAKSCGSSCAVHDLIFWR None 604249 24934 21.03 19.91 20.72 20.4 19.71 19.86 19.58 20.86 20.7 21.65 19.9 19.65 20.38 20.4 19.94 19.47 19.2 20.72 20.2 21.03 19.6 20.75 20.19 20.04 19.84 20.23 19.14 20.92 21.67 20.32 19.87 Q6RJR6 Rtn3 1 204.6126821 140945 - 204.6126821 204.669187 reticulon-3 None DWTETFTEGKPVKGYLSSTK None 604249 24934 21.92 20.73 20.54 21.35 21.07 21.88 20.65 21.03 21.45 21.1 21.08 21.69 21.26 21.58 19.63 21.14 21.81 21.27 21.85 21.12 20.68 21.41 21.71 20.85 20.93 21.4 20.61 21.15 22.59 21.36 20.91 A0A0G2JSS9 Atl3 1 204.6809691 309187 + 204.6809691 204.721939 atlastin-3 None MEKEINGSKVTCRGLLEYFK None 609369 9149 19.51 16.6 18.47 18.27 18.54 18.37 18.96 19.48 18.38 18.2 20.47 17.91 18.68 18.73 19.4 18.54 18.27 18.55 19.21 16.95 17.76 18.51 19.08 18.51 18.77 17.83 19.05 17.98 17.71 19.21 17.82 Q0ZHH6 Atl3 1 204.6809691 309187 + 204.6809691 204.721939 atlastin-3 None MEKEINGSKVTCRGLLEYFK None 609369 9149 19.04 16.25 17.18 17.79 18.15 18.45 18.58 19.15 18.12 18.06 19.52 18.71 18.26 18.33 19.1 18.18 17.99 18.11 18.92 16.55 17.47 18.12 18.64 18.13 17.56 17.79 18.67 17.51 17.57 19.04 17.34 P08482 Chrm1 1 205.580341 25229 + 205.580341 205.582105 muscarinic acetylcholine receptor m1 None GSEVVIKMPMVDSEAQAPTK None 118510 20189 15.86 17.03 17.1 16.23 15.35 16.21 15.89 15.4 16.82 15.84 15.93 16.22 15.45 16.4 15.47 16.4 16.61 15.71 16.71 14.98 16.45 15.74 16.91 15.68 15.11 15.62 16.01 16.43 15.93 15.64 15.11 A0A0H2UHQ0 Slc3a2 1 205.6044571 50567 - 205.6044571 205.618994 4f2 cell-surface antigen heavy chain None HKGALYRIGDLQAFVGPEAR None 158070 1795 21.96 19.72 22.44 22.36 20.61 21.44 20.52 21.29 20.64 21.75 21.99 20.63 21.65 21.27 21.42 20.52 22.31 20.86 20.45 21.61 21.27 21.93 21.78 21.79 21.56 21.82 22.07 21.51 20.82 22.04 21.65 Q794F9 Slc3a2 1 205.6044571 50567 - 205.6044571 205.618994 4f2 cell-surface antigen heavy chain None FTGLSKEELLKVAGSPGWVR None 158070 1795 21.96 19.72 22.44 22.38 20.62 21.44 20.52 21.29 20.64 21.75 21.99 20.63 21.65 21.26 21.45 20.54 22.34 20.89 20.45 21.6 21.25 21.91 21.78 21.79 21.56 21.82 22.07 21.51 20.82 22.05 21.65 Q08851 Stx5 1 205.6374021 65134 + 205.6374021 205.653562 syntaxin-5 None IDENVLGAQLDVEAAHSEILK None 603189 2381 17.87 16.14 17.25 18.25 18.02 16.85 17.88 17.21 17.8 16.93 17.7 18.55 18.0 18.33 17.97 15.87 16.5 18.69 17.45 17.45 18.77 17.3 17.73 18.06 18.89 17.43 18.64 16.8 16.59 18.17 18.72 F1MA52 Nxf1 1 205.6554251 59087 + 205.6554251 205.668636 nuclear rna export factor 1 Mex67h; Tap None None None None 16.09 14.74 16.3 16.06 16.01 15.98 15.77 16.39 16.45 14.96 15.51 16.83 16.18 16.42 16.93 15.3 16.78 15.85 16.36 14.39 17.25 15.49 16.23 15.68 16.99 15.67 16.39 15.27 17.13 16.7 17.27 O88984 Nxf1 1 205.6554251 59087 + 205.6554251 205.668636 nuclear rna export factor 1 None QLKLIMSKRYDGSQQALDLK None 602647 38176 16.09 14.74 16.3 16.06 16.01 15.98 15.88 16.39 16.45 14.96 15.51 16.83 16.18 16.42 16.93 15.3 16.78 15.85 16.36 14.39 17.25 15.49 16.23 15.69 16.99 15.67 16.34 15.19 17.11 16.7 17.27 P62489 Polr2g 1 205.6891321 117017 - 205.6891321 205.692562 dna-directed rna polymerase ii subunit rpb7 None IVFRPFKGEVVDAVVTQVNK None 602013 2019 15.32 14.28 15.96 15.34 15.45 15.24 15.28 15.59 15.54 14.46 15.64 15.46 15.83 15.6 15.99 14.79 13.9 15.63 15.68 16.2 16.74 15.27 15.56 14.83 16.33 14.72 16.56 14.61 16.17 16.15 16.73 Q6P5P3 Ttc9c 1 205.7029271 309196 - 205.7029271 205.712449 tetratricopeptide repeat protein 9c None RLQEAQLYKEEGNQRYREGK None None 18361 15.66 17.04 16.61 16.02 16.18 15.32 16.66 17.16 15.44 16.84 16.08 14.63 15.68 15.9 15.87 15.42 15.87 15.68 16.51 15.7 15.37 15.24 15.36 15.13 15.86 16.21 14.63 16.77 16.11 15.49 16.12 D4ABT8 Hnrnpul2 1 205.7135281 309197 + 205.7135281 205.725622 heterogeneous nuclear ribonucleoprotein u-like 2 None ELRKEVEGDDVPESIMLEMK None None None 18.44 19.31 19.93 19.53 19.59 19.37 18.37 19.34 20.25 18.47 18.84 20.34 20.29 20.09 20.69 18.9 20.01 19.33 20.07 19.39 21.49 19.92 20.05 20.42 20.59 19.84 20.86 18.9 20.26 19.76 20.49 G3V8K2 Gng3 1 205.7318381 114117 - 205.7318381 205.733603 guanine nucleotide-binding protein subunit gamma None MKGETPVNSTMSIGQARKMV None None 22575 18.11 18.31 18.73 19.25 18.56 19.85 19.19 18.65 19.96 19.91 18.7 20.2 20.2 20.5 19.61 18.27 19.23 18.4 19.51 19.62 20.23 19.27 20.22 19.36 17.95 19.02 17.96 19.74 20.27 19.13 19.09 Q499N6 Ubxn1 1 205.7652961 293719 + 205.7652961 205.769235 ubx domain-containing protein 1 None EPTPSEQVGPEGSGSAAGESKPVLTEEER None None 9283 19.35 17.0 19.98 19.35 19.26 19.06 19.14 18.28 19.0 17.03 18.94 19.0 19.5 19.69 17.9 17.77 19.01 19.15 20.25 18.69 19.94 18.97 19.43 19.45 19.77 19.35 20.29 18.18 18.07 19.57 19.57 D3ZAN3 Ganab 1 205.7938961 293721 + 205.7938961 205.813695 alpha glucosidase 2 alpha neutral subunit None FGKMLDYLQGSGETPQTDIR None 104160 5426 20.28 19.08 19.61 19.45 20.28 19.91 18.84 19.96 19.28 20.32 20.19 19.44 18.64 19.38 18.56 19.44 18.96 19.92 19.06 21.13 19.84 19.35 19.6 20.13 19.96 18.93 18.91 18.84 20.59 20.19 20.48 B2GV35 B3gat3 1 205.8173791 293722 + 205.8173791 205.823897 galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase None DSPPPGTQGVVYFADDDNTYSR None 606374 56554 16.08 16.62 15.84 15.61 14.99 14.19 15.77 14.95 15.56 15.92 15.85 14.93 15.99 15.52 15.51 14.26 16.27 15.25 15.09 15.4 16.02 15.97 14.61 15.67 15.04 14.92 15.06 15.15 15.63 14.72 14.74 B2GV01 Mta2 1 205.8381821 361724 + 205.8381821 205.846902 metastasis-associated 1 family, member 2 None SAAAASRDITLFHAMDTLQR None None 3480 16.91 17.91 18.55 18.56 16.86 17.1 16.26 17.38 19.17 16.79 17.36 17.24 17.66 17.48 19.03 17.1 17.16 17.22 17.61 17.11 18.42 17.07 17.02 18.92 18.11 16.9 18.56 17.41 17.1 17.28 19.4 Q3MHT4 Tut1 1 205.8487241 499314 + 205.8487241 205.859917 speckle targeted pip5k1a-regulated poly(a) polymerase None EEDRGEGKHRKELELAEASK None None 69361 15.38 16.8 16.09 14.66 14.93 16.55 16.55 15.0 16.51 14.86 15.59 16.37 14.26 15.88 16.45 16.16 15.67 14.7 15.48 16.47 16.02 15.96 15.3 15.1 14.85 14.99 15.53 16.19 14.74 16.51 16.67 Q68FR6 Eef1g 1 205.8607141 293725 + 205.8607141 205.871317 elongation factor 1-gamma None GQDLAFPLSPDWQVDYESYTWR None 130593 20363 20.99 21.89 21.34 21.05 21.15 20.46 20.12 22.27 21.13 22.86 21.05 20.4 21.8 21.39 21.43 20.94 22.03 20.92 20.03 20.55 20.87 20.35 21.0 21.37 21.34 20.29 21.81 21.21 21.45 19.82 20.67 A0A0G2JUA5 Ahnak 1 205.8822741 191572 + 205.8822741 205.912349 ahnak nucleoprotein None KGPSVDVEVPDVDLECPEAK None 103390 67425 21.63 19.57 21.33 20.56 20.46 20.17 21.59 22.54 20.97 20.05 22.86 20.47 20.74 21.76 20.59 20.09 20.79 21.84 20.69 20.87 20.71 20.71 21.13 21.2 21.09 20.14 21.13 21.14 19.27 20.96 21.54 Q8VI04 Asrgl1 1 206.0066171 246307 - 206.0066171 206.027142 isoaspartyl peptidase/l-asparaginase None ALDCKGNLAYATSTGGIVNK None None 11825 21.12 23.44 21.35 21.06 20.59 20.88 21.91 22.01 21.4 22.48 21.03 20.83 21.55 21.63 20.35 22.36 21.98 21.19 22.25 22.3 21.09 22.08 21.21 21.69 21.45 22.62 22.65 21.46 20.32 21.1 21.62 P19132 Fth1 1 206.6271411 25319 + 206.6271411 206.62943 ferritin heavy chain None EKLMKLQNQRGGRIFLQDIK None 134770 38448 18.47 17.5 17.5 17.47 17.87 17.54 18.14 17.89 18.24 16.34 17.66 16.56 16.94 17.98 17.66 18.23 17.2 19.11 17.55 16.73 16.51 18.12 17.06 16.43 19.06 17.59 18.54 17.6 17.18 17.14 17.51 Q66HI5 Fth1 1 206.6271411 25319 + 206.6271411 206.62943 ferritin None EKLMKLQNQRGGRIFLQDIK None 134770 38448 17.05 18.74 16.78 17.08 17.53 17.75 18.02 17.37 18.07 17.67 17.08 18.15 17.34 17.91 17.62 18.08 17.06 18.88 17.54 16.17 16.66 18.11 17.14 15.97 16.07 17.19 18.27 17.56 17.22 16.58 16.8 Q5XIP6 Fen1 1 206.8451351 84490 - 206.8451351 206.849502 flap endonuclease 1 None EIVRRLDPSKYPVPENWLHK None 600393 3034 17.46 16.93 17.55 17.29 18.03 17.91 18.07 17.23 17.87 16.48 16.91 18.52 18.02 17.6 18.03 16.91 16.93 17.04 18.65 17.64 19.23 17.14 17.23 16.22 18.03 17.66 19.12 17.53 17.43 18.44 18.57 Q5YLM1 Dagla 1 206.8906391 309207 - 206.8906391 206.947232 diacylglycerol lipase-alpha None PTSDYTEGPKSPSQQEILLR None None None 18.02 17.48 17.94 17.46 18.31 17.88 17.7 17.57 19.04 17.74 17.17 18.94 18.39 18.74 18.39 17.84 17.47 18.34 19.42 16.96 19.28 17.89 17.82 18.16 18.04 17.86 18.28 19.31 17.27 18.25 19.48 Q62747 Syt7 1 207.0315931 59267 + 207.0315931 207.089156 synaptotagmin-7 None GEVSIPLNKVDLTQMQTFWK None 604146 20889 19.47 19.79 19.13 19.54 19.27 19.29 19.24 18.68 19.32 19.17 19.08 19.6 18.56 19.47 19.3 19.45 19.19 18.88 19.9 18.91 19.48 19.19 20.09 18.34 19.43 20.23 18.83 19.6 19.97 19.02 19.55 Q5XI29 Cpsf7 1 207.168561 365407 + 207.168561 207.191587 cleavage and polyadenylation specificity factor subunit 7 None AASQPSDDRSSSTEPPPPVR None None None 17.22 15.57 16.59 16.62 16.71 16.6 15.99 16.2 18.79 17.1 15.99 17.76 17.37 17.28 17.57 16.45 16.96 17.01 16.41 17.96 18.8 17.93 17.24 17.14 16.42 16.91 17.59 16.84 18.22 17.36 18.24 Q4KLZ6 Tkfc 1 207.239531 361730 - 207.239531 207.252737 triokinase/fmn cyclase None VALLSGGGSGHEPAHAGFIGK None None 56710 18.33 18.02 18.36 16.87 18.96 17.6 17.5 19.15 19.09 19.62 18.56 17.32 17.24 18.8 17.16 18.4 18.83 19.04 16.94 19.21 17.24 18.94 17.39 19.33 17.87 17.4 17.48 19.27 17.27 18.05 20.18 G3V8T4 Ddb1 1 207.2528911 64470 + 207.2528911 207.278676 dna damage-binding protein 1 None TEPATGFIDGDLIESFLDISRPK None 600045 1448 19.99 22.09 19.41 19.81 19.65 19.51 19.85 20.86 19.32 20.93 19.19 19.37 19.42 19.35 19.38 19.38 19.5 19.98 19.93 21.56 20.52 20.03 19.21 19.79 19.72 20.93 20.01 19.34 20.78 19.17 20.06 Q9ESW0 Ddb1 1 207.2528911 64470 + 207.2528911 207.278676 dna damage-binding protein 1 None MELFRPKGESKDLLFILTAK None 600045 1448 20.06 21.97 19.81 19.37 19.23 20.07 19.75 19.81 19.08 21.03 19.4 19.28 19.39 20.19 19.47 18.78 19.47 20.0 19.93 21.52 21.5 20.49 19.22 19.8 19.57 20.66 20.06 19.44 20.69 19.09 20.17 B5DFF4 Vps37c 1 207.3367641 108348178 + 207.3367641 207.362293 vps37c subunit of escrt-i None ESPEVQDLQLEREMALATNR None None None 16.24 16.58 16.02 15.24 17.39 16.0 16.44 16.81 16.99 17.0 17.61 15.48 15.74 16.77 14.89 16.25 17.03 17.35 15.28 16.59 15.23 16.94 16.13 15.67 15.87 15.33 14.87 17.07 16.67 16.97 16.77 G3V963 Tmem132a 1 207.5071271 338474 - 207.5071271 207.518758 rcg47487, isoform cra_b None AQLGVVVSGVGAEGLPLHVALHPPEPCR None None 75076 16.99 15.33 16.96 16.79 16.34 17.1 16.93 16.41 17.34 16.17 16.3 18.18 17.43 17.85 15.18 16.11 16.66 17.58 17.58 16.9 17.73 17.01 17.41 16.53 16.21 16.57 16.65 16.86 18.08 17.41 17.29 Q80WF4 Tmem132a 1 207.5071271 338474 - 207.5071271 207.518758 transmembrane protein 132a None IRGKFERAEEEAGKEENEAK None None 75076 16.91 15.15 16.8 16.75 16.24 17.19 16.44 16.14 17.06 15.94 16.34 18.1 17.35 17.86 15.32 16.01 16.18 17.62 17.76 16.69 17.68 16.97 17.33 16.2 16.34 16.4 16.6 17.22 18.04 17.35 17.17 Q6AYQ4 Tmem109 1 207.5196321 361732 - 207.5196321 207.530203 transmembrane protein 109 None ASPGQQKRESSADILTEIGR None None 11458 17.78 17.86 18.48 17.59 18.11 17.11 18.2 18.31 17.83 17.8 17.18 17.74 18.36 18.7 18.35 17.53 17.27 17.92 19.42 18.16 19.57 17.85 17.77 17.07 18.81 19.59 17.75 18.72 19.38 18.53 19.5 Q9JMJ4 Prpf19 1 207.541621 246216 + 207.541621 207.552659 pre-mrna-processing factor 19 None ADKNVVVFDKSTEQILATLK None 608330 6421 19.25 19.86 20.63 19.98 20.07 19.61 18.71 20.2 20.47 19.22 19.67 20.57 20.15 20.63 20.67 19.02 19.64 19.61 20.0 20.77 21.69 19.88 19.65 20.67 20.77 19.51 21.14 19.23 20.92 20.47 21.6 Q5M818 Mrpl16 1 208.6336721 293754 + 208.6336721 208.638472 39s ribosomal protein l16 None ATANMFGIRKFLSPYDLTQK None 611829 9872 16.57 15.75 15.1 15.67 16.56 16.08 14.42 14.96 15.52 14.73 14.95 16.52 14.59 16.28 16.56 17.17 16.34 15.72 15.99 14.5 14.82 16.32 15.87 16.27 17.19 16.91 17.09 16.41 16.11 15.44 17.05 Q08849 Stx3 1 208.6407611 81802 - 208.6407611 208.685772 syntaxin-3 None APIPEPKTKDDLEQLTTEIK None 600876 80191 18.17 19.46 19.58 19.5 18.51 18.43 19.93 18.32 19.46 17.68 19.64 18.66 17.71 18.58 18.16 18.08 18.4 19.27 18.18 19.76 20.01 19.49 18.62 17.54 18.78 18.81 18.7 19.16 18.84 18.32 18.85 D4A9D8 Osbp 1 208.8886981 365410 + 208.8886981 208.918506 oxysterol-binding protein None LRPDQRLMENGRWDEANAEK None 167040 75303 19.64 17.12 19.22 19.11 18.47 18.89 18.73 19.41 18.83 19.59 18.56 17.56 19.33 18.35 19.25 19.14 18.77 19.75 18.44 19.84 18.95 20.52 19.34 19.19 19.86 20.04 20.74 18.92 17.92 19.65 19.43 Q07141 Tle4 1 211.6605191 25565 - 211.6605191 211.797862 transducin-like enhancer protein 4 None EVVCAVTISNPTRHVYTGGK None None 38259 16.16 17.55 15.33 15.7 16.1 17.72 15.58 14.58 17.22 17.02 15.35 16.56 15.3 16.63 15.79 16.09 15.74 16.71 15.63 17.61 17.82 16.81 15.7 15.84 15.11 16.35 16.23 15.8 18.01 15.59 16.9 A0A0G2K931 Psat1 1 213.1967131 293820 - 213.1967131 213.218564 phosphoserine aminotransferase Psa1 None None None None 21.14 23.02 20.31 21.41 21.27 21.84 22.17 21.83 20.18 21.53 21.39 20.79 20.92 21.47 20.0 21.89 20.71 20.89 21.98 22.39 20.19 20.77 21.72 21.62 21.57 22.58 21.78 19.8 20.57 21.3 19.78 E9PSV5 Psat1 1 213.1967131 293820 - 213.1967131 213.218564 phosphoserine aminotransferase None QKQLLDYKGLGISVLEMSHR None 610936 6973 21.14 23.02 20.31 21.41 21.27 21.84 22.17 21.83 20.18 21.53 21.39 20.79 20.92 21.47 20.0 21.89 20.71 20.89 21.98 22.39 20.19 20.77 21.72 21.62 21.57 22.58 21.78 19.8 20.57 21.3 19.78 P82471 Gnaq 1 213.4256571 81666 + 213.4256571 213.667064 guanine nucleotide-binding protein g(q) subunit alpha None EKIMYSHLVDYFPEYDGPQR None 600998 1566 20.34 23.2 20.8 19.95 20.97 20.52 21.04 20.61 20.11 20.88 19.46 21.33 20.67 20.68 19.83 21.97 20.81 22.15 21.5 20.9 21.42 20.51 20.12 21.48 20.81 22.08 20.56 21.8 19.64 20.38 20.77 Q6AY91 Nmrk1 1 216.0493341 499330 - 216.0493341 216.076809 nicotinamide riboside kinase 1 None PLDTIWNRSYFLTVPYEECK None None None 13.9 15.64 15.57 14.16 14.98 14.63 15.82 14.93 14.41 14.63 16.42 14.33 15.23 14.73 14.54 15.91 15.07 14.86 15.79 15.25 16.64 13.89 15.76 13.92 15.33 14.61 14.52 15.34 14.72 14.32 14.08 Q6P686 Ostf1 1 216.0020371 259275 + 216.0020371 216.049212 osteoclast-stimulating factor 1 None VELNQQNKLGDTALHAAAWK None 610180 8227 18.27 16.01 17.47 17.08 18.5 17.24 18.3 18.08 16.65 16.98 19.17 16.89 17.7 17.32 16.43 17.24 16.96 18.43 16.7 18.22 16.6 16.95 17.7 17.36 17.5 16.68 17.83 16.76 16.28 17.93 17.52 Q5EAP4 Gna14 1 213.7160211 309242 + 213.7160211 213.897423 g protein subunit alpha 14 None RVPTTGIIEYPFDLENIIFR None 604397 68386 19.01 21.15 19.1 18.41 18.97 19.04 18.49 19.45 19.41 20.61 18.13 19.16 18.62 18.28 19.14 20.18 19.45 19.6 19.96 18.41 19.12 19.28 18.53 20.82 17.8 19.9 19.46 19.27 18.39 18.24 19.07 M0R6W5 Vps13a 1 213.9382851 - 213.9382851 213.957308 vacuolar protein sorting 13 homolog A None YLVSFFEGLQRIILFTEDPR None None None 17.91 15.15 16.12 17.56 16.45 16.79 17.11 18.05 16.64 16.59 17.31 17.36 17.04 16.16 17.53 16.96 15.88 17.61 17.26 16.38 16.11 15.6 16.47 16.36 15.93 17.06 17.19 17.14 15.66 17.06 17.13 D4A899 Vps13a 1 213.9633471 309243 - 213.9633471 214.128404 vacuolar protein sorting 13 homolog a None RSGLPDVKPSGASLEDIMHR None None None 19.18 17.9 18.11 18.08 17.64 19.14 18.87 17.66 18.12 18.69 18.99 18.99 18.84 18.95 18.52 18.69 18.48 18.67 19.41 17.27 19.99 18.45 18.96 18.14 18.76 18.66 18.56 19.26 18.12 18.98 18.82 Q6AYA7 Rfk 1 214.799881 499328 - 214.799881 214.807391 riboflavin kinase None QLDLPEHLKLKDDNFFQVSK None 613010 115690 17.8 19.69 18.45 17.65 17.97 17.64 18.67 18.43 17.04 17.76 18.55 16.92 17.1 17.12 18.19 17.71 17.64 17.83 17.76 17.04 17.0 17.85 17.04 17.5 18.31 17.42 17.98 17.82 16.23 17.16 17.21 Q5BJR4 Prune2 1 214.5723171 - 214.5723171 214.621715 protein prune homolog 2 None KRSVRTSCLYNDPEMTSMEK None None None 17.34 15.73 17.8 16.76 16.64 17.63 17.58 16.78 18.04 17.07 15.73 17.83 17.82 17.91 18.3 17.19 16.8 17.95 17.54 17.15 18.54 17.73 17.8 17.21 17.66 17.31 18.44 17.62 16.17 17.83 18.11 P07150 Anxa1 1 217.8611591 25380 - 217.8611591 217.877204 annexin a1 None EEVVLAMLKTPAQFDADELR None 151690 563 17.58 16.57 17.16 17.13 17.09 17.25 17.8 18.72 16.82 16.61 18.57 17.08 17.33 18.03 16.87 17.09 17.35 17.49 18.51 16.79 17.06 17.34 17.59 16.95 17.85 16.86 17.35 17.49 17.26 17.43 18.59 P51647 Aldh1a1 1 218.1109181 24188 + 218.1109181 218.152911 retinal dehydrogenase 1 None DVIKRANNTTYGLAAGVFTK None 100640 110441 21.28 19.01 20.61 18.9 20.42 20.57 20.28 20.28 19.21 20.41 20.01 19.41 19.27 21.03 19.72 19.99 19.92 19.87 20.11 20.93 19.19 20.94 20.37 19.42 20.53 19.38 21.09 18.96 20.11 20.87 20.2 B5DF11 Zfand5 1 218.7666151 293960 + 218.7666151 218.775843 an1-type zinc finger protein 5 None NLFCGLHRYSDKHNCPYDYK None 604761 21215 15.3 14.24 15.4 15.43 15.07 15.17 14.21 14.83 15.92 15.32 15.32 16.46 16.14 15.73 15.06 15.36 16.25 16.0 16.67 14.62 17.81 15.8 15.74 15.75 16.14 15.99 16.0 15.25 16.84 15.84 16.09 Q9JKB7 Gda 1 218.9067031 83585 - 218.9067031 218.982429 guanine deaminase None ETTEESVKETERFVSEMLQK None 139080 3171 21.6 23.0 22.57 22.25 20.87 22.11 23.3 22.71 22.34 23.01 22.0 21.59 22.96 22.18 21.87 23.15 22.92 22.84 21.77 21.99 21.93 23.18 22.51 22.64 21.45 23.31 21.94 22.93 20.76 21.05 21.89 Q9WTT6 Gda 1 218.9067031 83585 - 218.9067031 218.982429 guanine deaminase None QRAFVGKVCMDLNNTVPEYK None 139080 3171 21.64 22.88 22.57 22.25 20.87 22.12 23.31 22.71 22.34 23.01 22.0 21.59 22.99 22.18 21.88 23.15 22.92 22.82 21.76 22.0 21.92 23.18 22.53 22.61 21.45 23.31 21.94 22.93 20.78 21.06 21.9 Q6AY17 Abhd17b 1 219.1985191 309399 + 219.1985191 219.232776 alpha/beta hydrolase domain-containing protein 17b None LYGQYLERLKQFVSQELVNL None None 41089 14.99 16.61 16.33 16.9 17.44 16.31 16.59 15.79 17.18 17.41 16.06 17.32 17.17 16.21 17.14 17.36 16.5 16.42 16.15 17.49 15.5 17.13 17.17 16.48 15.17 16.23 15.62 17.24 16.86 16.13 15.87 A0A0G2JZA7 Cemip2 1 219.3310231 309400 + 219.3310231 219.40776 hyaluronoglucosaminidase None VKEIPQYLHVGEIIDGIDMR None 605835 75008 15.94 17.55 14.95 15.35 14.65 15.51 14.87 15.61 15.82 15.96 15.41 16.79 15.38 16.12 14.83 15.88 16.06 14.91 17.07 16.63 16.2 16.19 15.79 16.41 16.48 16.15 14.59 16.96 16.23 14.56 15.34 F1LN45 Trpm3 1 219.6728921 309407 + 219.6728921 220.560717 transient receptor potential cation channel, subfamily m, member 3 None ARGRRAANPISSQETENADR None None None 17.16 15.25 17.68 16.71 17.13 16.53 17.4 17.46 17.36 16.43 17.1 17.42 17.86 17.67 17.62 16.44 17.72 17.12 17.08 15.91 17.89 16.77 16.89 16.8 17.05 16.88 18.09 17.84 16.02 18.17 18.03 P13601 Aldh1a7 1 218.2019161 29651 - 218.2019161 218.241148 aldehyde dehydrogenase, cytosolic 1 None GNKGFFVQPTVFSNVTDEMR None None 137245 20.61 19.97 20.18 19.63 20.33 19.98 20.2 20.99 18.78 19.92 19.8 19.16 18.84 19.52 19.2 20.37 19.68 19.91 20.02 20.06 18.04 19.55 19.72 19.12 20.35 19.24 20.54 18.61 19.97 20.27 19.56 D3ZWG9 Ptar1 1 221.2834361 286972 + 221.2834361 221.392492 protein prenyltransferase alpha subunit repeat containing 1, isoform cra_b None TKRLKRTPAPDSLGLEMEHK None None 34254 16.68 15.83 16.95 15.71 17.43 15.51 17.04 16.92 16.9 15.84 16.13 15.43 16.1 16.1 15.04 15.53 15.97 17.47 17.1 16.1 17.35 15.3 15.83 14.93 16.48 16.75 15.53 16.88 17.27 16.19 17.51 O35430 Apba1 1 221.3637791 83589 + 221.3637791 221.566553 amyloid-beta a4 precursor protein-binding family a member 1 None EARDGLRLYERERDEAAAYR None 602414 897 19.09 16.29 17.15 19.22 17.48 18.93 18.09 17.97 18.62 18.11 18.96 18.44 19.02 19.56 18.48 18.07 19.87 18.61 17.46 18.44 17.71 19.32 18.95 17.26 18.25 19.8 18.95 18.34 20.06 18.6 18.82 Q3ZB99 Tjp2 1 221.7097711 115769 - 221.7097711 221.838295 tight junction protein 2 None SRDYSRGRSIDRDYDRDYER None 607709 3541 20.13 18.4 17.84 18.44 20.1 19.05 18.76 19.18 18.72 18.84 20.35 18.53 18.88 18.48 19.05 19.29 19.13 18.11 19.14 19.45 17.82 18.76 19.28 20.12 20.17 18.16 19.14 18.96 17.54 19.65 17.79 D3ZYW7 Fxn 1 221.872421 499335 - 221.872421 221.89754 frataxin None ELTEALNTKLDLSSLAYSGK None 606829 47908 18.78 16.39 19.13 17.35 18.93 17.53 19.32 19.16 17.71 18.19 19.29 17.36 18.42 18.84 18.37 17.88 18.34 19.44 16.76 18.41 17.76 16.98 18.64 16.92 18.74 16.93 18.57 17.61 18.47 18.81 18.54 Q5CZZ9 Pip5k1b 1 221.9141581 309419 - 221.9141581 222.183672 phosphatidylinositol 4-phosphate 5-kinase type-1 beta None KSADGIIAENPDTMGGIPAK None 602745 100644 18.51 19.8 19.73 19.1 18.67 18.98 18.76 18.62 19.7 18.34 18.96 19.32 19.39 20.13 20.17 19.04 19.45 19.41 19.46 18.14 20.46 19.31 19.6 19.38 19.14 20.47 20.15 20.01 19.0 18.72 19.61 D3ZVR9 Pgm5 1 222.3267721 679990 - 222.3267721 222.513387 phosphoglucomutase 5 None QAVLSPLIAIALKISQIHER None 600981 74881 17.72 15.41 17.94 17.46 17.45 15.79 17.93 18.3 17.28 16.22 18.53 17.17 17.24 17.69 17.08 16.49 16.11 17.77 17.42 18.53 17.38 17.33 17.29 17.2 17.75 16.84 17.7 17.41 16.18 18.0 18.49 Q99MB4 Cbwd1 1 222.5682861 171057 - 222.5682861 222.610624 cobw domain-containing protein 1 None LDFIIKIPVTIVTGYLGAGK None 611078 6843 14.98 15.36 17.03 16.14 16.46 15.38 16.86 15.54 14.61 16.65 15.23 16.06 17.51 15.16 15.66 17.38 16.6 14.97 16.69 15.88 14.79 16.83 17.17 16.27 17.52 15.78 15.63 16.57 14.89 16.47 15.33 F1LPG2 Dock8 1 222.6493141 499337 + 222.6493141 222.84247 dedicator of cytokinesis 8 None VEKNRRLITAEQREYQQELK None 611432 52414 17.36 15.06 17.84 17.41 16.32 16.92 16.88 17.12 17.09 16.9 18.13 16.44 17.74 17.57 17.53 16.19 17.69 16.1 17.54 16.24 17.47 17.29 17.42 16.73 17.07 16.69 18.36 17.56 15.69 17.75 17.6 D4AE58 Kank1 1 222.9553471 309429 + 222.9553471 223.07452 kn motif and ankyrin repeat domains 1 None EMRTVAIGEGRVRDINPSTK None 607704 17706 16.46 14.92 17.13 17.36 15.86 16.61 15.98 16.27 15.36 16.42 17.2 15.34 16.3 16.59 15.67 15.49 16.99 16.08 16.61 15.48 15.45 16.12 16.56 15.52 15.98 16.55 16.69 15.84 17.27 17.27 16.58 E9PTG1 Smarca2 1 224.1911151 361745 + 224.1911151 224.357658 swi/snf-related, matrix-associated, actin-dependent regulator of chromatin, subfamily a, member 2 None FAMTGERVDLNEEETILIIR None 600014 2308 17.99 19.54 19.35 18.41 18.45 18.74 17.94 18.26 19.21 17.57 19.02 19.05 18.04 19.29 19.65 17.9 18.86 18.29 18.94 18.16 20.52 19.22 18.44 19.57 19.15 18.32 19.99 18.23 18.32 18.67 19.77 P98166 Vldlr 1 224.8144571 25696 + 224.8144571 224.84592 very low-density lipoprotein receptor None QLVEQLRNTVALDADIAAQK None 192977 443 17.36 16.21 17.49 16.49 16.06 16.82 17.05 16.86 15.2 16.71 17.22 16.06 15.93 17.33 16.78 15.37 15.57 17.47 16.14 17.2 17.35 16.89 17.41 16.85 17.79 16.38 16.0 16.09 17.25 16.97 16.66 P51907 Slc1a1 1 226.5498961 25550 + 226.5498961 226.631924 excitatory amino acid transporter 3 None LGIVVGVLVRGHSELSNLDK None 133550 20881 15.0 15.15 14.61 14.9 15.33 14.92 15.49 14.18 15.54 17.02 14.86 15.92 15.49 15.97 14.86 16.02 16.57 14.57 16.07 15.15 16.32 16.22 16.23 14.04 15.95 15.16 15.04 16.02 16.56 15.2 14.17 Q5XIC3 Cdc37l1 1 226.702271 293886 + 226.702271 226.733029 hsp90 co-chaperone cdc37-like 1 None AKAEEEGYFEAFKNELEAFK None None 9912 18.43 16.27 18.34 17.53 19.01 17.54 17.01 18.32 17.92 16.98 19.01 17.55 18.52 17.49 17.66 18.27 18.63 17.67 17.89 19.05 18.5 17.87 18.74 17.93 19.49 17.6 18.8 18.68 18.06 18.9 18.47 P29411 Ak3 1 226.7393671 26956 - 226.7393671 226.764571 gtp:amp phosphotransferase ak3 None DLTGEPLIQREDDKPETVIK None 103030 21744 19.49 17.01 17.14 19.51 18.16 19.2 19.4 19.36 17.51 17.3 17.5 18.44 18.43 16.76 19.5 18.21 17.82 18.76 18.28 16.92 18.57 16.88 17.56 17.67 19.21 19.57 19.57 17.54 17.48 17.69 19.48 Q6P2A5 Ak3 1 226.7393671 26956 - 226.7393671 226.764571 gtp:amp phosphotransferase ak3 None DLTGEPLIQREDDKPETVIK None 103030 21744 19.77 17.63 17.44 19.74 18.39 19.4 19.67 19.63 17.76 17.65 17.66 18.62 18.57 16.99 19.82 18.47 18.08 19.0 18.48 17.2 18.81 17.16 17.67 17.72 19.41 19.9 19.83 17.8 17.77 17.73 19.77 D4ACN8 Plgrkt 1 227.0990121 293888 - 227.0990121 227.111277 plasminogen receptor (kt) None YGTLLQRMKSEAEDILETEK None None None 18.02 19.62 17.46 17.83 16.9 16.96 18.04 16.24 17.23 18.0 17.07 17.49 17.41 18.46 16.67 18.01 18.47 17.4 18.41 17.41 18.27 18.88 17.14 17.18 18.66 18.92 17.61 17.48 18.38 16.73 18.25 Q6UPR8 Ermp1 1 227.3879211 373544 - 227.3879211 227.422069 endoplasmic reticulum metallopeptidase 1 None EFDARQARVYLEHITAIGPR None 611156 121891 18.08 18.24 17.86 17.48 18.7 16.16 16.96 18.5 17.21 16.28 17.42 16.49 16.82 17.15 17.05 17.8 16.49 17.68 17.16 17.78 16.01 16.28 16.25 17.23 18.96 17.65 16.59 17.42 18.24 16.98 18.03 D4A634 Ranbp6 1 227.5735991 309326 - 227.5735991 227.576915 ran-binding protein 6 None DIIKRLLDQCIQDQEHPAIR None None 18935 16.85 15.84 17.72 17.75 17.3 18.28 18.59 17.17 17.28 18.04 17.59 16.92 18.29 16.93 17.15 17.13 17.93 17.38 18.34 16.64 18.27 18.08 18.45 17.09 16.66 18.52 17.53 17.52 17.05 17.73 17.19 A0A0G2JUZ5 Gldc 1 227.883251 309312 - 227.883251 227.955265 glycine cleavage system p protein None GKGLKEATEIAILNANYMAK None 238300 141 17.64 16.73 17.85 17.83 17.14 19.04 17.89 17.2 18.33 18.23 17.94 18.33 18.19 18.7 17.84 17.87 18.0 19.03 17.75 17.6 19.24 18.26 18.37 19.42 17.18 17.91 18.63 17.73 16.83 17.11 19.27 D4A5Q9 Gldc 1 227.883251 309312 - 227.883251 227.955265 glycine decarboxylase None IDDIYGDQHLVCTCPPMEVYESPFSEQK None 238300 141 17.66 16.51 18.13 17.84 17.17 19.01 17.92 17.2 18.24 18.07 18.07 18.2 18.23 18.71 17.8 17.84 17.84 19.13 17.78 17.66 19.26 18.23 18.56 19.2 17.17 18.03 18.73 17.72 16.69 17.3 19.19 Q5BJN5 Chchd4 1 227.9876691 100361898 + 227.9876691 227.988087 mitochondrial intermembrane space import and assembly protein 40 None DIKGSDCIDQFRAMQECMQK None None None 15.32 15.19 15.83 16.11 15.94 16.9 17.43 15.29 17.08 17.13 15.92 17.06 17.2 15.23 16.86 17.51 16.85 15.33 16.74 16.25 17.16 17.45 17.34 15.02 15.18 16.16 15.5 16.84 17.22 16.26 16.33 M0R6B9 Cstf2t 1 228.9526181 309338 + 228.9526181 228.956183 cleavage stimulation factor subunit 2, tau variant None SLRSVFVGNIPYEATEEQLK None 611968 80230 16.96 15.42 17.45 17.04 17.2 15.36 16.18 16.13 16.93 15.92 16.29 16.57 17.04 17.28 17.83 15.66 16.45 16.8 16.39 16.58 17.55 16.54 17.37 15.9 18.14 16.15 17.84 16.05 17.54 17.25 17.51 O35217 Minpp1 1 230.3544841 29688 + 230.3544841 230.379728 multiple inositol polyphosphate phosphatase 1 None SLPGRGDPVASVLSPYFGTK None 605391 37980 17.18 17.56 16.22 16.92 18.55 16.11 17.21 17.1 15.98 16.0 18.17 16.32 16.16 16.64 15.09 16.44 16.84 17.62 16.26 16.91 15.67 15.65 16.08 16.44 17.65 16.7 15.63 16.22 17.76 15.8 16.6 A0A0G2K950 Papss2 1 230.4543171 294103 + 230.4543171 230.539331 3'-phosphoadenosine-5'-phosphosulfate synthase None AMDFYDPARHDEFDFISGTR None 603005 55840 15.97 16.82 14.92 16.79 15.43 15.82 16.57 15.15 14.54 16.46 15.51 15.12 14.8 15.75 15.49 15.38 15.88 15.18 14.59 17.22 16.27 15.75 15.26 15.28 16.32 16.76 15.84 15.57 15.02 15.54 14.94 Q505J9 Atad1 1 230.5440471 309532 - 230.5440471 230.596548 atpase family aaa domain-containing protein 1 None HAEAFSRPLSRNEVVGLIFR None None 5960 19.88 17.42 20.4 19.77 19.22 18.27 19.46 19.34 19.13 19.28 19.57 18.33 19.33 19.38 20.19 19.18 19.19 18.98 19.85 18.1 20.58 18.53 20.06 18.27 20.44 18.4 19.86 20.05 18.8 19.86 19.97 Q7TP35 Atad1 1 230.5440471 309532 - 230.5440471 230.596548 atpase family aaa domain-containing protein 1 None KMKKSKDAAFQSVLTHVCLD None None 5960 20.13 17.8 20.04 20.24 20.11 18.85 20.14 20.57 18.81 19.1 20.74 18.68 19.75 19.4 18.5 19.82 19.17 19.42 20.62 19.74 18.69 18.62 20.16 17.9 20.78 18.87 20.09 19.92 19.44 20.23 19.8 O54857 Pten 1 230.6310861 50557 + 230.6310861 230.696952 phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase pten None GFPAERLEGVYRNNIDDVVR None 601728 265 18.4 17.07 17.96 18.3 16.9 17.21 17.93 16.98 17.83 17.79 16.21 16.94 17.32 18.51 18.22 18.03 17.54 17.92 18.7 16.33 18.38 16.58 17.93 17.22 18.32 18.76 18.27 18.06 16.95 17.84 17.95 B0BMZ5 Stambpl1 1 231.7065451 687696 + 231.7065451 231.745025 loc687696 protein None LLADSNTVRGIETCGILCGK None None None 14.85 15.88 15.88 16.01 15.91 17.9 17.82 16.05 16.1 17.19 16.43 17.07 17.37 16.74 15.97 16.73 16.18 17.08 16.87 15.35 16.36 16.16 17.38 15.81 15.18 15.89 15.46 16.15 16.58 15.87 15.49 P62738 Acta2 1 231.7465291 81633 - 231.7465291 231.759307 actin, aortic smooth muscle None TTGIVLDSGDGVTHNVPIYEGYALPHAIMR None 102620 123845 25.49 27.37 25.45 25.75 25.43 24.63 25.52 26.4 24.7 24.94 25.84 24.96 25.09 25.33 26.44 26.66 25.29 24.13 25.47 25.76 23.7 25.18 25.07 25.03 26.29 26.56 24.76 25.78 26.18 24.65 25.18 Q64194 Lipa 1 232.0243431 25055 - 232.0243431 232.057721 lysosomal acid lipase/cholesteryl ester hydrolase None DWLADTSDINILLTEIPTLVYHK None 613497 37277 15.52 15.24 15.72 16.5 15.85 15.2 16.34 16.11 15.33 15.44 17.54 15.8 16.79 14.86 16.77 15.6 14.18 16.28 16.14 15.31 14.7 15.73 15.52 15.01 15.27 15.21 16.12 16.3 14.63 15.16 14.99 D3ZWD3 Pank1 1 232.3284311 294088 - 232.3284311 232.393807 pantothenate kinase 1 None ETFEEALDMAAKGDSTNVDK None 606160 56979 17.33 15.14 16.3 18.35 16.66 17.74 18.5 17.41 16.84 15.52 16.94 18.0 17.14 17.07 18.23 16.01 15.95 17.41 17.24 16.48 17.61 16.03 17.14 15.69 16.56 17.61 16.24 17.33 17.15 17.47 17.61 D3ZX13 Kif20b 1 232.4300891 309523 + 232.4300891 232.483765 kinesin family member 20b None SYDLAAAELHTQRAVNQEQK None None 9418 17.0 14.62 15.1 17.19 16.38 15.84 16.88 16.76 17.34 15.85 16.88 16.22 17.15 17.26 16.55 16.99 16.54 16.32 16.22 16.03 16.15 16.48 16.77 15.27 17.12 17.2 15.65 17.89 17.1 17.01 17.3 D3ZU51 Rpp30 1 233.7861131 685332 + 233.7861131 233.808952 ribonuclease p/mrp subunit p30 None AAFLHGETRKTAFGIISTVK None 606115 38180 15.82 17.22 15.8 16.24 16.42 15.31 16.26 16.47 15.78 14.89 15.58 15.74 15.47 16.27 15.76 15.07 15.81 15.77 15.29 16.39 16.38 15.34 14.88 15.83 17.28 16.44 14.62 16.08 16.81 15.6 16.35 F1LW16 Btaf1 1 234.6533831 368042 + 234.6533831 234.743903 b-tfiid tata-box-binding protein-associated factor 1 None RHNLIVASYDVVRNDIDFFR None 605191 31978 15.32 16.77 15.33 15.91 14.78 16.49 15.4 14.91 15.93 14.14 16.18 16.08 14.37 16.79 15.97 15.14 15.84 15.82 16.83 14.16 16.23 16.33 15.18 14.89 16.58 15.51 15.86 15.99 16.27 15.6 16.07 D4AD99 Cpeb3 1 234.7542121 309510 - 234.7542121 234.904224 cytoplasmic polyadenylation element-binding protein 3 None VFVGGLPPDIDEDEITASFR None 610606 40992 18.01 15.4 17.3 18.3 17.44 16.02 17.1 16.55 16.51 18.02 17.13 17.31 17.75 17.89 18.48 16.82 18.36 16.84 16.81 17.08 17.52 18.13 17.88 17.47 18.15 18.04 18.24 17.37 16.72 18.11 17.68 D3Z942 Ac103056.1 1 234.8901811 + 234.8901811 234.890658 60s ribosomal protein l35 None LKVEMSQLRMTKVTGGAASK None None None 17.04 16.37 16.35 17.52 17.49 15.21 15.89 17.78 16.03 16.93 16.44 16.84 17.03 15.82 17.73 17.76 17.25 16.28 16.78 15.48 15.69 16.37 16.16 17.19 17.36 18.59 17.88 15.89 17.22 16.85 18.04 B0BNF6 Marchf5 1 234.9312761 294079 + 234.9312761 234.951648 membrane-associated ring finger (c3hc4) 5 None YLIVFPKLGPVVYVLDLADR None 610637 9862 16.24 15.07 17.73 16.63 16.87 17.2 17.36 16.09 16.6 16.4 17.2 16.9 17.73 17.33 16.92 16.87 16.86 16.49 16.68 17.72 17.73 17.05 17.68 16.14 17.28 15.95 16.72 17.44 17.26 17.14 17.21 P35559 Ide 1 235.0029671 25700 - 235.0029671 235.102023 insulin-degrading enzyme None NKNVPLPEFPEHPFQEEHLK None 146680 3645 19.93 18.87 19.5 19.28 18.31 18.21 18.77 19.2 18.68 18.16 19.13 17.73 17.6 18.94 18.53 17.46 17.54 19.58 18.28 19.92 19.37 19.19 17.98 18.26 19.99 18.3 18.9 18.59 18.65 18.92 18.95 O54923 Exoc6 1 235.3146081 50556 + 235.3146081 235.457319 exocyst complex component 6 None QPASKYLRVNPHAALTLLEK None 609672 41305 17.43 19.27 17.63 16.18 16.29 17.93 17.61 17.74 17.1 17.98 17.38 16.62 16.94 17.49 18.23 17.84 17.66 17.63 18.19 15.76 17.98 18.13 17.04 17.42 17.08 18.39 17.76 17.91 16.55 16.81 16.65 A0A0G2K695 Myof 1 235.6731781 309499 - 235.6731781 235.822337 myoferlin None KPPEKKLEPISNDDLLVVEK None None 40882 16.71 14.3 17.26 16.97 16.62 15.36 16.57 17.0 16.41 15.44 17.69 15.55 16.61 16.9 16.25 16.11 16.17 16.61 17.08 15.67 15.74 16.34 17.26 16.0 17.24 16.02 15.89 16.51 16.79 16.85 16.31 Q4V7C8 Cep55 1 235.8328961 294074 + 235.8328961 235.848403 centrosomal protein of 55 kda None KIQKLREESSVFKGKLEEER None None None 17.59 19.92 17.9 18.07 18.54 16.92 16.3 18.42 18.01 18.58 17.12 17.63 17.55 18.26 17.47 17.44 18.83 17.88 17.45 17.33 17.33 17.03 17.04 18.18 17.42 18.61 18.57 18.21 18.34 17.45 17.67 P04916 Rbp4 1 235.8939141 25703 - 235.8939141 235.901152 retinol-binding protein 4 None CRLQNLDGTCADSYSFVFSR None 180250 4908 16.36 14.56 16.25 18.16 16.22 16.85 16.89 16.01 16.78 16.88 16.22 17.12 16.95 15.91 17.21 16.12 16.64 16.3 15.92 15.68 16.81 15.71 17.22 17.51 14.89 16.26 16.02 15.76 15.55 16.4 15.96 Q8K4Y5 Lgi1 1 236.0430851 252892 + 236.0430851 236.086688 leucine-rich glioma-inactivated protein 1 None WYRDTDVEYLEIARPPLTLR None 604619 3737 21.72 21.89 19.5 20.28 21.05 20.91 20.34 21.04 20.85 20.61 20.07 21.4 21.0 20.76 21.58 20.99 20.28 20.08 20.64 21.33 20.41 20.76 20.42 20.74 21.01 21.7 19.91 21.29 21.81 20.52 21.3 P52944 Pdlim1 1 239.0423451 54133 - 239.0423451 239.091018 pdz and lim domain protein 1 None LTVSRSEQKIWSPLVTEEGK None 605900 9643 15.95 18.31 17.44 16.84 17.76 16.25 17.12 18.23 16.74 17.46 18.54 16.36 16.77 17.05 15.94 17.06 16.92 17.18 16.42 18.63 16.12 16.66 17.28 17.73 16.97 16.38 18.18 16.26 16.1 16.51 16.55 F1M820 Sorbs1 1 239.1108951 686098 - 239.1108951 239.218542 sorbin and sh3 domain-containing protein 1 None ARSSSLKSSPERNDWEPPDK None 605264 83252 18.73 17.27 18.64 17.83 19.48 16.84 18.5 18.84 19.98 18.15 19.1 18.62 18.52 19.62 18.36 18.42 19.15 17.75 19.33 18.35 18.99 18.44 19.14 19.16 18.29 18.51 19.2 18.56 17.63 19.28 19.61 F1M865 Sorbs1 1 239.1108951 686098 - 239.1108951 239.218542 sorbin and sh3 domain-containing protein 1 None SPRHFIPADYLESTEEFIRR None 605264 83252 18.67 17.16 18.59 17.7 19.46 16.64 18.59 18.81 19.68 18.1 18.89 18.59 18.54 19.4 17.78 18.36 17.91 18.38 19.69 18.98 18.8 18.42 18.94 18.83 18.33 18.34 19.29 18.45 17.46 19.16 19.51 F1M866 Sorbs1 1 239.1108951 686098 - 239.1108951 239.218542 sorbin and sh3 domain-containing protein 1 None PQNDDELELRDGDIVDVMEK None 605264 83252 18.43 17.04 18.4 17.51 19.3 16.64 18.3 18.65 19.35 17.91 18.68 18.6 18.35 19.18 18.02 18.16 18.16 17.74 19.3 18.85 18.65 18.19 18.75 18.66 18.0 18.13 19.23 18.1 17.21 18.95 19.37 F1M8Z8 Sorbs1 1 239.1108951 686098 - 239.1108951 239.218542 sorbin and sh3 domain-containing protein 1 None SEDDDSDLHSPRYSFSEDTK None 605264 83252 18.52 16.99 18.45 17.5 19.4 16.76 18.25 18.68 19.29 17.86 18.67 18.59 18.36 19.18 18.49 18.06 18.5 17.6 18.81 18.65 18.62 18.09 18.72 18.65 18.2 17.98 19.22 18.17 17.23 18.96 19.33 P84109 Sorbs1 1 239.1108951 686098 - 239.1108951 239.218542 sorbin and sh3 domain-containing protein 1 (fragments) None NRDDDSDLHSPRYSFSEDTK None 605264 83252 15.42 18.31 15.9 15.35 15.9 15.87 15.64 15.95 17.94 17.14 16.89 15.83 16.44 17.1 15.23 16.04 15.87 16.54 17.2 16.3 17.9 17.15 16.0 15.74 15.39 16.27 16.03 16.84 17.35 15.38 16.74 D3ZIE9 Aldh18a1 1 239.3756611 108348083 - 239.3756611 239.407883 delta-1-pyrroline-5-carboxylate synthase None ALHSGQNHLKEMAIPVLEAR None None None 18.73 18.1 17.7 19.34 19.32 18.23 18.94 19.3 17.84 17.88 17.95 18.58 19.1 18.09 19.83 18.63 17.95 18.76 19.08 17.43 17.38 18.23 17.71 19.43 19.7 19.61 18.64 19.3 17.04 18.27 20.16 P97687 Entpd1 1 239.4734191 64519 + 239.4734191 239.535021 ectonucleoside triphosphate diphosphohydrolase 1 None RLLRMESKQSADEVLAAVSR None 601752 20423 15.55 17.0 16.6 16.06 16.06 14.86 16.42 17.7 16.7 17.4 15.93 16.6 15.58 17.06 15.76 17.19 16.61 16.1 15.22 17.93 15.37 15.92 16.88 17.15 15.75 16.76 16.66 17.08 14.72 15.12 16.76 Q56A26 Opalin 1 239.8911381 361757 - 239.8911381 239.908834 oligodendrocytic myelin paranodal and inner loop protein None TYRPPEEVERRRGLWWLVPR None None 13237 19.82 19.27 17.55 18.72 18.87 20.9 18.5 18.9 17.77 19.28 19.59 18.33 18.39 19.04 17.95 18.46 19.8 18.25 18.89 18.79 17.73 18.78 18.61 18.46 19.34 18.24 18.42 17.74 20.61 19.57 17.05 P25113 Pgam1 1 240.723891 24642 + 240.723891 240.731437 phosphoglycerate mutase 1 None DADLSPAGHEEAKRGGQALR None 172250 37647 22.55 24.09 21.71 20.85 23.54 22.46 23.5 22.34 21.78 21.44 21.48 22.9 21.48 21.85 20.66 22.64 22.54 21.91 21.94 23.62 22.08 21.6 21.54 21.53 22.98 22.71 21.23 22.2 22.11 21.71 22.55 M0R6T4 Mms19 1 240.7572821 171124 - 240.7572821 240.794269 mms19 nucleotide excision repair protein None LLMAFVCSLPRNVEIPELTR None None None 17.94 15.74 17.96 17.75 17.47 16.9 17.74 17.27 18.01 18.11 17.33 16.09 17.87 17.53 18.1 16.54 17.93 17.27 18.01 16.51 19.12 17.16 17.99 18.27 17.91 18.16 17.44 17.87 16.48 17.96 18.34 Q68FV8 Ubtd1 1 240.7945711 309373 + 240.7945711 240.845788 ubiquitin domain-containing protein 1 None GQLRSKRDEFWDTAPAFEGR None None 11799 15.55 16.09 16.15 16.18 16.15 16.01 15.69 16.39 17.06 16.0 15.32 17.1 16.61 16.59 16.15 15.36 16.18 16.18 15.89 15.91 17.0 16.21 15.49 15.97 15.55 16.02 16.61 17.62 15.65 16.77 17.23 D4A2K1 Hoga1 1 240.8571271 293949 + 240.8571271 240.884243 4-hydroxy-2-oxoglutarate aldolase None RGFVVQGSTGEFPFLTSLER None None None 16.65 14.52 16.5 17.43 16.22 15.24 16.82 15.43 16.39 16.51 15.71 15.56 15.16 15.25 14.71 16.05 16.19 15.85 17.14 15.87 16.98 15.46 15.42 15.77 16.6 15.03 15.43 15.81 15.78 16.41 17.06 Q5BJS9 Morn4 1 240.8883431 293950 - 240.8883431 240.898644 morn repeat-containing protein 4 None FGVLTFSDGSRYEGEFSQGK None None 16635 16.92 15.19 16.35 16.48 15.71 16.59 16.03 15.44 16.66 16.33 15.83 16.28 16.32 16.63 15.68 16.08 17.25 16.16 16.41 15.14 17.16 16.42 16.51 15.67 15.66 16.56 17.25 15.94 16.4 15.51 16.23 Q99M64 Pi4k2a 1 240.9028561 114554 + 240.9028561 240.927155 phosphatidylinositol 4-kinase type 2-alpha None FEVVVRQAEIAIECSIYPER None 609763 101681 18.81 16.96 16.89 18.43 17.28 19.3 18.5 17.15 18.08 16.72 17.81 16.56 16.84 16.35 16.03 17.8 17.96 18.15 17.79 17.68 16.47 17.83 17.78 17.46 18.81 17.52 16.15 17.12 17.87 17.54 16.51 F1M362 Golga7b 1 241.0617231 309378 + 241.0617231 241.081562 golgin a7 family, member b None THYEKVLKKISRYIQEQNEK None None None 17.91 18.67 17.36 16.96 18.21 17.03 16.45 15.77 16.99 18.63 17.33 17.5 17.04 17.41 17.4 18.1 17.93 17.53 16.81 17.76 17.86 17.11 17.16 18.62 17.36 18.12 17.61 17.4 17.14 16.64 17.45 A0A096MJG4 Crtac1 1 241.0788121 171438 - 241.0788121 241.233484 cartilage acidic protein 1 None LSRSVANREMNSVLEILYPR None None 23070 17.8 17.02 16.99 18.79 16.67 17.56 18.04 17.0 17.66 17.94 17.77 17.44 17.51 17.68 17.91 17.78 18.88 17.17 16.9 17.17 18.76 17.28 18.59 17.48 18.06 18.16 18.18 17.93 16.87 17.45 17.61 Q68FT3 Pyroxd2 1 241.5233781 309381 - 241.5233781 241.548761 pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 None AENQKQISQFSRKDAQAFPR None None None 17.69 15.69 16.51 17.65 15.74 18.41 16.43 17.09 16.87 16.05 16.49 16.43 17.24 15.69 17.64 15.5 15.21 17.5 17.5 15.94 18.02 17.19 15.58 16.12 16.57 15.96 16.09 16.15 18.62 17.82 16.75 Q9JM59 Kcnip2 1 244.6411281 100911951 + 244.6411281 244.664935 kv channel-interacting protein 2 None LYDLNKDGCITKEEMLDIMK None None None 17.18 16.36 16.63 17.15 17.32 17.59 17.39 16.09 18.37 17.11 16.36 17.2 17.78 17.93 16.48 17.27 17.53 16.95 18.14 16.79 17.99 17.53 18.22 16.28 17.09 17.27 16.64 17.3 18.64 16.11 17.87 D4A1C0 Cnnm1 1 242.2972771 309387 + 242.2972771 242.353513 cyclin m1 None PLHCVFNDTRLDTVLEEFKK None 607802 10673 17.2 19.49 17.39 17.67 17.5 17.04 17.75 17.35 18.0 17.4 17.73 18.27 17.19 17.99 17.9 16.66 17.76 17.34 18.7 16.17 18.37 17.94 16.74 16.71 18.07 17.1 18.1 18.17 17.83 17.79 18.01 P13221 Got1 1 242.3572941 24401 - 242.3572941 242.380623 aspartate aminotransferase, cytoplasmic None APPVLVFKLIADFRDDPDPR None 138180 1571 23.75 25.22 23.68 22.92 24.25 23.14 24.07 24.53 23.03 23.52 23.06 21.68 22.72 22.39 21.96 23.05 22.69 23.74 22.77 24.74 22.24 22.71 23.02 22.54 24.2 23.19 22.53 22.85 23.83 23.35 22.51 D4A414 Cox15 1 242.6055911 309391 - 242.6055911 242.622244 cox15 homolog, cytochrome c oxidase assembly protein (yeast), isoform cra_a None FSPILKNVFENPTMVQFDHR None 603646 5848 17.24 15.54 17.29 17.82 17.68 15.53 17.38 16.22 16.83 16.4 17.68 17.29 17.39 17.57 18.75 17.83 17.39 15.99 17.26 16.25 17.26 16.56 17.54 17.18 18.6 17.59 17.51 17.91 15.91 17.65 18.07 M0R4F8 Dnmbp 1 242.7361881 309362 - 242.7361881 242.829433 dynamin-binding protein None IYEKDERIQKHLQDYLADLK None None 9061 14.45 16.01 14.77 14.83 14.39 13.54 14.79 13.35 14.81 13.79 14.73 14.95 14.04 15.87 14.3 13.7 15.62 14.38 14.47 13.63 15.24 14.87 14.66 14.62 15.24 15.57 13.25 16.09 14.1 14.29 13.96 B1WBY7 Erlin1 1 242.9211481 293939 - 242.9211481 242.956472 er lipid raft-associated 1 None QALQKDLNTMAPGLTIQAVR None 611604 4716 17.71 15.95 18.37 17.61 16.91 16.37 17.4 17.53 17.85 17.69 18.19 17.15 18.25 18.4 17.47 16.16 16.96 17.9 18.05 16.71 17.35 17.89 17.57 16.79 17.73 16.76 16.7 17.43 19.32 17.82 18.18 D3Z863 Cwf19l1 1 242.9977271 365465 - 242.9977271 243.020961 cwf19-like 1, cell cycle control (s. pombe) None EKQGRKRSSTGRDNKPPHAK None None None 16.38 15.64 16.97 16.02 16.96 16.2 16.9 15.79 17.04 15.33 16.06 17.16 16.36 16.86 16.25 16.5 16.68 15.55 16.55 18.05 18.24 16.85 16.7 15.79 17.35 16.53 16.83 16.82 16.93 17.12 18.08 Q32WR5 Bloc1s2 1 243.0245651 293938 - 243.0245651 243.031672 biogenesis of lysosome-related organelles complex-1 subunit 2 None LTGELTATSEDYKLLENMNK None 609768 45479 17.22 18.33 17.68 17.17 16.74 17.45 18.36 16.36 17.65 18.44 17.4 17.38 16.43 18.18 16.56 17.06 18.04 16.72 16.27 18.7 17.08 17.49 17.43 16.96 16.31 16.7 16.19 17.45 17.08 16.8 17.15 B2RYS8 Ndufb8 1 243.4086581 293991 - 243.4086581 243.413751 nadh dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8 None VEDYEPYPDDGMGYGDYPMLPNR None 602140 3668 19.42 18.11 17.57 17.99 18.83 18.52 18.77 17.17 17.48 18.77 17.65 18.73 17.46 18.77 18.09 19.56 18.36 18.43 19.25 17.23 17.88 17.75 18.6 17.11 19.88 18.27 18.15 18.16 19.22 18.85 17.74 B0BNG5 Hif1an 1 243.4192051 309434 + 243.4192051 243.431443 hif1an protein None GEAREEAEAPGPAWDESQLR None None None 15.84 13.12 15.12 14.03 15.39 16.06 14.47 14.49 16.36 14.04 16.09 14.88 15.95 15.97 15.46 14.94 14.96 16.17 14.93 16.08 16.3 15.81 15.79 15.76 14.89 15.64 14.61 15.51 16.08 15.79 15.76 D4A6G2 Sema4g 1 243.8538551 361764 + 243.8538551 243.865341 sema domain, immunoglobulin domain (ig), transmembrane domain (tm) and short cytoplasmic domain, (semaphorin) 4g None RILEKRKHTQLVEQLDESSV None None 22682 15.51 17.65 16.31 16.77 16.86 16.51 15.61 16.69 16.67 15.87 15.35 15.77 15.29 15.48 16.6 16.53 15.69 15.42 15.45 17.61 14.96 15.21 15.38 16.35 16.55 16.0 17.18 16.21 15.22 15.93 16.31 D3ZXF8 Mrpl43 1 243.8674481 309440 - 243.8674481 243.868455 mitochondrial ribosomal protein l43 None EEITSLVQKLADQSGLDVIR None 611848 41847 17.14 17.2 15.39 17.09 17.3 16.44 14.88 17.16 15.8 15.69 15.81 17.27 16.08 15.71 17.22 18.01 15.98 15.89 16.96 16.08 15.03 15.98 15.73 17.14 17.87 17.53 17.44 16.82 16.96 16.07 17.93 Q3LUD4 Lzts2 1 243.8800051 365468 + 243.8800051 243.888517 leucine zipper putative tumor suppressor 2 None EAEQLREKARHLDAEAAGLR None None 15690 20.4 18.28 19.05 21.21 20.34 19.21 18.94 20.51 19.73 20.03 20.09 19.6 20.34 20.3 20.23 19.05 19.88 20.46 18.7 20.14 19.02 18.87 20.34 21.33 19.86 21.37 19.66 19.19 20.31 20.37 20.25 G3V804 Sfxn3 1 243.9087141 65042 + 243.9087141 243.917064 sidoreflexin None RLGHSVTAAKQGIFQVVVSR None None 23394 20.91 21.59 21.84 20.92 19.65 19.67 20.6 21.34 20.89 20.81 19.24 19.97 20.67 20.76 21.0 19.87 19.94 21.58 21.43 19.51 21.81 20.4 19.89 20.32 20.56 21.23 21.72 21.62 19.72 20.52 21.5 Q9JHY2 Sfxn3 1 243.9087141 65042 + 243.9087141 243.917064 sideroflexin-3 None GRARHFFTVTDPRNLLLSGK None None 23394 20.73 22.34 21.86 20.85 19.63 19.68 20.59 21.09 20.87 20.86 19.19 19.98 20.29 20.94 20.87 19.85 19.92 21.66 21.44 19.5 21.9 20.52 19.72 20.38 20.56 21.26 21.79 21.54 19.66 20.29 21.05 Q6AYM4 Dpcd 1 244.4087341 294004 + 244.4087341 244.42623 protein dpcd None RMVHYLFPDGKEMAEEYDEK None None None 16.33 15.94 15.98 16.25 14.91 16.39 17.12 15.39 15.37 16.33 15.26 15.1 15.6 16.06 16.38 15.92 16.81 15.73 16.01 15.23 15.58 16.97 16.13 16.24 16.99 17.59 15.88 16.34 14.48 16.4 14.9 A0A0H2UI10 Oga 1 244.5989851 154968 - 244.5989851 244.63381 protein o-glcnacase None PDDKRILEFYSKLGCFEIAK None 604039 8154 20.42 19.4 19.92 20.28 18.16 20.31 19.79 19.47 18.91 18.87 19.3 20.21 20.05 18.77 19.38 19.46 18.75 20.81 20.31 18.3 19.62 20.33 19.18 18.25 18.95 19.46 19.86 18.54 20.41 19.55 17.93 Q8VIJ5 Oga 1 244.5989851 154968 - 244.5989851 244.63381 protein o-glcnacase None EMYDDGVGLPFQSQPDLIGDK None 604039 8154 20.32 19.3 19.88 20.18 18.06 20.16 19.69 19.38 18.74 18.72 19.21 20.04 19.95 18.67 19.28 19.36 18.65 20.72 20.22 18.2 19.52 20.24 19.08 18.15 18.99 19.39 19.76 18.44 20.31 19.45 17.84 D3ZZE3 Armh3 1 244.6669841 103689959 - 244.6669841 244.848827 armadillo-like helical domain-containing 3 None LSIVDDEATLNGMGLVITQALSEYNR None None None 16.84 16.13 17.5 17.15 15.24 16.93 15.71 17.31 15.12 15.15 15.33 17.04 16.51 15.03 16.69 14.66 14.89 17.05 16.84 14.85 16.26 16.21 14.85 15.23 15.63 15.39 15.55 15.58 17.89 16.6 15.35 P41777 Nolc1 1 244.9213781 64896 + 244.9213781 244.932088 nucleolar and coiled-body phosphoprotein 1 None SVPPPSVSLSKKSVGAQSPK None None 68818 18.9 17.1 19.28 18.66 18.03 18.06 17.63 17.89 19.02 17.7 17.16 18.67 18.98 18.73 18.27 17.34 18.26 18.11 18.47 19.54 20.04 19.06 18.61 18.72 18.5 19.09 19.39 19.59 17.3 19.03 19.22 F1M8X9 Gbf1 1 245.0185011 309451 + 245.0185011 245.147101 golgi brefeldin a-resistant guanine nucleotide exchange factor 1 None HSADARGGSPSALWEITWER None 603698 37897 17.39 14.54 17.38 17.69 16.09 16.49 17.15 16.7 16.51 16.16 17.99 16.33 17.2 16.78 17.32 16.38 17.0 17.07 17.34 15.39 17.31 17.47 17.17 16.49 17.77 16.14 17.53 17.26 15.84 17.53 17.39 Q5U2Z4 Nfkb2 1 245.1669511 309452 + 245.1669511 245.173204 nuclear factor kappa b subunit 2 RGD1307189 None None None None 15.63 16.17 16.95 16.36 16.49 16.18 15.25 15.8 17.13 14.99 15.95 16.89 16.55 17.07 17.63 16.1 15.79 17.18 15.15 16.89 17.64 16.38 16.4 17.43 16.93 16.54 17.39 15.43 16.73 16.64 17.5 G3V8J5 Psd 1 245.173281 171381 - 245.173281 245.188131 ph and sec7 domain-containing protein 1 None YSSIKNEKLQWAIDEEELRR None 602327 31115 18.05 17.68 17.61 17.91 17.26 18.51 17.55 17.2 18.11 17.56 17.97 18.35 17.84 18.21 17.75 18.19 18.53 17.9 18.56 16.26 18.85 17.78 18.33 18.5 17.54 18.11 17.87 18.01 17.53 16.84 17.48 Q9ESQ7 Psd 1 245.173281 171381 - 245.173281 245.188131 ph and sec7 domain-containing protein 1 None LYSSIKNEKLQWAIDEEELR None 602327 31115 18.07 18.14 17.59 17.92 17.33 18.45 17.56 17.25 18.16 17.65 17.88 18.38 17.78 18.19 17.93 18.3 18.16 18.06 18.77 16.22 18.81 17.5 18.25 18.49 17.46 18.2 17.89 18.01 17.56 16.78 17.18 P85515 Actr1a 1 245.2378251 294010 - 245.2378251 245.256493 alpha-centractin None LDTFKKMWVSKKEYEEDGAR None None 21173 20.92 19.08 19.17 21.09 20.47 19.79 20.31 20.83 19.14 19.26 19.62 20.41 20.74 19.9 19.05 20.69 20.41 20.2 19.75 21.44 18.23 20.32 19.91 18.6 21.39 21.3 19.98 20.71 21.24 19.97 21.4 P37996 Arl3 1 245.4006621 64664 - 245.4006621 245.446679 adp-ribosylation factor-like protein 3 None KSAPDQEVRILLLGLDNAGK None 604695 2425 20.31 20.59 20.9 20.08 20.23 18.88 20.63 19.98 18.98 19.36 19.87 19.0 19.5 18.79 19.46 20.43 19.49 19.84 19.55 19.62 18.77 19.9 19.29 19.61 20.5 19.54 19.86 20.08 18.01 19.43 20.29 D3ZLX2 Borcs7 1 245.5643481 294012 + 245.5643481 245.578182 bloc-1-related complex subunit 7 None ARNMVLQEDAILHSEDSLRK None None 16941 17.61 17.83 18.13 16.97 17.79 16.9 17.23 16.13 16.43 16.51 17.51 16.0 15.92 17.76 16.35 16.77 17.8 16.2 15.93 18.34 17.17 16.27 16.94 17.14 18.36 16.64 16.63 16.9 16.42 17.15 16.46 G3V8P2 As3mt 1 245.596141 140925 + 245.596141 245.627859 arsenic (+3 oxidation state) methyltransferase, isoform cra_a None DLGSGSGRDCYVLSQLVGQK None 611806 10754 17.45 18.15 16.83 17.75 17.83 17.23 17.75 18.45 16.37 16.96 17.06 17.83 17.06 16.95 17.29 16.88 16.1 18.74 17.94 18.13 18.02 17.98 16.5 16.75 19.01 18.92 17.87 17.23 17.96 17.91 17.41 Q8VHT6 As3mt 1 245.596141 140925 + 245.596141 245.627859 arsenite methyltransferase None LWGECLGGALYWKDLAVIAK None 611806 10754 17.94 17.75 17.2 17.66 17.64 17.92 17.86 18.32 15.78 17.85 16.93 17.94 17.34 17.5 17.34 16.12 15.97 18.72 17.84 17.84 17.93 17.93 16.17 16.55 17.98 18.29 17.66 17.22 17.81 18.43 16.97 Q5U2P1 Cnnm2 1 245.6437691 294014 + 245.6437691 245.763286 metal transporter cnnm2 None ETTWIYHDGEDTKMIVGEEK None 607803 9761 17.94 15.63 17.93 17.33 17.3 17.82 17.91 16.91 17.19 17.7 17.97 18.93 18.23 18.9 17.96 16.49 18.22 17.01 18.48 16.25 18.48 18.0 17.87 16.22 17.7 16.97 17.58 18.66 18.04 18.49 18.23 D3ZMY7 Nt5c2 1 245.7734081 100363253 - 245.7734081 245.89685 5'-nucleotidase, cytosolic ii None WRTFLVIPELAQELHVWTDK None None None 17.89 16.18 19.17 17.49 17.26 18.87 17.78 18.97 17.78 17.21 18.22 18.59 18.64 17.63 18.48 16.62 16.28 19.13 18.53 18.15 18.84 18.82 17.6 17.68 16.68 17.99 18.39 17.31 19.02 19.62 18.42 G3V8Q2 Ina 1 245.8955581 24503 + 245.8955581 245.908372 alpha-internexin None EYQDLLNVKMALDIEIAAYR None None 10433 23.42 24.49 22.81 22.67 23.97 23.54 22.87 23.76 21.72 22.83 23.11 22.08 21.75 22.35 22.78 23.27 22.86 22.46 22.43 23.45 21.49 21.93 22.87 23.46 23.93 22.62 22.35 23.1 22.1 22.56 22.39 P23565 Ina 1 245.8955581 24503 + 245.8955581 245.908372 alpha-internexin None LNDRFAVFIEKVHQLETQNR None None 10433 23.75 24.15 22.86 22.71 23.96 23.53 22.87 23.81 21.73 22.75 23.15 22.12 21.88 22.31 22.79 23.29 22.88 22.45 22.42 23.45 21.47 21.91 22.7 23.46 23.92 22.55 22.35 23.09 22.09 22.8 22.22 D3ZNI3 Pdcd11 1 245.9808811 309458 + 245.9808811 246.021999 programmed cell death 11 None VKNSKKKGSTVNTGQLVDVK None 612333 74968 14.71 13.31 15.77 14.98 14.8 13.85 15.15 14.45 14.86 15.34 16.36 14.6 14.78 15.39 15.72 14.84 15.21 15.19 14.72 13.38 15.73 14.84 15.61 14.83 14.7 15.19 14.11 15.21 16.23 15.8 15.08 A0A0G2JX92 Sh3pxd2a 1 246.1603741 309460 - 246.1603741 246.359452 sh3 and px domains 2a None WWYVQIGEKEGWAPASYIDK None None None 17.09 15.16 16.21 16.74 16.49 16.82 16.08 16.18 16.76 16.13 16.95 16.66 16.55 17.22 14.96 17.3 16.92 16.93 17.54 16.02 16.78 16.37 17.13 17.04 16.8 17.13 16.79 17.36 16.11 16.22 16.75 A0A0H2UHR9 Stn1 1 246.3955841 294025 - 246.3955841 246.429569 cst complex subunit stn1 Obfc1 None None None None 15.96 15.41 17.61 15.44 16.45 16.65 17.91 16.0 16.45 15.62 18.0 16.3 17.18 17.47 16.35 16.0 15.77 17.72 16.62 16.5 17.61 16.77 16.6 16.96 16.6 15.58 16.83 16.02 15.28 17.37 17.83 Q6AYD2 Stn1 1 246.3955841 294025 - 246.3955841 246.429569 cst complex subunit stn1 None CSDQVELKNDAASDIHSVFK None 613128 11788 15.95 15.4 17.6 15.43 16.44 16.63 17.9 15.99 16.44 15.61 17.99 16.29 17.17 17.46 17.89 15.99 16.86 15.95 16.74 15.67 17.6 16.75 16.58 16.95 16.59 15.56 16.81 16.01 15.27 17.36 17.82 G3V7I8 Slk 1 246.4737361 54308 + 246.4737361 246.526718 non-specific serine/threonine protein kinase None TLTEKATEGPEAHGAEEEPR None None 22515 19.62 18.9 19.29 19.18 19.79 19.51 20.36 19.05 21.0 19.5 19.7 19.39 19.8 20.7 18.53 20.26 21.02 19.37 20.03 19.38 20.16 19.46 20.26 20.21 19.69 20.14 18.93 20.75 18.37 19.55 20.49 O08815 Slk 1 246.4737361 54308 + 246.4737361 246.526718 ste20-like serine/threonine-protein kinase None MFKKSLRINSTATPDQDREK None None 22515 19.57 19.44 19.24 19.15 19.77 19.4 20.34 19.1 20.96 19.65 19.65 19.28 19.63 20.71 18.57 20.28 21.01 19.32 19.99 19.45 20.14 19.49 20.17 20.32 19.71 20.26 19.03 20.72 18.27 19.26 20.54 Q6TXG9 Sfr1 1 246.5970451 294030 + 246.5970451 246.62325 swi5-dependent recombination dna repair protein 1 homolog None DEDEKLTLTELIDYYGIDDK None None None 17.03 16.1 17.27 17.1 17.52 16.17 17.56 16.37 17.79 17.03 17.07 16.17 17.1 18.21 16.29 16.99 17.59 16.61 16.5 18.83 18.39 17.01 17.5 17.94 18.2 17.72 16.5 17.79 16.29 17.46 18.67 Q6AXR6 Gsto1 1 246.7212251 114846 + 246.7212251 246.731228 glutathione-dependent dehydroascorbate reductase None ARSLGKGSAPPGPVPEGQIR None 605482 37971 21.97 19.32 21.05 20.11 21.62 21.51 21.2 22.06 20.86 20.14 19.68 21.69 21.38 19.95 20.21 21.33 19.51 22.21 21.54 21.0 19.97 21.07 20.95 20.36 20.76 21.21 21.13 20.21 21.4 21.42 21.44 Q9Z339 Gsto1 1 246.7212251 114846 + 246.7212251 246.731228 glutathione s-transferase omega-1 None LWMATMQEDPVASSHFIDAK None 605482 37971 21.78 19.22 20.74 19.15 20.97 21.97 20.8 21.46 20.57 19.87 19.47 21.57 21.17 19.99 20.06 20.87 19.24 21.98 21.34 20.72 20.47 21.16 20.7 20.06 20.52 20.86 21.01 20.13 21.12 21.2 21.14 D4A2I9 Sorcs3 1 247.3040491 294043 + 247.3040491 247.734027 sortilin-related vps10 domain-containing receptor 3 None GSVTESSLWRSVDYGATYEK None 606285 8986 16.95 17.47 17.05 17.1 16.37 17.37 14.93 16.02 16.93 16.79 15.85 15.32 15.45 16.05 16.07 15.36 15.2 16.37 17.32 15.98 16.78 16.33 15.64 17.18 15.95 16.77 16.5 16.4 16.67 15.96 15.76 F1LUZ4 Sorcs1 1 249.088191 309533 - 249.088191 249.594279 sortilin-related vps10 domain-containing receptor 1 None FYWSVLGSNKEPDLVHLEAR None None None 17.9 15.65 16.57 17.39 16.19 15.97 16.55 16.21 16.67 17.42 16.93 16.04 17.05 16.87 16.1 16.4 17.27 16.53 17.56 16.26 16.77 17.15 16.92 17.3 16.08 17.11 15.63 15.94 17.26 16.75 15.86 A0A0G2JV31 Xpnpep1 1 252.0013631 170751 - 252.0013631 252.051594 x-prolyl aminopeptidase (aminopeptidase p) 1, soluble, isoform cra_a None VPKGGVTEISAADKAEEFRR None 602443 6424 20.39 21.98 21.37 20.04 19.72 21.08 20.07 19.77 19.98 19.39 20.63 19.46 19.62 19.1 19.2 19.73 19.05 21.14 20.9 20.3 21.43 20.9 19.65 20.99 19.87 19.37 20.69 19.41 19.4 19.84 19.69 O54975 Xpnpep1 1 252.0013631 170751 - 252.0013631 252.051594 xaa-pro aminopeptidase 1 None VDALTDKECDWLNSYHQTCR None 602443 6424 20.45 21.97 21.38 20.04 19.72 21.05 20.07 19.77 19.9 19.27 20.65 19.46 19.66 19.1 19.2 19.73 19.05 21.14 20.9 20.3 21.43 20.9 19.64 20.99 19.98 19.44 20.69 19.41 19.4 19.84 19.67 D3ZCH7 Add3 1 252.1473871 25230 + 252.1473871 252.255126 adducin 3 (gamma), isoform cra_b None AFTHGVAMTGGGGVNMGSHQK None 601568 40893 19.98 18.87 19.83 19.17 19.85 19.82 20.24 19.42 20.1 19.49 19.07 20.8 20.48 21.0 19.61 20.09 20.64 18.81 20.21 20.85 20.71 19.13 19.99 19.24 20.39 20.09 20.72 20.01 19.46 20.59 20.93 G3V9D7 Add3 1 252.1473871 25230 + 252.1473871 252.255126 adducin 3 (gamma), isoform cra_a None SFTSVDVPVIVNGKDEMHDVEDELAQR None 601568 40893 19.94 18.69 19.76 19.09 19.76 19.78 20.18 19.32 20.11 19.44 19.04 20.76 20.48 20.9 19.59 20.19 20.6 18.78 20.18 20.82 20.71 19.18 19.95 19.23 20.35 20.08 20.68 20.02 19.4 20.54 20.94 Q62847 Add3 1 252.1473871 25230 + 252.1473871 252.255126 gamma-adducin None KVGEIEFEGLMRTLDNLGYR None 601568 40893 20.07 18.47 20.23 19.0 19.52 19.95 20.2 19.04 20.39 19.55 19.35 20.65 20.39 20.91 19.61 20.07 20.73 18.77 20.19 20.69 20.96 19.68 20.0 19.14 20.05 19.52 20.51 20.12 19.51 20.64 20.91 Q4QQU6 Smndc1 1 252.389681 287768 - 252.389681 252.400749 survival of motor neuron-related-splicing factor 30 None ENEDLLKLKKDLQEVIELTK None None 4290 16.59 14.7 17.35 16.44 16.7 16.16 15.6 16.64 17.16 15.71 15.64 17.16 17.07 16.83 16.84 15.65 16.17 16.5 16.92 17.78 17.87 16.9 16.96 16.15 17.39 16.2 17.95 16.43 16.88 17.28 17.63 D4A1B9 Smc3 1 252.6014181 29486 + 252.6014181 252.64452 structural maintenance of chromosomes protein None YYIVKQGKINQMATAPDSQR None 606062 3974 17.74 16.7 18.05 17.81 18.2 17.72 17.6 18.13 18.28 16.57 17.24 18.33 18.18 17.92 19.49 17.18 17.66 17.55 17.99 17.26 19.27 17.87 17.85 18.22 18.92 18.03 19.24 18.17 16.73 18.46 19.5 P97690 Smc3 1 252.6014181 29486 + 252.6014181 252.64452 structural maintenance of chromosomes protein 3 None LELQKDVRKAEEELGELEAK None 606062 3974 17.66 16.59 18.01 17.71 18.09 17.68 17.41 18.04 18.23 16.49 17.18 18.29 18.09 17.88 19.35 17.08 17.63 17.41 18.0 17.26 19.2 17.74 17.75 18.18 18.72 17.86 19.13 18.06 16.7 18.38 19.4 Q9JID1 Pdcd4 1 252.9213581 64031 + 252.9213581 252.944275 programmed cell death protein 4 None TLTPIIQEYFEHGDTNEVAEMLR None 608610 7879 16.31 15.34 17.8 17.05 16.62 16.76 18.28 16.48 16.14 16.17 17.69 15.93 17.02 17.49 16.74 15.64 17.39 15.29 17.76 17.01 18.16 17.15 16.48 16.85 18.23 16.72 16.59 16.95 15.67 17.8 18.02 Q6AYI5 Shoc2 1 252.9846511 309548 + 252.9846511 253.046596 leucine-rich repeat protein shoc-2 None LPHGLGNLRKLRELDLEENK None 602775 7219 17.11 15.04 16.19 16.92 17.11 16.05 16.51 17.69 15.79 15.42 16.21 16.56 17.91 15.73 16.79 17.41 15.85 17.45 17.17 15.61 15.45 16.99 16.68 16.86 17.79 18.04 17.17 17.47 15.65 16.4 17.65 P22909 Adra2a 1 253.0614811 25083 + 253.0614811 253.064278 alpha-2a adrenergic receptor None RRGPGAAGPGASGSGQGEER None 104210 47944 15.16 12.65 15.45 15.04 14.93 14.2 14.8 14.31 14.08 14.52 15.06 15.04 15.29 15.33 15.72 15.57 14.6 14.8 14.18 14.13 13.34 15.09 15.18 15.52 14.46 14.77 15.62 14.85 12.89 15.08 15.12 A0A0G2K2U7 Gpam 1 254.109321 29653 - 254.109321 254.170561 glycerol-3-phosphate acyltransferase 1 None IHKLGGFFIRRRLDETPDGR None 602395 7343 15.43 15.49 14.74 15.81 15.99 13.82 15.09 15.27 14.96 15.6 14.4 15.65 14.48 14.61 16.11 16.23 15.08 15.03 15.99 13.6 14.3 15.24 14.63 15.43 15.7 15.43 15.62 15.57 14.46 15.01 15.67 P97564 Gpam 1 254.109321 29653 - 254.109321 254.170561 glycerol-3-phosphate acyltransferase 1 None IHKLGGFFIRRRLDETPDGR None 602395 7343 15.39 15.44 14.69 15.76 15.95 13.77 15.04 15.23 14.91 15.55 14.35 15.6 14.43 14.56 15.42 16.18 15.27 15.19 15.97 13.53 14.25 15.19 14.58 15.38 15.66 15.38 15.57 15.52 14.42 14.97 15.62 O88813 Acsl5 1 254.2924071 94340 + 254.2924071 254.336604 long-chain-fatty-acid--coa ligase 5 None LTPGLKTVILMDPFDDDLMK None 605677 69208 16.97 19.15 16.55 16.81 17.48 17.95 17.73 16.22 16.73 18.32 17.14 17.54 16.53 17.07 18.44 18.4 17.16 17.63 17.37 15.62 16.92 17.24 16.99 17.18 17.11 17.72 17.08 17.26 17.06 16.74 16.68 F1M938 Vti1a 1 254.3563961 65277 + 254.3563961 254.538548 vesicle transport through interaction with t-snares homolog 1a None SRVPRLPPDEKKQMVANVEK None None 39963 18.39 17.04 17.85 17.57 17.03 17.73 17.5 16.25 18.94 17.48 17.24 17.06 17.93 19.04 17.28 17.89 18.92 17.13 16.83 18.64 18.53 17.89 17.61 18.19 18.57 18.08 16.78 18.3 18.38 17.3 18.84 Q9JI51 Vti1a 1 254.3563961 65277 + 254.3563961 254.538548 vesicle transport through interaction with t-snares homolog 1a None RLEAGYQIAVETEQIGQEMLENLSHDR None None 39963 18.23 16.15 17.86 17.82 17.36 17.23 17.7 16.28 18.68 17.83 17.27 17.11 18.18 18.81 17.13 18.3 18.83 17.33 16.82 18.63 18.63 17.63 18.01 18.07 18.85 18.05 16.48 18.37 18.42 17.75 18.51 O88550 Casp7 1 255.4373151 64026 + 255.4373151 255.476729 caspase 7, isoform cra_c None KATGMDVRNGTDKDAEALFK None 601761 11168 16.29 14.4 15.95 16.83 16.73 14.71 16.2 16.05 15.4 18.16 15.85 15.13 15.32 15.37 15.07 15.95 15.44 16.71 16.36 15.19 15.4 15.05 14.96 16.43 15.74 15.42 14.23 16.23 15.97 16.2 16.74 D3ZLM5 Nhlrc2 1 255.5897431 307986 + 255.5897431 255.650448 nhl repeat containing 2 None SAPNISLPPVTVHPGQALQLGLR None None 12048 18.4 18.99 18.78 18.61 18.39 18.22 16.86 18.92 17.04 16.18 18.8 18.81 17.49 15.96 18.3 16.91 16.46 19.04 18.54 16.93 17.87 17.91 17.6 18.54 17.67 17.12 18.81 16.65 18.25 17.99 17.1 A0A0G2K8K1 Ccdc186 1 255.8412961 361773 - 255.8412961 255.863504 coiled-coil domain-containing 186 None SYVLREESGTLSSEASDFNK None None 9963 17.27 14.48 16.45 16.27 16.96 16.67 16.01 15.57 16.46 14.77 16.52 17.55 16.61 16.33 16.88 16.06 15.9 16.18 17.3 15.95 17.0 16.72 16.78 16.74 16.84 17.3 15.71 16.32 17.9 16.89 17.18 M0R484 Afap1l2 1 255.9642391 292130 - 255.9642391 256.06082 actin filament-associated protein 1-like 2 None YIYMNKVAVNKEQNPASPDK None 612420 13057 14.6 12.73 15.85 15.28 15.23 13.89 15.3 14.83 15.86 13.79 14.16 14.42 15.2 14.83 15.82 15.09 13.92 13.48 14.94 15.51 15.58 13.8 15.08 14.55 15.16 14.3 13.56 16.07 14.84 15.53 15.54 A0A0G2JW01 Ablim1 1 256.0842921 - 256.0842921 256.275711 actin-binding LIM protein 1 None FYTSGYEDKQDRQSLGESPR None None None 18.45 17.47 18.07 18.21 19.2 18.27 18.6 17.97 18.8 16.79 18.48 18.88 18.66 18.88 19.19 18.36 16.98 18.22 19.22 18.78 19.16 17.84 18.39 18.36 19.55 18.42 18.69 19.74 17.24 18.79 19.77 F1LWK7 Ablim1 1 256.0842921 - 256.0842921 256.275711 actin-binding LIM protein 1 None DYQGLFGVKCEACHQFITGK None None None 18.22 17.22 18.59 17.99 19.1 18.58 19.23 18.85 19.84 18.3 17.86 19.32 19.5 19.2 20.34 18.9 18.13 18.41 18.44 19.16 19.88 17.93 19.04 18.65 18.73 19.01 19.0 20.11 17.39 19.27 19.65 D4A3I5 Fam160b1 1 256.4179081 361774 + 256.4179081 256.44143 family with sequence similarity 160, member b1 None IVCAKLKQDPYLVNFFLENK None None 28133 16.76 14.91 16.85 16.9 15.97 17.41 16.5 15.91 17.97 16.35 17.74 15.96 17.33 16.67 17.19 16.5 17.27 16.25 17.35 15.4 18.45 16.13 17.03 16.51 15.26 17.09 16.74 17.17 16.92 16.93 17.66 F1M3T8 Atrnl1 1 256.6710611 307992 + 256.6710611 256.925723 attractin-like 1 None NLASLTTSKEVGFVLDEIQK None 612869 45809 16.66 14.72 15.47 16.59 16.59 16.39 15.7 15.43 17.26 16.33 17.18 16.83 16.68 16.5 16.91 16.34 15.76 16.81 17.17 15.58 17.3 16.67 17.05 17.02 16.07 16.42 15.62 16.22 17.43 16.63 16.4 Q62997 Gfra1 1 257.3202231 25454 - 257.3202231 257.550783 gdnf family receptor alpha-1 GDNFR; RET1L; RETL1; TRNR1; GDNFRA; GFRalpha-1; GFR-ALPHA-1 NYICRSRLADFFTNCQPESR None 601496 3855 15.03 14.6 15.76 16.02 15.25 16.91 16.77 15.68 16.06 16.76 15.66 16.57 17.01 15.67 16.35 16.11 15.69 16.28 15.31 17.0 16.05 16.54 16.98 15.77 14.54 15.8 15.31 15.54 16.34 15.84 15.65 D3ZC55 Hspa12a 1 257.9356451 307997 - 257.9356451 258.005889 heat shock 70kda protein 12a, isoform cra_a None EAGGGDAGPRETAPTSAYSS None 610701 18422 21.99 22.51 19.65 20.9 21.53 21.51 21.34 21.58 20.58 22.03 21.82 20.88 20.95 20.8 20.93 21.63 22.1 20.74 21.57 19.83 19.77 20.47 20.83 21.53 21.02 21.36 21.12 20.55 20.71 20.74 19.41 A0MZ67 Shtn1 1 258.1232431 292139 - 258.1232431 258.225917 shootin-1 None QCQKQIKELRDQIVSVQEEK None None 41249 18.09 17.93 18.81 18.37 17.34 18.12 18.19 17.68 18.32 18.86 17.69 17.59 18.59 17.66 17.95 17.97 18.45 18.78 17.11 18.81 18.98 19.23 17.92 18.6 17.88 18.76 19.36 18.18 16.69 17.99 18.81 D3ZXY2 Pdzd8 1 258.4492191 308000 - 258.4492191 258.506828 pdz domain containing 8 None DVRVQTELKEETQPLSHSPK None None 14879 18.61 16.34 17.32 17.54 18.42 16.92 16.7 17.39 16.95 15.94 18.76 16.5 17.13 17.09 17.37 17.01 17.17 16.93 18.07 16.02 16.16 17.28 17.01 17.89 18.47 16.93 16.88 16.92 17.37 18.16 16.61 D3ZD48 Rab11fip2 1 259.05761 308003 - 259.05761 259.093883 rab11 family interacting protein 2 (class i), isoform cra_a None SDDLRKIPDSNPFDATAGYR None 608599 8937 16.86 17.3 16.9 17.48 16.12 16.44 17.31 16.37 17.67 17.66 17.35 17.6 17.89 17.34 18.0 17.28 17.45 17.37 17.8 15.79 17.86 17.77 17.28 17.57 16.5 17.97 17.73 17.12 16.46 16.28 16.83 Q1JU68 Eif3a 1 259.9027821 292148 - 259.9027821 259.932976 eukaryotic translation initiation factor 3 subunit a None TREDAPIGPHLQSMPSEQIR None 602039 2779 20.86 20.68 19.84 20.44 20.45 18.65 18.89 20.92 19.87 20.0 19.49 19.21 19.33 20.56 21.55 19.99 20.42 19.41 19.69 18.99 19.54 18.82 19.05 21.08 21.08 21.18 20.71 20.6 18.92 19.32 21.08 F1LNS2 Dennd10 1 259.9509811 308009 + 259.9509811 259.97345 denn domain-containing 10 None GKLHKEIGQLIVQSAEDPEK None None 10217 17.25 15.21 17.75 17.36 16.4 17.94 17.98 16.34 16.57 16.02 18.14 16.78 17.07 17.03 18.58 16.71 16.33 16.84 17.36 15.79 17.62 17.44 17.27 16.35 17.74 16.28 16.95 17.51 15.76 18.15 17.53 G3V7I0 Prdx3 1 260.0016421 64371 - 260.0016421 260.014128 peroxiredoxin 3 None IIDPNGVIKHLSVNDLPVGR None 604769 4944 22.72 20.35 22.49 21.66 21.9 21.61 21.66 22.52 20.7 22.04 22.77 20.34 21.1 21.26 21.32 20.79 20.9 22.43 21.36 22.72 22.19 22.27 22.67 21.25 22.88 21.74 20.91 22.0 22.73 22.24 21.79 Q9Z0V6 Prdx3 1 260.0016421 64371 - 260.0016421 260.014128 thioredoxin-dependent peroxide reductase None IIDPNGVIKHLSVNDLPVGR None 604769 4944 22.05 19.67 21.89 21.09 21.28 20.87 21.11 21.9 20.07 21.34 22.14 19.75 20.49 20.65 20.58 20.29 20.32 21.88 20.81 22.04 21.52 21.53 21.94 20.54 22.33 21.11 20.26 21.44 22.12 21.74 21.15 Q62833 Grk5 1 260.0282421 59075 + 260.0282421 260.218701 g protein-coupled receptor kinase 5 None PKSPVFIAQVGQDLVSQTEK None 600870 3879 16.64 15.36 17.05 15.78 15.53 15.57 16.65 16.21 16.04 15.17 16.87 15.82 15.79 16.21 16.27 14.94 15.75 16.32 16.21 15.1 17.1 16.17 16.64 15.72 15.81 15.0 15.65 16.7 15.01 16.81 15.13 Q9JJ22 Erap1 2 3.9319361 80897 + 3.9319361 3.970734 endoplasmic reticulum aminopeptidase 1 None SVSKMTKSGVKVSVYAVPDK None 606832 56754 18.15 15.47 16.89 16.23 17.86 17.23 17.88 18.48 17.9 16.84 18.85 17.88 17.93 18.06 16.79 15.95 16.38 18.88 18.28 16.95 17.4 17.84 17.7 17.74 16.61 17.58 16.25 17.46 17.99 18.02 18.26 F1LPH1 Cast 2 3.9731181 25403 - 3.9731181 4.082465 calpain inhibitor None None None None 20.0 16.92 17.48 18.24 20.21 19.18 19.4 20.21 19.78 18.65 19.34 20.13 19.58 19.45 17.58 18.14 19.08 20.3 19.35 18.87 18.03 19.08 19.74 18.81 18.0 19.82 17.49 19.28 20.3 19.57 19.05 P27321 Cast 2 3.9731181 25403 - 3.9731181 4.082465 calpastatin None EKKGSDEVTASSAATGTSPR None 114090 7658 20.0 16.92 17.48 18.24 20.21 19.18 19.39 20.21 19.78 18.65 19.34 20.13 19.58 19.45 17.58 18.14 19.09 20.29 19.37 18.86 18.03 19.08 19.74 18.88 18.0 19.82 17.45 19.28 20.29 19.57 19.05 Q9ESH6 Glrx 2 5.3418951 64045 + 5.3418951 5.351679 glutaredoxin-1 None PTCPYCRKTQEILSQLPFKR None None None 17.22 16.88 17.79 17.83 19.2 18.95 17.92 18.51 18.73 18.98 17.97 18.73 19.04 17.83 17.49 18.76 18.66 18.55 17.02 19.43 17.37 17.65 19.12 19.09 16.81 17.76 18.74 17.36 17.83 18.13 18.1 D3ZL50 Ttc37 2 5.6438061 294595 + 5.6438061 5.750592 tetratricopeptide repeat domain 37 None RALQDKKYEDAISHLTEGLK None None 40966 19.08 15.71 18.25 18.9 17.02 18.23 17.82 17.1 16.72 17.21 18.79 16.04 17.16 16.72 19.1 18.08 18.08 16.66 17.35 16.73 17.94 17.55 17.4 17.47 18.81 17.24 18.78 17.6 16.18 17.97 17.33 D3Z8Q9 Mctp1 2 6.0717311 309928 + 6.0717311 6.760873 multiple c2 and transmembrane domain-containing protein 1 Mctp1-ps1; RGD1305199 None None None None 14.48 15.28 14.59 15.06 15.21 14.06 14.83 14.82 15.71 14.9 14.28 15.77 14.75 14.98 15.45 14.64 15.01 14.86 16.13 13.42 15.97 15.1 14.4 15.02 15.51 14.67 15.03 15.53 14.67 14.92 15.24 D4ABL6 Mctp1 2 6.0717311 309928 + 6.0717311 6.760873 multiple c2 and transmembrane domain-containing protein 1 None AVSPSFQARLWKNLQLGVGK None None None 16.32 15.86 17.11 15.99 17.1 16.38 17.31 16.39 18.07 16.9 15.88 17.54 17.72 17.92 17.81 16.47 17.11 16.97 17.86 15.53 18.0 17.28 16.79 17.02 17.7 16.84 17.12 17.75 16.22 17.13 18.34 D3ZYE5 Fam172a 2 7.5538651 294606 + 7.5538651 8.01558 family with sequence similarity 172, member a None ESEPKSFIFMSEDALTNPQK None None 12933 15.87 13.7 15.68 15.21 15.17 16.36 16.41 14.41 15.93 15.21 15.87 15.08 15.87 15.64 16.22 16.45 14.83 15.08 15.68 16.0 15.67 15.55 15.86 14.96 15.71 15.1 16.39 15.49 14.48 16.03 16.11 D4A249 Mblac2 2 11.985921 365627 + 11.985921 12.031098 metallo-beta-lactamase domain-containing 2 None GICHKVSTFAMRSLASLALR None None None 18.16 18.46 17.82 18.66 17.43 18.49 16.7 17.83 16.39 18.26 17.77 18.46 17.87 17.19 18.94 19.17 18.33 16.83 17.1 18.59 17.92 18.1 17.67 18.32 17.06 18.01 17.96 17.72 18.3 17.62 17.95 A0A096MJY4 Mef2c 2 13.9733181 499497 + 13.9733181 14.136064 myocyte-specific enhancer factor 2c None TEYNEPHESRTNSDIVETLR None 600662 31087 15.61 14.35 15.26 16.35 14.67 14.4 14.71 14.96 16.13 14.96 15.58 15.32 14.95 15.79 14.62 15.18 15.67 16.39 15.12 14.87 16.42 15.21 16.17 15.28 15.77 15.28 14.66 15.41 16.6 14.94 15.58 A0A0G2JTC2 Cetn3 2 12.0893071 170895 + 12.0893071 12.101828 centrin 3 None FNEVVTDWILERDPHEEILK None None 74521 16.59 14.52 16.49 15.94 15.69 15.99 16.98 15.01 15.59 16.05 16.89 15.23 15.11 16.21 16.59 16.48 15.02 16.38 15.31 17.0 15.76 16.2 15.67 14.97 15.5 15.77 16.69 16.05 15.66 16.82 16.69 Q9R1A0 Ccnh 2 15.8348341 84389 + 15.8348341 15.855643 cyclin-h None MRNLVKKYEPPRSEEVAILK None 601953 946 14.64 13.84 15.07 15.53 14.92 14.73 15.68 16.98 15.28 13.9 15.63 15.66 16.2 15.4 16.59 14.59 15.24 15.21 15.56 14.83 15.53 16.11 15.9 14.31 17.15 16.09 16.03 15.69 15.24 15.63 16.05 P50904 Rasa1 2 15.8585561 25676 - 15.8585561 15.940176 ras gtpase-activating protein 1 None GVQQHVLKKLLAITELLQQK None 139150 2168 19.11 17.4 18.49 18.95 17.94 18.46 19.3 18.99 18.58 19.53 18.17 17.88 18.82 17.96 19.1 19.28 18.34 19.23 19.32 17.44 18.4 19.0 19.28 18.41 18.71 19.79 19.17 19.45 17.25 18.34 18.55 P80432 Cox7c 2 16.8417761 100188937 - 16.8417761 16.843796 cytochrome c oxidase subunit 7c None RRSHYEEGPGKNLPFSVENK None 603774 81691 21.42 19.09 21.11 20.64 20.12 20.51 20.69 19.36 21.51 21.62 20.93 21.21 21.13 20.33 20.64 20.67 20.56 20.76 21.62 19.82 21.91 21.93 21.21 20.05 20.05 18.95 20.15 20.18 22.44 20.68 21.03 P03994 Hapln1 2 20.6316411 29331 + 20.6316411 20.696382 hyaluronan and proteoglycan link protein 1 None VVFPYFPRLGRYNLNFHEAR None None 1420 18.16 20.27 19.08 19.38 20.43 20.28 18.52 19.61 20.33 19.92 19.33 20.68 20.15 19.6 20.37 21.09 19.78 19.68 18.79 20.12 19.93 18.26 20.62 19.95 18.36 19.7 19.58 19.43 21.16 19.02 19.17 D3Z9N6 Vcan 2 20.7617191 114122 - 20.7617191 20.840039 versican core protein None LQGAHLTSILSHEEQMFVNR None 118661 3228 19.01 18.66 19.25 19.46 21.33 21.26 19.48 20.18 20.41 20.34 19.66 20.91 20.66 19.33 20.4 20.0 19.97 19.89 18.83 21.07 20.21 19.2 20.91 19.68 18.62 19.74 19.55 19.34 21.9 20.23 19.78 D4A8Y6 Vcan 2 20.7617191 114122 - 20.7617191 20.840039 versican core protein None EVPRPGLKKDPYAVDEIQEK None 118661 3228 18.9 18.5 19.16 19.45 21.41 21.01 19.39 19.97 20.25 20.07 19.51 20.85 20.5 19.19 20.39 19.94 19.94 19.53 18.75 20.94 20.06 19.03 20.79 19.5 18.6 19.57 19.39 19.21 21.78 20.2 19.71 Q9ERB4 Vcan 2 20.7617191 114122 - 20.7617191 20.840039 versican core protein (fragments) None ENAKTFGKMKPRYEINSLIR None 118661 3228 19.48 18.64 20.03 19.45 21.59 21.69 19.64 20.48 19.61 19.36 20.67 20.12 20.74 19.58 20.65 19.98 20.14 19.87 19.03 21.23 20.35 19.48 21.07 19.85 20.82 19.56 19.68 19.52 22.09 20.64 20.03 Q5XI44 Xrcc4 2 20.9512011 309995 - 20.9512011 21.197585 x-ray repair complementing defective repair in chinese hamster cells 4 None YMDELRRALVPESGAAGAYK None 194363 2555 16.75 15.22 15.03 15.26 14.64 15.58 16.58 16.25 15.18 15.97 15.94 15.55 16.44 17.43 14.73 15.9 15.7 17.02 15.57 17.08 16.26 16.57 16.14 15.13 16.37 17.43 15.58 15.57 17.0 16.42 16.49 P62268 Rps23 2 22.079341 124323 + 22.079341 22.080909 40s ribosomal protein s23 None PGVRFKVVKVANVSLLALYK None 603683 799 17.16 19.36 16.74 17.81 16.59 17.87 15.8 18.04 17.95 18.46 17.0 16.78 16.67 16.48 18.4 17.7 17.31 17.08 16.94 16.23 16.73 17.36 16.67 17.89 16.11 17.67 17.67 16.47 18.45 16.72 16.88 A0A0G2JVQ1 Ckmt2 2 23.0800591 - 23.0800591 23.094781 creatine kinase None VFADLFDPVIKLRHNGYDPR None None None 17.35 18.64 18.9 18.99 19.3 17.26 18.3 18.78 18.36 20.19 18.04 18.06 19.48 18.74 18.05 19.02 18.16 19.01 19.48 18.7 18.89 19.04 19.49 18.52 19.39 18.8 18.15 18.81 20.44 18.42 18.97 P09605 Ckmt2 2 23.0800591 688698 - 23.0800591 23.094781 creatine kinase s-type S-MtCK; mib-CK None None None None 17.35 18.64 18.51 18.99 19.3 17.35 18.3 18.78 18.48 20.11 17.67 18.49 19.48 18.74 19.0 19.02 17.91 18.85 19.19 18.66 18.89 19.04 19.49 18.52 18.69 19.67 18.15 18.81 20.44 18.42 18.97 Q99JE4 Rasgrf2 2 23.1176321 114513 - 23.1176321 23.360955 ras-specific guanine nucleotide-releasing factor 2 None EREVLMQKYIHLVQIVETEK None 606614 2169 18.36 17.91 18.02 18.82 17.24 19.43 18.05 17.62 18.57 18.53 18.6 18.52 18.93 18.03 18.51 19.19 19.04 18.78 18.75 16.6 18.95 18.07 18.91 18.83 17.68 18.83 18.43 18.5 18.28 18.08 17.53 A0A0G2JW65 Rasgrf2  2 23.2193891 - 23.2193891 23.360955 ras protein specific guanine nucleotide releasing factor 2 None LEDQDTEIERLKSEIVALNK None None None 18.16 17.6 17.83 18.6 17.08 19.28 17.74 17.34 18.34 18.2 18.51 18.38 18.76 17.81 18.0 18.99 18.73 18.64 18.78 16.49 18.74 17.83 18.69 18.62 17.44 18.59 18.31 18.21 18.21 17.99 17.3 D3ZKP1 Ankrd34b 2 23.6513821 499506 + 23.6513821 23.667307 ankyrin repeat domain 34b None RAKMVKYLLENSADPNIQDK None None 18450 16.39 14.1 15.84 15.6 15.78 15.72 16.15 14.79 15.37 15.36 15.56 14.09 14.7 16.12 14.91 14.61 16.17 15.41 15.15 15.45 14.61 16.17 15.61 15.52 16.7 15.71 15.29 14.09 15.7 16.21 15.24 B2RZ92 Fam151b 2 23.6743321 499507 - 23.6743321 23.71043 fam151b protein None CFNKTQVFYDILEPQNYEFK None None 17853 15.91 13.66 16.7 16.54 15.72 16.11 15.42 14.0 16.59 14.82 14.4 15.56 15.68 15.83 16.15 15.86 15.81 14.64 14.73 17.12 16.85 15.21 16.12 15.84 15.82 15.9 17.25 14.64 15.07 16.4 15.89 D4ADF6 Zfyve16 2 23.7133321 499508 - 23.7133321 23.75699 zinc finger fyve-type-containing 16 None DESMRSGILVSDAELDAFLK None None 8826 15.65 15.59 15.96 16.01 15.64 16.16 16.83 15.18 15.51 14.63 16.66 15.75 15.61 16.2 15.51 15.05 16.56 15.48 15.29 16.94 16.79 16.32 15.65 14.97 16.48 15.87 16.55 15.19 15.54 16.62 14.88 D3ZNK1 Mtx3 2 24.0663681 688905 + 24.0663681 24.0742 metaxin None PRGDVPILTTEDSIVSKPEK None None None 18.14 17.16 17.7 17.18 19.02 18.83 18.28 17.2 18.14 17.2 17.92 18.39 18.4 18.5 18.04 17.4 18.01 16.78 17.85 19.07 18.54 17.54 17.68 17.54 18.57 17.23 17.36 17.25 19.86 19.12 19.02 A0A0H2UI35 Homer1 2 24.5434331 29546 + 24.5434331 24.643088 homer protein homolog 1 None REQPIFSTRAHVFQIDPNTK None 604798 3155 20.49 21.23 19.07 20.13 19.77 19.89 19.52 19.73 20.21 20.05 19.8 20.39 19.8 20.43 20.6 20.08 20.11 19.95 20.2 18.41 19.99 19.65 19.98 20.75 19.59 20.18 19.97 20.35 18.88 18.79 19.24 Q9Z214 Homer1 2 24.5434331 29546 + 24.5434331 24.643088 homer protein homolog 1 None EPRAEPAQNALPFSHSAGDR None 604798 3155 20.41 21.15 19.0 20.05 19.69 19.82 19.39 19.65 20.13 19.97 19.73 20.31 19.72 20.36 20.58 20.01 20.05 19.83 20.15 18.32 19.92 19.58 19.91 20.7 19.52 20.1 19.92 20.23 18.86 18.72 19.16 M0R8J3 Jmy 2 24.6749661 683593 - 24.6749661 24.730445 junction mediating and regulatory protein, p53 cofactor None QKEVLRESFTLLPDADPLTR None None None 16.93 17.95 16.84 16.26 16.91 16.9 17.46 16.82 17.26 17.44 15.78 16.59 15.79 17.31 16.5 16.75 16.77 17.31 18.06 15.83 18.23 16.36 16.0 16.39 17.82 16.97 16.84 16.86 16.5 17.14 17.65 P50430 Arsb 2 25.0023621 25227 + 25.0023621 25.162674 arylsulfatase b None RLQYYHEHSVPSYFPPLDPR None 611542 73870 19.27 18.38 17.62 18.57 17.59 17.36 19.1 19.86 17.23 19.63 18.58 17.18 17.74 17.8 17.52 18.38 17.06 18.08 19.6 18.57 17.75 17.8 17.93 17.66 18.22 18.76 17.03 19.01 18.41 17.74 18.56 D4A0X7 Lhfpl2 2 25.3461851 294643 + 25.3461851 25.427954 lhfpl tetraspan subfamily member 2 None AQAEIATSSDKVQEEIEEGK None 609718 4222 14.81 15.18 15.15 14.95 15.55 16.13 16.77 15.58 15.11 17.02 16.53 15.89 16.39 15.7 16.09 15.3 15.96 14.99 17.12 15.68 16.27 16.72 16.83 15.63 15.56 15.55 14.88 16.01 16.1 15.42 15.23 P56603 Scamp1 2 25.4339331 29521 - 25.4339331 25.516629 secretory carrier-associated membrane protein 1 None GLDEYNPFSDSRTPPPGGVK None 606911 37975 20.68 19.18 21.07 19.91 20.39 20.1 19.84 20.38 20.58 21.2 18.86 19.24 20.68 19.9 20.33 20.03 20.07 19.9 20.74 20.46 20.01 21.33 20.5 20.03 20.62 20.87 19.5 21.03 21.59 20.8 21.59 A0A0G2JWD6 Ap3b1 2 25.6000271 309969 + 25.6000271 25.801647 ap-3 complex subunit beta None STAQLIINTEKTVIGSVLLR None 603401 68125 18.97 20.08 19.74 19.23 17.12 19.05 18.92 19.68 18.61 18.68 18.6 18.26 18.76 18.8 19.81 19.61 18.78 19.45 18.85 17.87 18.93 18.95 18.05 19.23 19.85 19.84 19.9 19.16 17.69 19.21 19.41 Q6PEC1 Tbca 2 26.010381 366995 + 26.010381 26.06589 tubulin-specific chaperone a None QEEKIEKMKAEDGENYAIKK None None 3388 20.63 20.19 20.53 19.67 19.61 19.67 20.58 20.7 19.67 20.11 19.41 18.84 20.19 19.52 19.89 19.5 19.33 20.56 19.4 21.58 19.9 20.58 19.49 19.95 20.22 21.32 20.34 19.6 19.48 20.21 20.23 F7ETI3 Wdr41 2 26.2244961 361879 + 26.2244961 26.273836 wd repeat domain 41 None WDCDTGRQIQRVTCFQSTVK None None 23087 16.76 15.71 15.34 16.55 16.23 17.94 17.37 17.05 16.99 16.66 16.04 17.35 18.04 17.01 17.53 16.39 16.74 16.87 17.84 15.66 17.36 16.88 16.72 16.18 16.59 17.98 16.78 16.54 16.77 17.5 17.36 Q76KC5 Pde8b 2 26.2765461 309962 - 26.2765461 26.479418 phosphodiesterase None LPKSDKNRADLLDTINTCIK None 603390 2758 16.62 17.38 15.97 15.83 16.43 16.28 15.38 15.21 15.31 15.17 16.6 15.48 15.13 16.73 15.65 14.84 15.85 15.82 15.97 15.01 16.61 16.32 15.29 16.2 16.19 16.17 15.85 15.61 15.86 15.39 15.69 P0C6P5 Arhgef28 2 29.2638871 361882 - 29.2638871 29.5286 rho guanine nucleotide exchange factor 28 None QRSLPAVFSPGSKEVTELNR None 612790 8078 15.51 16.7 16.11 15.4 15.58 15.93 15.72 16.35 14.76 16.49 15.28 16.12 15.93 15.9 16.22 17.49 16.3 16.2 15.04 14.6 15.03 14.87 15.36 14.68 15.9 15.9 16.88 16.25 15.42 14.76 15.19 F1LW74 Iqgap2 2 26.900411 100360623 - 26.900411 27.169993 iq motif-containing gtpase-activating protein 2 None VTSDYIRENLWSASEDLLLR None None None 17.8 17.17 16.74 16.84 16.81 18.49 15.83 17.03 17.06 17.13 18.08 18.19 17.45 17.02 18.47 18.97 17.8 17.3 17.74 15.83 17.27 16.92 18.05 17.77 17.11 17.74 18.2 17.76 17.41 16.96 16.35 Q9Z2I6 Sv2c 2 27.2326521 29643 - 27.2326521 27.428536 synaptic vesicle glycoprotein 2c None ESPRFLLEVGKHDEAWMILK None None 57152 20.25 19.84 19.53 19.18 19.94 19.02 18.91 19.84 19.55 19.3 20.21 17.3 18.79 18.68 19.8 19.63 19.28 18.73 18.51 20.39 17.69 19.6 18.68 19.12 19.76 18.88 18.49 19.63 19.74 18.54 19.31 A0A0G2K8T5 Sv2c 2 27.2329341 - 27.2329341 27.428479 synaptic vesicle glycoprotein 2c None None None None 18.99 17.0 19.01 18.84 18.65 18.45 17.15 18.18 19.25 18.5 19.83 19.39 19.23 19.11 18.12 18.03 19.04 19.35 18.96 18.32 18.38 19.08 19.22 19.54 18.44 17.61 19.17 18.01 19.5 19.17 18.98 D4A1D2 Arhgef26 2 146.7398331 310460 + 146.7398331 146.85046 rho guanine nucleotide exchange factor 26 None AALKMGKQQIIPKSLASEIK None None None 15.26 13.52 16.34 15.67 14.34 15.95 15.3 15.5 14.52 13.78 15.69 15.81 15.97 14.11 15.56 15.55 13.98 16.49 16.26 14.82 16.28 16.65 15.42 15.1 16.32 15.96 16.26 16.58 13.85 16.19 16.56 D4ACN6 Cert1 2 27.8825561 365652 + 27.8825561 27.987074 ceramide transfer protein None HVTPKGINGIDFKGEAITFK None None 4173 18.68 16.09 16.99 18.29 19.09 18.09 17.76 18.82 18.49 17.78 19.17 18.75 19.06 18.91 18.35 18.78 17.65 19.1 18.99 17.67 17.26 17.57 18.79 19.75 19.01 18.86 18.08 18.36 17.75 18.75 18.44 D3ZKX8 Fam169a 2 28.405831 310013 + 28.405831 28.438817 family with sequence similarity 169, member a None ECEPGLGERQCRELQIHSLK None None 52656 17.67 16.8 18.75 18.34 17.62 17.53 18.13 17.56 18.37 17.15 17.01 18.52 18.12 18.11 19.31 17.41 18.11 17.52 17.85 18.01 19.78 18.3 18.49 18.22 18.83 18.55 19.35 18.45 16.45 18.55 19.07 F1LMZ4 Gfm2 2 28.4495131 294672 + 28.4495131 28.484328 ribosome-releasing factor 2 RGD1309854 None None None None 18.11 15.99 18.25 16.9 19.27 16.67 18.25 16.88 16.02 18.84 17.63 16.36 17.83 16.58 16.66 17.19 16.47 18.98 17.08 16.67 16.56 17.29 18.31 15.93 17.36 16.6 16.45 18.17 17.75 16.51 18.12 Q5BJP6 Gfm2 2 28.4495131 294672 + 28.4495131 28.484328 ribosome-releasing factor 2 None RSLGDVDDGDTVTDFMAQER None None 6238 18.11 15.99 18.25 16.9 19.27 16.67 18.25 16.88 16.02 18.84 17.63 16.36 17.83 16.58 16.66 17.19 16.47 18.98 17.08 16.67 16.56 17.29 18.31 15.93 17.36 16.6 16.45 18.17 17.75 16.51 18.12 Q6AXR4 Hexb 2 28.484191 294673 - 28.484191 28.504091 beta-hexosaminidase subunit beta None GFYKRHHGPAKFQDKPQLEK None 606873 437 18.59 20.31 16.87 19.01 18.32 17.81 17.87 18.54 18.32 18.28 17.29 18.87 17.19 17.5 17.9 18.58 16.44 18.52 19.09 18.9 19.14 17.47 17.93 18.89 18.7 19.37 18.16 17.72 18.35 17.74 18.02 Q6DKY8 Enc1 2 28.5506711 294674 + 28.5506711 28.562483 ectodermal-neural cortex 1 None MEELITKQRKSKEIVEEAIR None 605173 2694 15.2 16.36 15.39 14.87 15.27 14.64 15.1 14.58 14.2 14.77 15.27 14.62 15.3 15.59 13.87 16.21 15.58 15.85 14.4 15.85 14.43 16.23 15.28 15.62 16.43 16.08 14.61 14.82 16.13 13.79 14.6 Q5U3Y8 Btf3 2 29.6600281 294680 - 29.6600281 29.66621 transcription factor btf3 None APLATGEDDDDEVPDLVENFDEASK None 613595 37453 17.95 16.32 17.98 18.09 18.5 16.47 16.59 17.58 16.22 16.92 18.38 16.99 17.88 17.89 16.94 16.54 17.04 17.44 17.38 18.04 17.21 16.23 17.54 17.52 18.76 16.97 18.65 16.24 17.88 17.73 18.03 D3ZYR1 Fcho2 2 30.0791511 309129 - 30.0791511 30.181146 f-bar domain only protein 2 None VRKLQELIKEVQKYGEEQVK None 613438 9030 17.15 15.95 16.73 16.76 16.6 17.71 16.46 17.27 17.33 16.85 17.45 17.9 16.98 17.47 15.95 19.11 16.95 17.53 17.87 17.32 16.7 16.74 17.73 18.05 17.24 17.51 17.18 16.62 17.85 16.78 17.01 F1LQP9 Tnpo1 2 30.207531 309126 - 30.207531 30.269385 transportin 1 None KGDVEEDEAIPDSEQDIRPR None 602901 5358 20.22 18.03 19.29 18.54 19.01 18.79 19.86 19.28 18.9 19.07 19.72 18.91 19.0 18.76 18.98 18.77 18.41 19.43 20.19 18.02 19.46 19.57 19.06 18.06 18.86 18.26 19.49 19.43 18.25 19.12 20.01 D4A3E8 Mrps27 2 30.7400341 361883 + 30.7400341 30.80859 mitochondrial ribosomal protein s27 None EQREKAKQEYQSLSAVENAA None 611989 41006 18.13 15.92 17.02 17.64 17.4 16.99 17.79 17.47 18.88 18.25 18.43 17.25 18.32 18.56 19.11 16.81 16.98 16.87 17.5 18.73 19.24 17.25 17.99 17.16 17.93 17.02 18.5 16.37 18.67 18.4 18.14 P15205 Map1b 2 30.8172621 29456 - 30.8172621 30.910317 microtubule-associated protein 1b None ALEKGEAEQSEEEGEEEEDK None 157129 38111 23.16 21.13 23.2 23.01 22.81 23.04 21.56 22.73 22.34 23.06 22.12 22.22 23.04 21.24 22.47 23.27 22.96 22.9 21.71 23.75 22.89 22.64 23.3 22.39 23.29 23.07 23.18 22.24 23.9 23.13 23.03 Q5XIT9 Mccc2 2 31.3049331 361884 - 31.3049331 31.375957 methylcrotonoyl-coa carboxylase beta chain None KEPIIKRFEEEGNPYYSSAR None 609014 11145 17.66 20.1 17.8 19.43 19.29 17.61 19.07 17.59 18.8 18.82 18.54 18.92 19.17 17.87 18.5 19.1 17.14 18.2 18.86 19.43 18.49 17.66 17.68 18.69 17.01 17.74 18.91 16.62 18.77 17.34 18.51 A0A096MK48 Serf1 2 31.4759861 502503 + 31.4759861 31.482015 similar to small edrk-rich factor 1, isoform cra_a None EDSLTASQRKQRDSEIMQQK None None 49268 16.7 14.27 16.48 15.37 17.45 16.48 15.86 16.17 16.56 15.4 17.49 16.51 16.6 15.88 15.28 15.46 14.98 17.01 16.56 16.94 17.35 16.05 16.5 16.62 15.06 16.16 15.13 15.63 17.57 16.68 16.53 Q6P6T5 Ocln 2 31.6576061 83497 - 31.6576061 31.70712 occludin None SPPLVPEVAQEIPLTLSVDDFR None None None 15.81 14.37 15.62 15.76 17.09 14.96 16.01 15.4 15.17 14.74 17.03 14.86 15.64 15.34 16.25 14.51 15.05 16.72 15.04 15.72 15.7 16.11 16.83 13.98 16.97 15.94 16.03 16.13 16.17 15.27 16.13 F1LQC8 Cdk7 2 31.8405271 171150 - 31.8405271 31.865442 cell division protein kinase 7 CAK; P39 Mo15 None None None None 15.87 15.26 15.46 16.64 16.66 15.24 16.99 16.73 15.66 16.42 14.63 15.9 15.66 15.42 17.15 17.15 14.59 16.25 15.69 16.52 14.58 15.28 15.62 15.21 17.18 17.04 14.71 15.94 16.67 16.0 17.55 P51952 Cdk7 2 31.8405271 171150 - 31.8405271 31.865442 cyclin-dependent kinase 7 None QFATVYKARDKNTNQIVAIK None 601955 1363 15.87 15.26 15.46 16.64 16.66 15.24 16.99 16.73 15.66 16.42 14.63 15.9 15.66 15.42 17.15 17.15 14.59 16.25 15.69 16.52 14.58 15.28 15.62 15.21 17.18 17.04 14.71 15.94 16.67 16.0 17.55 A0A0G2JZC3 Mrps36 2 31.8697851 294696 - 31.8697851 31.878361 mitochondrial ribosomal protein s36 None GNLSPNLLMHQGPPDTAELIK None 611996 11924 18.72 19.93 18.67 18.43 19.17 16.88 17.55 18.26 17.24 17.89 18.57 17.55 17.31 19.01 17.17 17.72 17.05 18.04 18.63 18.97 18.16 16.2 17.61 18.34 19.68 17.68 17.02 18.4 19.06 18.16 17.82 M0R776 Mrps36 2 31.8697851 294696 - 31.8697851 31.878361 mitochondrial ribosomal protein s36 None KMASATRVVQVVKPHAPLIK None 611996 11924 19.07 20.28 18.65 18.26 19.51 18.79 17.94 17.46 17.22 18.45 18.09 18.16 17.65 18.71 17.4 18.95 17.32 18.76 19.09 19.23 18.08 17.28 17.95 18.18 19.98 18.51 17.82 19.15 19.34 18.51 18.17 F1LNG5 Pik3r1 2 32.8817071 25513 - 32.8817071 32.963691 phosphatidylinositol 3-kinase 85 kda regulatory subunit alpha None DDEDLPHHDEKTWNVGSSNR None 171833 7889 18.34 15.41 17.0 18.12 16.49 18.35 17.57 17.59 17.55 17.72 17.13 17.67 17.93 17.75 17.24 17.73 17.8 17.79 18.6 16.9 18.17 17.56 18.11 17.71 17.87 18.44 18.13 18.31 16.5 18.03 17.92 Q63787 Pik3r1 2 32.8817071 25513 - 32.8817071 32.963691 phosphatidylinositol 3-kinase regulatory subunit alpha None VSKYQQDQVVKEDNIEAVGK None 171833 7889 18.51 15.96 17.26 18.75 17.4 17.63 17.31 18.4 17.46 17.55 17.17 17.44 17.72 17.27 16.82 17.47 17.59 17.84 18.67 17.1 17.42 16.65 17.91 17.74 18.1 18.55 18.28 18.24 16.35 17.76 17.74 M0R3L1 Mast4 2 33.8955221 100912235 - 33.8955221 33.969607 non-specific serine/threonine protein kinase None RFLPPSRALQDSLAAPGPDR None None None 16.5 16.08 15.68 16.07 15.36 16.32 15.88 15.12 15.97 16.51 16.02 15.93 16.04 15.64 15.41 15.4 16.88 15.45 16.17 16.84 17.12 16.41 16.28 14.91 15.36 17.04 15.65 16.81 16.27 16.51 15.54 G3V9I9 Srek1 2 34.8533241 56763 - 34.8533241 34.885013 splicing regulatory glutamine/lysine-rich protein 1 None INHSNNAIVKPPEMTPQAAAK None 609268 None 15.92 14.49 16.17 16.1 15.98 15.23 14.66 15.82 16.33 14.75 15.34 15.8 16.12 16.59 16.33 15.14 16.17 15.63 15.8 16.46 17.43 15.63 16.25 16.51 16.89 16.42 16.46 15.21 16.65 16.29 16.91 Q9JKL7 Srek1 2 34.8533241 56763 - 34.8533241 34.885013 splicing regulatory glutamine/lysine-rich protein 1 None ETQPTRFAFVEFADQNSVPR None 609268 None 15.82 14.39 16.0 16.01 15.89 14.77 14.8 15.72 16.39 14.97 15.27 15.76 16.02 16.49 15.94 15.04 16.29 15.6 15.64 16.33 17.33 15.53 16.15 16.22 16.6 16.4 16.28 15.02 16.83 16.19 16.81 M0R9T2 Erbin 2 34.9271271 365661 - 34.9271271 34.968918 erbb2-interacting protein None SQDTALCSPAKQIPIDSNSK None None 41282 18.2 15.33 17.01 17.53 17.24 16.55 16.89 17.92 16.64 15.67 17.42 15.64 16.77 16.43 15.66 17.28 17.72 16.66 16.6 17.13 16.14 15.69 16.55 16.85 18.6 17.35 18.35 15.7 16.09 17.19 17.67 A0A0G2JSY3 Nln 2 35.1345481 117041 - 35.1345481 35.232906 neurolysin (metallopeptidase m3 family), isoform cra_a None None None None 19.97 18.06 20.22 20.62 18.8 18.97 19.0 18.35 19.01 19.85 19.25 18.72 19.59 19.47 18.06 19.26 18.99 19.26 19.86 20.76 19.86 19.86 19.59 20.16 19.47 19.39 20.21 18.57 18.9 19.57 19.2 P42676 Nln 2 35.1345481 117041 - 35.1345481 35.232906 neurolysin None AKLLGYNTHADFVLELNTAK None 611530 69315 19.97 18.06 20.22 20.62 18.8 18.97 19.0 18.35 19.01 19.85 19.25 18.72 19.59 19.47 18.06 19.26 18.99 19.26 19.86 20.76 19.86 19.86 19.59 20.16 19.47 19.39 20.21 18.57 18.9 19.57 19.2 Q80W98 Sgtb 2 35.2331861 294708 + 35.2331861 35.266899 small glutamine-rich tetratricopeptide repeat-containing protein beta None EAVTSYQKALDLDPENDSYK None None 10409 19.52 18.55 17.69 19.09 18.98 19.18 17.96 18.9 18.86 18.94 19.12 18.96 18.93 19.58 17.35 18.72 19.11 19.0 19.2 19.34 18.61 18.18 19.46 19.58 18.97 19.15 19.63 18.18 18.68 18.87 18.28 Q5M887 Trappc13 2 35.270451 294709 - 35.270451 35.302068 trafficking protein particle complex subunit 13 None LSLEAIPDTVNLEEPFHITCK None None None 17.6 19.14 17.66 16.06 18.07 17.21 17.84 16.99 17.53 15.99 16.86 17.12 17.11 18.07 18.7 16.87 16.62 16.27 17.92 17.92 17.16 17.7 17.1 16.74 18.52 18.71 18.44 15.95 18.36 16.35 17.11 D3ZVP6 Ppwd1 2 35.3373021 294711 - 35.3373021 35.36046 peptidylprolyl isomerase domain and wd repeat containing 1 None GKIFIYDGRGDNQPLHIFDK None None 9099 16.03 17.24 16.83 16.87 16.7 17.45 16.82 14.87 17.33 16.02 14.79 16.19 16.21 16.92 15.57 16.13 15.71 16.28 16.44 17.85 17.06 16.01 15.66 16.95 17.37 16.21 16.08 16.85 15.36 16.04 17.31 Q5FVH8 Rgs7bp 2 36.1393881 294715 - 36.1393881 36.16667 regulator of g-protein signaling 7-binding protein None PLKNQDDSSLLNLTPYPMVR None None None 18.4 16.17 17.11 18.68 18.62 16.91 17.65 17.87 18.74 17.59 17.8 19.26 18.53 18.13 18.33 18.48 17.97 18.41 18.73 17.0 17.77 17.3 18.88 17.95 18.2 17.85 18.42 18.02 18.07 18.36 18.08 M0R8E8 Ipo11 2 38.1708681 - 38.1708681 38.333289 importin 11 None HGIDRYWRRVAPHALSEEEK None None None 17.32 14.49 16.72 16.09 16.85 16.08 16.68 16.71 16.25 15.86 17.13 15.95 16.96 16.02 16.97 17.92 16.51 16.87 17.66 15.2 17.93 15.67 16.79 16.93 18.12 17.3 16.56 17.27 15.89 16.63 17.23 F1M8L1 Kif2a 2 38.3700931 84391 - 38.3700931 38.431191 kinesin-like protein None KLRVLEDGKQQVQVVGLQER None None 3320 19.89 20.84 20.2 20.23 19.38 18.71 19.65 20.34 19.53 20.57 18.78 18.85 19.63 18.55 20.53 20.58 20.22 19.65 19.87 18.35 19.69 19.04 19.12 20.28 19.82 20.73 20.05 19.12 19.61 18.64 20.3 Q9WV63 Kif2a 2 38.3700931 84391 - 38.3700931 38.431191 kinesin-like protein kif2a None SVSDISPVQAAKKEFGPPSR None None 3320 19.78 21.4 20.21 20.17 19.38 18.73 19.71 20.39 19.56 20.56 18.77 18.89 19.48 18.52 20.55 20.63 20.21 19.71 19.83 18.4 19.64 19.04 19.06 20.15 19.81 20.7 20.12 19.14 19.59 18.62 20.05 A0A0G2JZF6 Ndufaf2 2 39.5352841 361894 - 39.5352841 39.647383 nadh:ubiquinone oxidoreductase complex assembly factor 2 None RTEVDYEAGDIPTEWEAWIR None None None 18.12 16.59 17.89 17.59 18.51 17.52 18.2 17.51 16.96 18.29 16.89 17.5 18.1 18.1 16.31 18.82 18.62 18.86 17.71 17.95 17.0 17.86 18.17 17.71 19.49 18.57 19.39 18.03 17.06 18.83 18.39 A0A140TAB1 Pde4d 2 40.6255621 24627 + 40.6255621 41.524907 phosphodiesterase None RERGMEISPMCDKHNASVEK None 600129 129755 18.34 16.85 17.84 17.77 16.95 18.44 17.06 16.85 18.42 17.51 16.9 18.59 17.38 18.31 17.36 18.12 18.45 18.06 19.06 16.86 18.74 18.05 18.41 18.0 18.04 18.07 17.84 18.14 18.34 17.9 17.91 P14270 Pde4d 2 40.6255621 24627 + 40.6255621 41.524907 camp-specific 3',5'-cyclic phosphodiesterase 4d None PMCNQPSINKATITEEAYQK None 600129 129755 18.33 16.78 17.84 17.77 16.95 18.44 17.06 16.85 18.42 17.51 16.9 18.59 17.44 18.31 17.36 18.12 18.45 18.06 19.06 16.86 18.74 18.05 18.32 18.0 18.04 18.07 17.84 18.14 18.34 17.87 18.02 P62824 Rab3c 2 41.6273631 171058 - 41.6273631 41.842663 ras-related protein rab-3c None KDNINVKQTFERLVDIICDK None 612829 23420 20.74 20.41 21.53 20.08 19.77 20.58 20.58 20.32 20.27 20.23 19.8 19.96 21.14 21.97 19.94 21.08 19.91 20.42 22.13 21.05 21.33 20.99 20.94 21.24 21.47 22.26 20.98 21.47 19.56 21.17 20.21 D3ZRN3 Actbl2 2 42.8580211 294732 + 42.8580211 42.860767 actin, beta-like 2 None SFLGIESRGIHETTFNSIMK None None None 25.38 27.27 25.61 24.58 24.24 24.9 25.39 25.22 24.64 24.59 25.8 24.65 24.91 26.35 26.3 25.7 25.25 23.81 25.39 25.45 24.76 26.02 24.89 24.88 26.29 26.16 24.66 25.56 26.0 24.42 25.14 P40190 Il6st 2 44.0763031 25205 + 44.0763031 44.101772 interleukin-6 receptor subunit beta None RNVVGKSPATVLTIPGSHFK None 600694 1645 16.86 15.18 15.82 16.32 16.9 14.53 16.02 16.9 16.2 16.59 15.39 15.93 17.63 16.08 16.25 17.23 17.27 14.65 16.39 16.55 15.25 16.1 16.02 15.36 18.08 16.61 16.1 16.37 17.45 16.34 16.54 Q64060 Ddx4 2 44.227911 310090 - 44.227911 44.282931 probable atp-dependent rna helicase ddx4 RVLG None None None None 17.84 19.47 17.57 17.24 17.33 17.32 17.65 17.61 17.63 18.47 18.13 17.65 17.03 18.4 18.96 16.93 18.53 17.34 18.01 16.34 19.22 17.89 16.82 18.18 17.16 18.21 18.45 17.64 16.97 16.76 18.15 D4AE49 Mtrex 2 44.4913921 365668 - 44.4913921 44.560574 mtr4 exosome rna helicase None YRAIPGVVEKVKNSEEQYNK None None 6257 16.72 16.66 17.99 17.29 16.67 17.44 15.48 16.83 18.19 16.22 16.45 17.46 17.15 17.43 18.02 16.44 16.96 16.33 18.12 17.12 19.09 17.39 16.94 17.89 18.0 16.84 18.1 17.67 17.56 17.68 18.85 D3ZHW0 Dhx29 2 44.5606141 100362324 + 44.5606141 44.611442 atp-dependent rna helicase dhx29 None GLYDSVGKIMCTKSVDVTEK None None None 16.94 15.4 16.83 17.63 15.51 16.28 16.59 16.22 16.46 15.88 18.41 16.47 17.14 16.12 17.73 17.13 17.33 16.62 16.63 15.2 16.78 17.63 16.1 16.52 16.65 17.09 17.22 17.27 15.91 16.86 16.81 D3ZZ38 Snx18 2 45.2323261 310097 - 45.2323261 45.258345 sorting nexin None LRARALYDFRSENPGEISLR None None 14164 17.03 15.77 18.47 17.25 17.72 15.39 17.5 17.6 17.73 16.38 16.79 17.45 16.98 16.56 17.75 16.81 15.59 18.06 16.62 16.97 17.89 16.67 16.79 16.52 17.39 16.19 17.27 17.24 17.19 17.95 18.24 F1M6C4 Arl15 2 45.4383381 689079 + 45.4383381 45.819959 adp-ribosylation factor-like gtpase 15 None PAARSVQEIKKYFELEPLAR None None 56843 17.49 19.41 18.25 17.06 17.24 18.47 17.43 15.91 17.41 16.84 17.37 17.54 16.65 17.77 16.56 18.22 18.16 17.09 17.88 17.08 17.74 17.85 17.1 17.29 17.01 17.93 17.48 18.11 16.98 16.89 16.74 Q5XIF3 Ndufs4 2 45.9513581 499529 - 45.9513581 46.06187 nadh dehydrogenase [ubiquinone] iron-sulfur protein 4 None KEDAVAFAEKHGWSYDVEGR None 602694 1866 21.49 22.28 20.74 21.19 21.54 19.73 20.71 21.2 20.7 21.91 20.31 21.0 20.27 20.82 20.9 22.68 20.9 21.22 21.29 20.98 19.75 20.97 21.36 21.85 22.68 21.78 21.67 21.02 20.04 21.39 20.9 Q6AY59 Mocs2 2 46.5045891 294753 + 46.5045891 46.516324 molybdopterin synthase catalytic subunit None LKDVDDVLEKPKDIIQFTAK None 603708 32193 17.24 14.31 15.59 16.06 15.82 15.52 16.71 16.3 15.55 15.98 15.86 15.55 16.02 16.19 16.12 16.17 15.66 17.76 15.87 16.16 15.56 17.36 16.24 15.19 17.77 17.39 16.21 16.73 16.31 16.49 16.78 P18614 Itga1 2 46.6530051 25118 - 46.6530051 46.812271 integrin alpha-1 None KENKNEPCGARFGTAIAAVK None 192968 57137 17.25 15.15 16.98 16.96 16.14 16.28 16.14 18.23 17.71 16.84 18.6 16.43 16.71 17.04 17.12 17.15 17.36 18.17 15.59 16.44 16.61 17.4 18.36 16.1 16.49 16.5 17.17 17.08 17.68 16.78 17.07 Q5XIP1 Pelo 2 46.7978341 294754 - 46.7978341 46.79972 protein pelota homolog None DNAGQVTLVPEEPEDMWHTYNLVQVGDSLR None 605757 6835 18.02 16.31 16.89 16.77 17.84 17.04 17.52 18.3 17.76 18.24 17.39 15.87 17.35 16.27 17.6 17.18 17.76 16.59 17.53 15.97 16.2 16.2 17.52 17.15 17.15 16.62 17.64 16.86 16.39 17.46 17.16 O88775 Emb 2 49.0705011 114511 + 49.0705011 49.121123 embigin None KVHGKNKPLITYVGDSTVLK None None 2554 18.98 16.75 18.32 19.33 17.88 17.35 18.63 19.09 18.23 18.57 20.69 18.42 18.93 19.96 17.99 18.33 17.81 19.44 18.46 19.46 17.3 18.07 18.71 19.02 18.01 18.16 18.24 18.8 17.82 19.32 19.08 F1LSH6 Hcn1 2 49.4957931 84390 + 49.4957931 49.899702 potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 None VDGGGGEEPAGSFEDAEGPR None None 32093 18.77 16.4 17.23 17.82 18.54 18.54 16.74 18.13 18.6 18.73 17.77 18.56 18.78 18.23 17.86 19.53 19.0 18.76 17.96 17.84 17.51 17.29 18.96 18.18 18.1 19.23 18.45 18.68 19.4 18.56 18.41 Q9JKB0 Hcn1 2 49.4957931 84390 + 49.4957931 49.899702 potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1 None SKEMKLTDGSYFGEICLLTK None None 32093 18.77 16.45 17.23 17.82 18.54 18.54 16.74 18.13 18.6 18.73 17.77 18.56 18.79 18.23 17.86 19.53 19.0 18.76 17.96 17.84 17.51 17.29 19.0 18.18 18.1 19.23 18.45 18.68 19.4 18.53 18.35 Q5BJZ3 Nnt 2 51.4114171 310378 - 51.4114171 51.504578 proton-translocating nad(p)(+) transhydrogenase None LLNKLSERKTTVLAMDQVPR None 607878 7445 20.31 21.75 20.83 20.15 20.35 19.57 20.67 20.2 19.03 20.34 20.51 18.37 19.36 20.3 19.92 20.38 20.6 19.19 20.82 19.77 19.55 19.18 19.44 19.07 21.03 20.18 19.96 19.7 20.47 20.17 19.36 A0A0G2JVP5 Paip1 2 51.5238331 365684 + 51.5238331 51.550241 poly(a)-binding protein-interacting protein 1 None DEMDPEIEEAYEKFCLESER None 605184 4709 18.93 16.2 18.75 17.86 17.73 18.2 17.76 17.69 17.96 19.27 17.39 18.07 18.52 17.56 17.34 18.28 17.94 18.59 18.19 19.83 19.12 18.62 18.79 17.92 17.68 18.89 18.84 18.02 18.39 18.5 18.92 P17425 Hmgcs1 2 51.6536191 29637 + 51.6536191 51.667073 hydroxymethylglutaryl-coa synthase, cytoplasmic None MGFCTDREDINSLCLTVVQK None 142940 1609 20.57 17.24 18.8 19.27 19.88 18.87 19.66 19.35 17.99 19.41 20.67 19.46 19.4 19.17 18.64 19.37 19.44 20.61 18.2 19.06 18.33 18.75 19.72 19.59 19.33 18.45 19.03 18.67 18.47 19.25 18.84 A0A0G2JVL5 Rgd1305938 2 53.189791 310362 - 53.189791 53.203836 similar to expressed sequence aw549877 None YFEENKLVDEDFPEDCSPQK None None None 16.04 17.71 18.18 16.71 16.09 16.12 17.11 16.31 16.5 17.0 16.96 16.15 17.27 17.73 16.44 15.09 16.06 16.66 16.97 17.27 17.35 17.33 16.52 17.16 17.17 16.17 16.88 16.68 16.36 17.49 16.29 B2GV06 Oxct1 2 53.236371 690163 + 53.236371 53.384738 succinyl-coa:3-ketoacid coenzyme a transferase 1 None IPGKMVKGMGGAMDLVSSSK None 601424 377 21.19 22.39 20.71 22.06 20.59 20.78 22.41 20.39 21.85 21.01 20.4 20.7 19.74 20.96 19.3 21.15 20.78 21.87 21.25 21.13 21.49 21.19 21.26 20.14 21.79 21.49 20.43 21.22 20.46 20.12 21.62 D4A1H2 Plcxd3 2 53.5670231 310358 + 53.5670231 53.746384 phosphatidylinositol-specific phospholipase c, x domain-containing 3 None TKPRDPDNELYFAHGLFSAK None None None 18.84 17.11 18.88 18.66 18.91 17.55 19.21 19.17 17.84 17.88 17.89 18.52 19.15 17.86 17.41 18.73 18.01 19.48 18.42 19.08 18.71 18.93 18.61 17.76 19.82 19.55 18.91 18.93 17.79 19.14 19.54 A0A0G2K7X7 C7 2 54.0896341 117517 - 54.0896341 54.161198 complement c7 None PTEEGCGDRFRCFSGQCISK None 217070 489 15.4 16.91 16.74 17.12 16.38 16.67 17.49 17.3 16.21 16.87 17.79 16.85 16.76 16.43 16.94 15.56 16.2 16.23 16.28 17.04 17.72 15.6 16.38 17.1 15.51 16.01 15.32 16.14 16.53 16.07 15.57 P54645 Prkaa1 2 54.2402991 65248 + 54.2402991 54.275978 5'-amp-activated protein kinase catalytic subunit alpha-1 None NAKIADFGLSNMMSDGEFLR None 602739 49590 17.77 17.44 18.45 18.0 18.55 17.91 18.14 18.23 17.49 17.55 18.12 17.33 18.33 17.66 18.76 18.02 17.93 17.71 18.15 17.31 18.11 16.8 17.38 18.15 17.44 19.69 18.9 17.74 17.46 18.73 18.59 D3ZBZ9 Ttc33 2 54.281 294774 + 54.281 54.322122 similar to osmosis responsive factor, isoform cra_a None GEKVSKATSQQFEAEAADEK None None 8226 16.4 15.8 16.83 17.08 16.79 16.84 16.07 16.49 17.67 15.56 16.02 17.56 17.16 17.48 16.19 15.68 16.22 16.63 17.88 17.36 18.38 16.26 17.05 16.41 17.26 16.89 16.64 16.82 17.64 17.32 17.73 D3ZLL8 Rps15al4 2 54.4375671 100361715 - 54.4375671 54.438003 40s ribosomal protein s15a None QFGFIVLTTSAGIMDHEEAR None None None 18.54 17.15 17.1 19.81 18.35 18.25 17.22 18.73 18.54 17.66 18.71 18.39 19.19 18.32 19.5 19.02 18.43 18.86 18.12 17.99 17.21 18.21 18.69 19.65 19.26 20.05 19.29 17.65 19.28 18.08 19.95 O88797 Dab2 2 55.5448491 79128 + 55.5448491 55.565801 disabled homolog 2 None PSKKEKKKGSEKTDEYLLAR None 601236 1026 15.93 15.25 16.63 15.78 14.91 14.89 16.95 16.74 16.39 15.18 17.81 16.4 16.13 17.47 16.89 16.24 15.79 16.91 16.55 15.04 16.18 16.82 16.24 16.38 16.54 15.99 16.58 16.75 14.46 16.21 16.83 Q62930 C9 2 55.5728061 117512 + 55.5728061 55.621364 complement component c9 None GKVVNISRDHIIDDVISFIR None 120940 74406 17.98 16.85 16.86 17.86 17.4 16.93 18.33 17.96 16.87 16.62 19.09 16.93 16.53 16.96 17.11 16.88 17.13 17.3 16.81 17.55 17.99 15.95 16.62 17.62 16.75 17.86 16.22 16.55 17.19 16.26 17.29 F1M4J0 Rictor 2 55.8507221 310131 + 55.8507221 55.899878 rptor-independent companion of mtor, complex 2 None GGGLPSGTGSLVKNSFHLLR None None 34317 16.73 17.77 16.5 17.0 17.15 16.34 16.68 15.96 16.87 15.62 17.4 16.83 15.74 16.63 17.69 16.75 16.85 16.59 17.21 14.99 18.26 16.51 15.73 17.14 17.37 17.24 16.68 15.79 17.06 16.52 17.37 O70535 Lifr 2 56.2256491 81680 + 56.2256491 56.288525 leukemia inhibitory factor receptor None KWSKWSNEKRYLTTEATPSK None 151443 1735 16.49 14.99 15.4 15.65 15.68 15.27 15.17 16.49 15.81 14.9 16.13 15.8 16.11 14.79 14.97 15.58 15.27 16.15 15.25 16.35 14.76 15.14 15.46 14.98 16.11 14.86 16.52 15.31 15.81 15.72 16.31 Q5EB92 Wdr70 2 56.9513441 294783 - 56.9513441 57.191204 wd repeat-containing protein 70 None EGEEDNPIHRIPDSHEITLK None None 9972 15.34 14.49 15.69 16.24 16.29 15.51 15.08 15.54 15.43 15.96 14.9 15.86 15.98 16.38 16.02 15.66 14.36 15.79 16.62 16.87 15.69 16.17 16.06 15.88 16.83 16.59 17.71 15.54 16.01 16.29 16.93 P37199 Nup155 2 57.2012561 117021 + 57.2012561 57.252971 nuclear pore complex protein nup155 None WALSAIDELKVDKIITPLNK None 606694 43155 16.3 17.59 16.62 16.17 16.5 16.46 16.33 16.67 16.82 16.17 15.68 16.56 16.01 17.19 16.89 15.81 17.51 16.36 17.66 15.57 18.74 16.94 16.1 16.86 17.57 17.97 16.97 16.33 17.48 16.35 18.15 A0A0G2K0J4 Nipbl 2 57.4003531 294787 - 57.4003531 57.490736 nipped-b protein None NLKIQVLKNLQTYLQEEDTR None 608667 15850 15.67 14.28 15.96 16.13 17.22 14.64 14.29 15.26 16.17 16.66 15.28 15.05 16.08 15.35 16.68 17.18 16.51 16.26 15.24 15.03 15.28 15.2 16.05 16.7 16.75 15.62 16.41 15.32 16.55 16.51 16.99 P24942 Slc1a3 2 57.7554491 29483 - 57.7554491 57.830605 excitatory amino acid transporter 1 None YKMSYREVKYFSFPGELLMR None 600111 20882 21.33 20.43 21.57 21.6 21.98 21.76 22.08 21.63 22.79 22.06 21.15 23.04 22.57 22.41 22.63 21.48 20.96 21.76 23.32 21.06 23.43 21.69 22.44 20.99 20.82 21.58 22.47 23.05 21.15 22.49 22.66 Q1HCL7 Nadk2 2 58.1176751 365699 + 58.1176751 58.159808 nad kinase 2 None SFNINRVAAQAVEDVLNIAR None None None 18.59 17.94 18.69 17.8 18.79 18.25 19.28 19.01 18.98 18.5 17.73 19.29 18.34 18.27 19.38 19.04 17.63 19.26 18.1 19.59 19.52 18.44 18.26 17.39 18.7 18.29 19.1 18.46 18.54 19.21 20.12 D3ZUP8 Lmbrd2 2 58.1895591 499539 + 58.1895591 58.247076 lmbr1 domain-containing 2 None NETSATHQFVHTFQSPEPENR None None None 18.07 15.88 17.68 17.06 17.27 18.39 17.32 16.92 18.84 18.16 16.73 17.74 18.38 18.5 18.47 17.59 17.6 18.08 17.75 16.8 19.38 17.69 18.34 17.93 17.21 17.67 18.73 18.27 16.75 18.13 18.01 A0A0G2QC19 Dnajc21 2 59.4195871 192210 - 59.4195871 59.446571 dnaj heat shock protein family (hsp40) member c21 None LRWHPDKNLDNAAEAAEQFK None None 6752 17.58 15.48 15.72 16.11 15.95 16.26 15.89 15.69 16.7 16.41 17.1 16.06 16.14 15.74 14.98 17.25 17.0 17.33 15.8 16.0 15.25 17.58 15.81 16.28 15.24 16.43 17.11 16.17 15.04 16.8 15.26 Q4QQT6 Brix1 2 59.4504361 294799 - 59.4504361 59.461519 ribosome biogenesis protein brx1 homolog None GDLEVQAKKPKKNRKDAGQP None None 10133 16.33 14.48 16.02 16.01 15.35 15.67 15.12 17.37 16.68 16.08 15.6 16.21 16.1 15.63 15.15 15.99 16.84 15.82 15.47 16.02 15.69 15.38 16.03 16.97 15.91 15.51 15.89 15.58 15.84 16.22 16.87 P70473 Amacr 2 59.946191 25284 + 59.946191 59.958239 alpha-methylacyl-coa racemase None EVLKDYGFSQEEIHQLHSDR None 604489 7410 16.2 16.1 14.66 16.13 16.14 15.37 16.74 17.04 16.0 15.05 15.87 16.48 15.02 14.73 16.89 16.97 16.57 16.39 14.48 14.9 14.71 15.74 15.35 14.68 16.5 15.77 14.63 16.44 16.63 15.23 17.46 Q7TP08 Amacr 2 59.946191 25284 + 59.946191 59.958239 alpha-methylacyl-coa racemase Da1-8; Marc1 None None None None 16.2 16.1 14.66 16.13 16.14 15.37 16.44 17.04 16.0 15.05 15.87 16.48 15.02 14.73 16.79 16.97 16.65 16.38 14.38 14.95 14.71 15.74 15.35 15.01 16.5 15.77 14.57 16.47 16.63 15.23 17.46 A0A0G2K9V6 Tars1 2 60.368391 294810 - 60.368391 60.387721 threonyl-trna synthetase None TGKIKTLKIHKNSSTYWEGK None 187790 11852 19.95 18.33 20.28 18.73 19.32 19.76 18.95 19.4 19.85 20.44 18.57 19.5 20.0 19.6 18.7 18.32 18.96 19.88 19.41 20.96 21.25 19.89 19.39 20.31 18.29 19.7 20.15 19.15 18.85 19.65 20.22 Q63396 Sub1 2 61.0083121 192269 - 61.0083121 61.020372 activated rna polymerase ii transcriptional coactivator p15 None EMKPGRKGISLNMEQWSQLK None None 38218 20.12 18.73 20.99 19.81 19.59 19.55 19.07 19.0 20.82 19.11 20.73 20.31 20.31 20.81 19.5 18.99 20.21 20.01 20.81 19.84 21.76 20.51 20.4 19.83 19.57 19.3 20.74 19.76 20.54 20.14 20.85 A0A0H2UHJ5 Zfr 2 61.1376121 365703 + 61.1376121 61.200322 zinc finger rna-binding protein None VMTKHATIYPTEEELQAVQK None None 8009 17.87 16.08 18.47 17.92 17.48 17.79 16.63 17.25 18.34 16.86 17.52 17.9 18.33 18.33 18.24 17.17 17.89 18.07 17.65 18.61 19.49 18.31 18.19 18.7 18.45 17.84 18.82 16.77 18.55 18.44 18.99 Q562A2 Zfr 2 61.1376121 365703 + 61.1376121 61.200322 zinc finger rna-binding protein None APKAGYSQGATQYTQAQQAR None None 8009 17.58 15.67 18.22 17.62 17.14 17.43 16.29 16.93 17.87 16.51 17.16 17.68 18.02 17.97 17.72 16.85 17.45 17.82 17.43 18.23 19.05 17.95 17.92 18.37 18.1 17.4 18.49 16.42 18.15 18.03 18.59 Q5FVM6 Mtmr12 2 61.2238541 310155 + 61.2238541 61.291194 myotubularin-related protein 12 None VATMGKLLEMMEEVQSLQEK None None None 17.81 15.71 17.79 17.16 16.53 18.9 17.43 17.25 17.56 17.14 17.46 18.17 18.23 17.63 17.04 18.08 17.49 17.91 18.0 17.08 17.87 17.49 17.53 16.79 16.49 16.98 17.4 17.93 18.42 17.8 18.07 Q569C9 Golph3 2 61.3480311 78961 + 61.3480311 61.376049 golgi phosphoprotein 3 None TNNNIKQRLIKKVQEAVLDK None 612207 56942 17.27 15.96 16.51 17.14 17.89 16.11 17.76 17.78 17.2 17.6 16.74 18.16 18.39 17.79 17.49 17.2 17.46 18.37 18.07 15.96 16.96 17.6 17.39 17.88 17.79 18.43 17.79 18.03 16.34 17.49 18.86 Q9ERE4 Golph3 2 61.3480311 78961 + 61.3480311 61.376049 golgi phosphoprotein 3 None TNNNIKQRLIKKVQEAVLDK None 612207 56942 17.19 15.87 16.42 17.05 17.8 16.03 17.67 17.69 17.11 17.51 16.65 18.07 18.3 17.7 17.48 17.11 17.28 18.24 18.12 15.78 16.87 17.51 17.3 17.79 17.7 18.34 17.7 17.94 16.25 17.4 18.77 Q9QZR8 Pdzd2 2 61.3870271 65034 - 61.3870271 61.621138 pdz domain-containing protein 2 None IPKSLKDGALLEDTAPASGK None 610697 23393 14.97 14.11 13.96 15.16 15.2 13.73 13.69 15.39 14.82 14.06 13.79 13.48 13.88 13.39 14.0 15.37 14.45 14.78 13.54 13.92 13.22 13.32 15.05 13.9 15.36 15.05 14.32 14.93 14.28 13.5 13.92 F1LQP8 Cdh6 2 62.0801561 25409 - 62.0801561 62.14504 cadherin-6 None SGSNFTIQDNKDNTAGILTR None 603007 21027 18.26 17.64 16.45 17.5 17.3 17.11 17.37 16.67 17.6 17.92 17.69 17.71 17.3 18.11 16.19 16.9 18.13 17.85 18.07 16.46 17.51 17.41 17.53 17.15 17.13 17.32 16.65 17.26 18.33 17.37 16.37 P55280 Cdh6 2 62.0801561 25409 - 62.0801561 62.14504 cadherin-6 None FVCEKAKADQLIQTLHAVDK None 603007 21027 18.03 17.11 16.31 17.17 17.01 16.89 17.2 16.33 17.37 17.62 17.38 17.38 17.06 17.95 15.82 16.67 17.69 17.81 17.87 16.33 17.23 17.2 17.23 16.88 16.96 17.1 16.26 17.06 17.97 17.24 16.26 D3ZFQ5 Cdh9 2 66.2281671 29163 + 66.2281671 66.367427 cadherin 9 None AREDSKLRRDVMPETIFQIR None None None 17.14 17.87 16.59 16.68 16.86 17.64 17.67 15.94 16.81 17.23 17.02 17.08 17.18 17.3 15.92 16.79 17.41 17.52 17.66 16.42 17.12 17.02 17.12 16.98 17.41 16.85 16.0 17.43 16.38 16.38 15.69 F1LR98 Cdh10 2 68.6284441 29181 + 68.6284441 68.85167 cadherin 10 None EDTQAFDIGTLRNPAAIEEK None 604555 68530 18.4 17.6 17.22 17.84 17.68 18.39 17.75 16.67 17.69 17.7 17.8 18.2 17.98 18.15 16.54 17.8 18.58 18.18 17.97 16.92 17.61 17.97 18.22 17.83 17.98 17.96 17.15 18.3 17.66 17.43 17.05 F1M702 Cdh18 2 73.5030371 310174 + 73.5030371 73.820143 cadherin 18 None GQVIHTITATDKDDFANGPR None None None 16.18 14.62 16.0 16.89 15.06 14.53 16.57 15.65 16.9 17.41 16.07 15.68 16.96 17.0 15.08 16.6 16.4 16.64 16.64 16.21 16.34 16.42 16.32 16.29 16.03 16.4 15.71 16.33 16.27 16.96 16.56 A0A0G2K1L8 Basp1 2 75.8169021 64160 - 75.8169021 75.863803 brain acid soluble protein 1 None SDAAPAASDSKPSSAEPAPSSKETPAASEAPSSAAK None 605940 38168 23.49 25.55 23.76 24.21 22.35 24.17 23.72 23.35 23.66 24.49 23.44 23.77 23.47 24.3 22.83 24.02 24.62 23.94 23.26 24.18 23.91 24.64 23.81 23.84 23.23 24.79 22.3 24.18 25.09 23.17 22.78 Q05175 Basp1 2 75.8169021 64160 - 75.8169021 75.863803 brain acid soluble protein 1 None AKDKDKKAEGAGTEEEGTQK None 605940 38168 23.53 25.3 23.7 24.11 22.26 24.3 23.81 23.2 23.73 24.61 23.51 23.8 23.57 24.25 22.8 24.15 24.53 24.02 23.21 24.27 24.02 24.73 24.11 23.76 23.06 24.73 22.37 24.12 25.07 23.15 22.62 D3ZS22 Cwc15 8 11.3054241 + 11.3054241 11.316326 spliceosome-associated protein cwc15 homolog None FEPARGGRRKGEGDLSQLSK None None None 16.44 15.04 17.17 16.2 16.18 16.0 17.09 15.9 17.28 16.06 15.9 16.64 16.72 16.9 17.52 15.64 16.26 15.74 15.68 16.75 18.29 16.49 16.44 16.16 16.36 15.73 15.82 16.49 16.1 16.8 17.69 D3ZJP6 Myo10 2 76.1009681 310178 + 76.1009681 76.30303 unconventional myosin-x None LRAQQEAETRKQQELEALQK None 601481 36328 16.84 17.83 17.0 18.78 18.89 16.98 18.21 18.76 18.13 17.54 17.02 18.08 18.4 17.35 18.94 18.81 17.68 17.91 17.94 17.99 16.78 17.54 17.75 16.62 19.16 19.55 18.26 18.2 19.3 17.75 18.94 Q5FVM3 Zfp622 2 76.3355421 103689968 + 76.3355421 76.475144 reticulophagy regulator 1 None WRSLSESWEVINSKPDERPR None None None 15.96 14.8 17.12 15.18 16.14 16.74 16.85 16.63 15.85 15.87 17.21 15.35 17.24 16.56 17.48 16.04 16.5 16.5 17.15 15.3 16.41 16.8 17.1 15.41 17.78 16.47 15.87 16.75 16.78 16.48 15.63 A0A0G2K4L3 Fam134b 2 76.4651571 619558 + 76.4651571 76.473222 reticulophagy regulator 1 None GDVITAAMTAAIKDQLEGAR None 613114 10368 15.12 14.26 15.18 15.48 15.72 16.63 15.78 16.42 16.12 14.71 16.73 15.79 16.64 15.79 15.98 15.13 15.68 16.27 14.21 16.81 15.5 16.34 16.63 16.3 15.72 16.95 14.69 16.02 16.06 15.86 15.34 F1LN34 Ankh 2 78.1530251 114506 + 78.1530251 78.280187 progressive ankylosis protein homolog Ank; SLC61A1 None None None None 17.23 14.82 17.05 16.87 15.52 16.5 15.55 15.41 16.36 15.63 16.87 15.62 15.55 16.05 15.18 15.7 15.27 16.64 16.73 15.71 16.28 15.78 15.15 16.45 15.77 14.79 14.59 16.2 16.98 16.37 15.97 P58366 Ankh 2 78.1530251 114506 + 78.1530251 78.280187 progressive ankylosis protein homolog None IHDIIPDRSGPELGGDATIR None 605145 10664 17.18 14.77 17.0 16.82 15.47 16.46 15.51 15.36 16.32 15.58 16.82 15.57 15.51 16.0 15.12 15.65 14.95 16.73 16.75 15.74 16.23 15.73 15.11 16.4 15.72 14.75 14.54 16.16 16.94 16.32 15.93 B0BMY6 Otulin 2 78.2928211 100362554 - 78.2928211 78.316417 ubiquitinyl hydrolase 1 None TRCPAEHEEDMYRAADEIEK None None None 16.89 15.58 18.38 16.92 17.46 18.78 17.78 16.18 16.71 16.5 17.08 17.12 17.61 16.97 17.7 16.63 16.73 16.65 18.29 16.98 18.1 16.98 17.26 17.01 17.37 16.24 17.68 17.67 15.74 18.03 17.83 F1M0Z1 Trio 2 78.5068741 310192 - 78.5068741 78.699794 triple functional domain protein None FGSSKFEFETNMVSLEGLTK None 601893 20847 19.3 17.76 18.52 18.9 18.56 19.56 18.96 18.64 20.41 19.16 18.06 20.26 19.73 19.84 19.89 19.31 19.82 19.22 19.77 17.55 20.11 19.48 19.36 19.57 18.71 19.93 19.11 19.63 19.27 19.25 20.47 M0R8U1 Dnah5 2 78.9810481 294854 + 78.9810481 79.101382 dynein heavy chain 5, axonemal None PHLLDQLEICQKSLTGYLEK None None None 16.61 14.2 15.81 15.98 15.27 16.82 16.72 15.24 15.77 15.59 17.13 16.39 16.96 16.28 16.72 17.43 16.25 15.92 16.97 15.88 16.87 17.49 16.94 16.0 17.6 16.96 15.51 17.6 16.2 16.85 16.92 F1M787 Ctnnd2 2 81.3296551 114028 + 81.3296551 82.015764 catenin delta-2 None KAEIRRQGGIQLLVDLLDHR None 604275 55574 19.58 17.69 19.18 19.13 18.67 18.57 18.74 18.23 20.22 19.74 18.74 19.67 20.02 20.57 18.63 18.81 19.55 19.96 20.43 18.09 20.54 20.13 19.96 20.04 18.79 20.26 19.42 19.46 19.68 19.8 19.76 O35116 Ctnnd2 2 81.3296551 114028 + 81.3296551 82.015764 catenin delta-2 None VLRNATGCLRNVSSAGEEAR None 604275 55574 17.23 17.55 18.21 17.9 17.39 19.39 17.97 17.51 19.34 19.48 17.95 19.48 19.43 19.35 18.89 18.0 19.39 18.39 18.55 17.05 20.03 19.46 19.48 19.52 17.09 18.1 18.24 18.99 18.27 18.34 18.27 Q7TP52 Cmbl 2 82.5692581 310201 + 82.5692581 82.591007 carboxymethylenebutenolidase homolog None EWLKSRNARKINREVDAVLR None 613379 100714 19.57 17.7 19.83 20.17 19.78 18.45 20.39 19.89 18.15 20.59 20.09 18.09 19.93 19.96 18.3 18.15 18.61 19.26 20.17 20.78 18.98 18.88 19.97 18.76 19.18 19.26 19.93 19.6 18.06 20.06 19.36 Q68FQ0 Cct5 2 82.5918061 294864 - 82.5918061 82.602963 t-complex protein 1 subunit epsilon None HRQMAEIAVNAVLTVADMER None 610150 6287 20.22 21.16 21.83 21.2 21.96 20.74 22.19 22.18 20.05 21.64 20.86 21.0 22.47 20.39 21.29 22.09 21.67 20.75 20.69 22.74 20.66 21.5 21.81 20.95 22.17 22.03 20.56 20.86 22.23 21.04 20.96 P27139 Car2 2 86.7416181 54231 - 86.7416181 86.756927 carbonic anhydrase 2 None SNGPENWHKEFPIANGDRQS None None 231 22.62 21.38 21.25 21.97 22.73 21.08 23.09 22.43 20.07 21.89 21.76 20.66 21.43 20.95 19.98 21.83 21.43 21.41 22.19 22.57 20.29 20.45 21.78 21.58 22.07 22.6 21.7 20.49 20.81 22.16 20.95 P14141 Ca3 2 86.7705691 54232 - 86.7705691 86.77931 carbonic anhydrase 3 None QPWSVSYDPGSAKTILNNGK None None 31298 18.03 16.47 17.55 17.86 17.01 16.67 17.36 17.61 16.35 16.7 17.68 16.49 16.22 16.21 16.76 16.24 15.8 16.69 18.03 17.84 17.67 17.11 17.58 16.85 18.0 16.59 17.18 16.41 17.16 16.52 16.86 B0BNN3 Car1 2 86.8619121 310218 + 86.8619121 86.872202 carbonic anhydrase 1 None EIVNVGHSFHVVFDDSSNQSVLK None None 29 20.63 19.78 19.79 20.22 20.23 18.66 21.29 21.64 19.46 19.85 21.79 20.48 19.62 20.06 18.64 19.92 20.27 20.82 20.12 20.34 19.86 19.14 19.04 20.79 19.69 19.97 19.02 19.89 19.18 19.92 20.8 D3ZW44 Ralyl 2 87.4827481 - 87.4827481 87.751004 rrm domain-containing protein None VDIEAIFSKYGKIVGCSVHK None None None 15.9 16.24 16.54 17.34 17.27 15.58 16.25 17.36 17.05 16.82 15.61 17.54 17.33 16.37 16.35 16.61 17.28 16.87 17.51 16.31 17.05 16.09 16.76 16.59 16.34 17.32 16.42 18.34 16.32 16.92 17.42 F7F855 Ralyl 2 87.4827481 294883 - 87.4827481 87.751004 raly rna-binding protein-like None VGGSSSSGSKLKSDELQTIK None None None 16.58 14.79 16.45 16.02 15.47 15.89 15.36 15.71 16.7 16.99 15.02 15.72 17.05 17.48 16.66 16.44 17.59 15.63 16.72 16.03 16.97 17.01 16.69 17.29 16.96 17.59 17.54 15.2 16.81 17.13 17.02 A0A0G2JUM9 Litd1 2 87.6945361 + 87.6945361 87.700053 lINE-1 type transposase domain-containing protein 1 None LKGPVNIFNKIIEENFPNLK None None None 17.12 15.32 15.92 15.79 17.58 16.61 16.79 17.94 15.15 17.52 16.28 15.77 16.41 15.77 17.2 16.3 16.21 16.92 16.04 17.2 15.89 16.72 17.84 16.79 17.67 17.46 14.86 17.17 17.19 17.07 16.76 A0A0G2JX54 Pcsk1 2 4.3955431 + 4.3955431 4.442433 neuroendocrine convertase 1 None SSSSSVEDRRDEQVQGAPSK None None None 16.08 16.87 17.06 16.29 15.87 16.27 17.3 16.53 15.09 16.98 16.18 15.27 16.55 16.15 16.66 16.29 16.5 15.9 14.83 17.35 15.11 16.93 15.87 16.01 16.02 17.45 16.43 15.43 16.16 16.18 15.48 P28840 Pcsk1 2 4.3955431 25204 - 4.3955431 4.442433 neuroendocrine convertase 1 BDP; PC1; PC3 None None None None 16.08 16.87 17.06 16.29 15.87 16.27 17.3 16.53 15.09 16.98 16.18 15.27 16.55 16.15 16.66 16.29 16.5 15.9 14.83 17.35 15.11 16.93 15.87 16.01 16.02 17.45 16.43 15.43 16.16 16.18 15.48 P57769 Snx16 2 91.336091 64088 + 91.336091 91.357615 sorting nexin-16 None QAFLQNLVAHKDIANCLAVR None None 11169 15.16 16.32 16.89 17.26 15.85 17.45 16.02 16.14 16.53 17.67 16.18 16.59 17.34 16.5 14.91 16.4 17.35 16.17 17.26 17.15 17.53 15.72 17.55 17.41 15.81 16.38 16.56 16.85 17.07 16.1 15.71 F1M978 Impa1 2 91.4627821 83523 + 91.4627821 91.483934 inositol-1-monophosphatase None VMIKSSPADLVTVTDQKVEK None 602064 4043 19.58 22.31 21.39 20.61 21.9 21.51 22.04 20.02 19.81 21.26 19.83 19.96 21.07 20.75 19.37 20.39 21.08 20.13 21.28 22.07 20.84 19.47 21.12 20.58 20.82 21.39 20.52 20.73 19.82 20.32 19.9 P97697 Impa1 2 91.4627821 83523 + 91.4627821 91.483934 inositol monophosphatase 1 None KGAFCNGQKLRVSQQEDITK None 602064 4043 19.34 21.94 20.97 20.43 21.59 21.34 21.8 20.18 19.94 21.22 19.57 19.94 21.1 20.37 19.29 20.38 20.92 20.03 21.2 22.0 20.57 19.41 21.07 20.58 20.75 21.59 20.54 20.67 19.64 20.13 19.87 P70623 Fabp4 2 91.580861 79451 + 91.580861 91.585563 fatty acid-binding protein, adipocyte None TEISFKLGVEFDEITPDDRK None 600434 36067 16.46 17.97 18.45 17.41 17.84 17.32 17.85 16.99 16.23 17.46 16.71 15.72 17.0 17.86 16.23 16.0 17.17 15.47 17.72 18.0 17.16 15.51 17.58 17.39 16.91 15.94 17.37 16.77 15.2 17.34 15.38 P55053 Fabp5 2 91.7650511 140868 - 91.7650511 91.768772 fatty acid-binding protein 5 None TTVFSCTLGEKFDETTADGR None 605168 108238 19.78 20.84 21.14 21.77 21.05 21.9 22.17 20.9 21.58 22.03 20.96 21.51 22.03 21.7 19.74 21.33 21.21 20.93 21.76 22.45 21.12 20.46 22.09 22.05 19.72 20.79 21.15 21.08 19.61 20.98 20.62 Q9JM80 Pag1 2 92.0573361 64019 + 92.0573361 92.069845 phosphoprotein associated with glycosphingolipid-enriched microdomains 1 None GHLVPKENDYESIGDLQQGR None 300822 37158 16.55 15.6 16.88 16.64 16.78 17.41 17.49 15.77 17.09 16.39 16.15 17.25 17.04 17.82 16.13 16.05 16.08 16.87 17.07 17.37 17.95 16.41 17.08 16.24 16.42 16.11 16.92 17.28 15.47 17.34 17.84 A0A0G2K865 Tpd52 2 92.7838931 294900 + 92.7838931 92.816109 tumor protein d52 None SQAGQKASAAFSSVGSVITK None None 38007 19.68 17.21 18.54 18.3 18.75 17.93 19.2 19.9 20.23 18.6 17.81 19.21 19.38 18.77 17.9 20.23 19.13 20.61 18.6 19.05 19.09 19.24 19.72 19.36 19.28 20.28 18.51 17.92 20.56 19.59 19.52 A0A0G2K8L9 Mrps28 2 92.8206361 689025 + 92.8206361 92.951301 mitochondrial ribosomal protein s28 None IHDSSAPRARSGGFASALER None None None 16.33 18.65 16.3 16.49 16.76 16.91 16.6 15.95 17.1 18.34 16.25 16.42 16.45 16.23 16.33 17.11 15.36 17.03 17.18 17.23 16.09 16.53 15.64 15.77 15.31 16.78 16.44 15.85 18.51 16.12 16.43 P21818 Stmn2 2 93.2046911 84510 - 93.2046911 93.252226 stathmin-2 None ASGQAFELILKPPSPISEAPR None 600621 5102 21.3 20.98 21.25 21.85 20.5 22.42 20.73 21.69 21.51 20.81 20.94 21.38 21.81 22.04 21.04 19.81 22.7 21.83 20.09 20.97 21.7 21.43 21.92 21.18 21.98 21.82 20.8 21.67 22.62 21.28 21.0 A0A0G2JSL0 Psb2 2 93.8338651 100360846 - 93.8338651 93.834635 proteasome subunit beta None SGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFK None None None 18.6 21.46 19.63 18.94 18.44 19.38 18.66 19.81 20.09 19.18 17.9 18.78 18.99 17.75 18.61 19.13 18.08 19.56 19.09 20.78 19.51 19.64 18.55 19.96 19.06 19.64 18.89 18.62 19.41 18.56 19.01 A0A0G2K782 Zc2hc1a 2 94.2873591 310244 - 94.2873591 94.324551 zinc finger, c2hc-type-containing 1a Fam164a; RGD1311970 None None None None 19.5 20.68 20.2 20.14 18.6 18.66 18.94 18.83 19.68 20.11 19.28 19.2 18.95 19.1 19.56 19.3 19.65 19.33 19.47 18.83 20.08 20.39 19.18 18.87 18.96 19.86 19.59 20.06 19.73 18.86 18.4 B5DF95 Zc2hc1a 2 94.2873591 310244 - 94.2873591 94.324551 family with sequence similarity 164, member a None PDYIQCPYCQRRFNENAADR None None 9338 19.5 20.68 20.2 20.14 18.6 18.66 18.94 18.83 19.68 20.11 19.28 19.2 18.95 19.1 19.56 19.3 19.65 19.33 19.47 18.83 20.08 20.39 19.18 18.87 18.96 19.86 19.59 20.06 19.73 18.86 18.4 P63249 Pkia 2 94.4007731 114906 - 94.4007731 94.473599 camp-dependent protein kinase inhibitor alpha None ALKLAGLDINKTEGEDDGQR None 606059 7473 17.17 14.7 17.0 17.1 16.1 15.58 17.13 16.1 16.59 16.16 16.37 16.37 16.96 16.66 17.94 16.99 17.48 16.16 15.78 16.15 16.3 18.51 16.99 16.82 17.27 18.1 17.1 15.61 16.52 17.36 17.24 D3ZIY3 Ythdf3 2 98.3506621 361920 + 98.3506621 98.38366 yth n(6)-methyladenosine rna-binding protein 3 None SLGRAITDGQAGFGNDTLSK None None 34991 18.31 16.37 17.36 18.42 17.57 18.49 17.09 17.59 19.35 17.23 18.08 18.74 18.62 19.13 19.01 16.98 17.56 18.57 17.94 17.02 19.03 17.98 18.65 19.17 18.09 17.96 18.43 18.45 17.85 18.19 18.75 M0RBL8 Tceal6 2 98.3378741 501628 - 98.3378741 98.338472 transcription elongation factor a (sii)-like 6 None PKNSQEDLQDRHVSSEEAMR None None None 20.79 19.25 21.34 21.29 20.34 20.18 22.47 19.83 21.19 20.78 20.42 20.32 21.34 20.89 20.17 20.04 20.04 21.38 20.66 22.0 22.32 21.44 21.45 20.14 20.71 21.6 20.52 20.55 20.82 21.34 21.38 G3V787 Cyp7b1 2 100.5027921 25429 - 100.5027921 100.669698 25-hydroxycholesterol 7-alpha-hydroxylase None FLQTLQRQYGDTFTVLLGGK None 603711 3544 16.86 17.6 18.37 17.67 17.54 17.64 17.22 15.41 16.54 16.37 17.04 16.26 17.37 17.57 16.08 17.57 18.64 16.28 18.07 17.5 18.27 16.86 18.4 18.35 18.72 17.74 17.87 17.5 15.48 17.49 17.52 Q63688 Cyp7b1 2 100.5027921 25429 - 100.5027921 100.669698 25-hydroxycholesterol 7-alpha-hydroxylase None PYLVSDIPIQLLRNAEFMQK None 603711 3544 16.9 16.94 18.43 17.57 17.38 17.48 17.0 15.31 16.85 16.16 16.88 15.94 17.23 17.42 15.88 17.29 18.51 16.15 17.77 17.34 18.07 16.74 18.16 18.13 18.36 17.24 17.78 17.33 15.33 17.13 17.59 M0RA78 Rpl30 2 100.7183621 100361143 - 100.7183621 100.718702 60s ribosomal protein l30 None SLESINSRLQIVMKSGKYIL None None None 18.15 16.17 16.49 18.18 17.45 17.21 16.43 17.97 18.6 17.78 17.91 18.31 18.35 18.6 18.97 16.84 18.42 17.73 17.01 17.55 18.27 18.23 18.27 19.08 17.53 19.41 18.49 17.06 18.35 18.16 18.44 B0BN83 Armc1 2 101.6082881 294948 - 101.6082881 101.652171 armadillo repeat-containing protein 1 None NKRAKTVVLHIDGLDDTSRR None None 10015 18.58 18.71 19.65 19.44 18.84 18.72 18.95 18.09 19.71 18.69 17.87 18.16 18.85 18.62 17.82 18.31 18.96 19.61 19.76 18.23 20.45 18.7 18.1 18.64 19.46 19.14 19.58 19.86 18.27 19.35 20.43 A0A0G2K9I6 Cp 2 102.4396431 24268 + 102.4396431 102.495004 ceruloplasmin None FIGSKYKKVVYREFTDSTFR None 117700 75 20.16 17.32 19.24 19.09 18.91 18.93 20.0 19.95 18.67 18.36 20.99 18.95 19.23 18.89 18.94 18.73 18.5 18.69 18.78 20.58 19.86 17.91 19.14 19.32 18.8 18.98 18.36 18.51 19.03 19.16 19.68 P13635 Cp 2 102.4396431 24268 + 102.4396431 102.495004 ceruloplasmin None QEQNVSNAFLDKEEFFIGSK None 117700 75 20.06 17.29 19.14 18.96 18.78 18.84 19.88 19.84 18.59 18.29 20.88 18.83 19.1 18.76 18.91 18.6 18.38 18.57 18.65 20.46 19.78 17.81 18.97 19.21 18.61 18.84 18.27 18.39 18.91 19.02 19.59 O08730 Gyg1 2 102.6118931 81675 - 102.6118931 102.65383 glycogenin-1 None GDSAHLTLMKRPELGITLTK None 603942 31219 17.88 15.27 17.58 17.21 17.75 17.32 17.77 17.6 16.31 16.75 18.38 16.77 17.81 16.41 17.05 18.13 18.43 17.42 16.32 18.26 16.01 17.8 17.83 17.08 18.4 17.23 17.56 17.19 16.92 17.9 17.9 D3ZNF4 Tbl1xr1 2 104.8017221 365755 + 104.8017221 104.929055 tbl1x receptor 1 None LAQQHAAAAAAAAAATNQQGSAK None None 69382 16.42 16.81 17.35 17.12 17.01 16.59 16.56 16.77 16.79 16.8 17.31 16.85 17.34 17.7 17.65 16.91 17.66 18.02 16.4 17.08 19.27 17.27 17.33 18.84 18.72 18.74 17.59 16.32 17.96 16.74 18.07 P03889 Nu1m 2 107.5188711 26193 + 107.5188711 107.518968 nadh-ubiquinone oxidoreductase chain 1 None IAMAFLTLVERKILGYMQLR None None 5011 17.11 14.79 16.13 16.83 17.7 16.5 16.81 16.51 16.23 17.13 15.04 16.5 16.8 16.92 17.0 17.3 16.11 16.91 17.81 15.53 16.02 15.34 17.27 15.9 17.8 17.53 16.62 16.93 17.21 17.36 17.27 Q62765 Nlgn1 2 108.2563241 116647 - 108.2563241 109.002295 neuroligin-1 None HVLSQKLDDVDPLVTTNFGK None 600568 56690 18.9 17.02 18.26 18.4 17.76 18.18 17.27 17.56 17.97 17.93 19.04 18.36 18.68 18.95 17.55 17.74 18.23 18.67 19.27 18.23 19.19 19.27 18.7 18.98 18.18 18.9 18.61 18.81 18.15 18.39 18.72 B2GV54 Nceh1 2 110.0749571 294930 + 110.0749571 110.135588 neutral cholesterol ester hydrolase 1 None TYILTCEHDVLRDDGIMYAK None None None 19.21 19.7 19.32 19.37 18.81 18.89 18.45 17.59 19.4 18.93 18.78 18.53 18.42 18.48 20.3 18.74 19.0 18.92 19.18 17.48 19.95 19.72 17.73 18.38 18.71 19.89 19.03 19.05 19.75 18.36 19.58 P70496 Pld1 2 110.849421 25096 + 110.849421 111.047692 phospholipase d1 None MPSLPRSSENAIQEEQFFGR None 602382 116234 18.08 14.84 17.28 17.25 16.95 16.65 16.36 16.7 16.27 17.26 17.61 15.75 16.55 16.25 16.12 16.67 18.05 17.04 15.65 16.72 16.41 17.18 16.89 17.55 17.54 16.36 15.95 15.69 17.95 16.86 16.6 A0A0G2K490 Tnik 2 111.1843881 294917 + 111.1843881 111.580407 traf2 and nck-interacting kinase None RRRAEHEQEYIRRQLEEEQR None None None 19.3 19.15 19.06 19.16 18.64 19.85 18.66 18.44 19.22 18.91 18.77 19.28 19.59 19.49 19.42 19.56 19.35 18.96 20.31 17.74 19.72 19.6 19.03 20.01 19.34 19.8 19.39 19.57 18.55 18.7 19.75 G3V7J7 Eif5a2 2 111.7293241 310261 + 111.7293241 111.746087 eukaryotic translation initiation factor 5a None GKKYEDICPSTHNMDVPNIK None None None 18.66 20.3 19.39 20.42 21.0 19.36 21.02 20.81 18.99 20.35 19.89 19.75 20.48 20.21 20.02 19.78 20.63 19.46 19.87 19.73 19.73 18.94 20.44 20.26 21.28 19.99 20.32 19.66 18.5 19.44 19.55 B2RZD5 Rpl22l1 2 111.7546881 361923 + 111.7546881 111.756617 rcg41580, isoform cra_a None FHLDLTHPVEDGIFDSGNFEQFLR None None 134069 16.44 18.5 17.24 16.57 16.23 16.76 15.83 17.07 16.23 16.48 17.11 16.45 16.21 16.57 17.69 17.18 15.76 17.45 17.53 16.28 16.45 17.25 16.36 17.43 17.52 17.45 17.57 15.72 17.09 16.62 16.16 A0A0G2K1G8 Slc7a14 2 112.0652871 499587 + 112.0652871 112.171318 solute carrier family 7, member 14 None NTCGAKNLPSLGDNEMLIGK None None None 18.61 16.62 18.9 17.36 16.96 18.84 17.52 17.63 18.26 18.88 17.9 16.94 18.51 17.96 18.78 18.58 18.52 17.47 17.57 17.68 17.48 19.28 17.73 18.17 16.63 17.91 18.4 18.68 17.19 18.71 18.09 Q99P82 Cldn11 2 112.2077431 84588 - 112.2077431 112.22105 claudin-11 None VVTCSYTIPTCRKMDELGSK None 601326 4093 23.38 21.4 23.37 22.06 23.11 23.1 22.08 23.03 21.79 23.46 23.9 21.11 22.58 22.3 22.55 23.45 23.16 21.73 22.11 23.6 21.99 22.3 23.24 22.9 22.26 22.56 22.79 21.36 24.03 23.44 21.58 F1M7Y5 Prkci 2 112.3219151 84006 - 112.3219151 112.382316 protein kinase c iota type None IIYRDLKLDNVLLDSEGHIK None 600539 37667 17.4 15.24 17.32 16.46 16.69 16.44 17.47 15.38 16.79 15.31 17.49 16.88 16.76 17.67 17.56 16.86 17.42 16.24 16.27 15.72 17.4 16.72 17.35 16.18 17.52 15.71 16.63 16.38 16.68 16.99 17.2 A0A0G2K2B0 Phc3 2 112.4087351 310258 + 112.4087351 112.47654 polyhomeotic homolog 3 None None None None 15.44 14.1 14.99 15.92 16.14 15.16 14.81 16.69 16.1 15.2 14.96 16.03 15.75 14.36 15.35 16.3 16.19 15.29 15.51 14.5 14.18 14.84 15.38 14.72 15.16 15.07 16.32 15.09 16.03 15.69 16.79 Q7TP42 Sec62 2 112.5719371 294912 - 112.5719371 112.601814 translocation protein sec62 None KKKDGEKEDSKKEETPGTPK None 602173 2449 19.86 19.29 19.5 17.87 18.14 18.0 18.35 18.58 18.72 18.65 17.65 17.7 17.85 18.04 18.91 18.65 18.07 18.58 17.66 19.26 19.36 18.55 17.35 19.03 18.18 19.0 18.21 18.36 18.14 18.38 18.81 A0A0G2K344 Pik3ca 2 115.2189211 170911 + 115.2189211 115.249032 phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform None YTLKINHDCVPEQVIAEAIR None 171834 21249 15.92 16.21 15.33 16.42 16.1 17.78 17.12 17.2 17.77 17.59 16.86 17.71 16.98 17.07 15.54 16.58 17.38 17.38 17.46 16.9 18.32 16.65 18.15 16.66 16.38 16.9 17.23 17.24 16.45 16.33 17.3 Q8R4Z9 Mfn1 2 115.3158791 192647 + 115.3158791 115.359642 mitofusin-1 None ELKVVSPLEARNRIFFVSAK None None 11481 17.24 15.74 16.67 17.6 16.95 16.12 16.43 15.84 15.73 16.41 17.41 18.1 16.87 16.97 17.67 17.22 17.15 16.5 16.5 15.35 16.51 17.4 16.38 17.29 16.79 15.98 16.04 16.37 17.67 16.85 17.87 O35353 Gnb4 2 115.3649191 294962 - 115.3649191 115.386795 guanine nucleotide-binding protein subunit beta-4 None QEAEQLRNQIQDARKACNDA None 610863 69140 21.23 24.17 21.1 21.73 21.74 21.36 21.98 23.02 22.07 23.03 20.87 22.07 21.62 21.36 21.26 22.32 22.45 22.66 21.18 21.56 21.62 21.62 21.47 21.49 20.77 22.72 20.36 22.1 23.41 21.12 21.64 Q4KM87 Actl6a 2 115.4921121 361925 + 115.4921121 115.509282 actin-like 6a None DGDKGKQGGPTYYIDTNALR None 604958 55811 16.62 17.04 17.88 16.63 17.16 17.15 16.76 16.1 17.14 15.96 17.56 16.9 16.23 17.1 17.28 16.94 16.72 17.48 16.1 17.79 18.85 16.61 16.65 17.57 18.0 15.97 16.5 17.12 17.73 17.59 18.77 Q3B8R7 Mrpl47 2 115.5078411 294963 - 115.5078411 115.518982 mitochondrial ribosomal protein l47 None PMPSPERLEKVVDSMDALDK None 611852 32475 15.68 18.03 16.82 16.92 16.25 16.98 15.98 17.23 16.71 15.69 16.13 18.03 16.55 16.56 18.23 18.61 17.26 16.21 16.57 16.16 16.21 17.6 17.05 17.76 18.64 16.87 17.87 17.26 16.59 16.69 17.06 D4A565 Ndufb5 2 115.5192491 294964 + 115.5192491 115.533589 complex i-sgdh None KNYEKTLAILQIESEKADLR None None 31093 20.11 22.25 20.35 19.13 19.77 20.07 20.79 19.66 19.89 22.0 19.14 20.36 19.07 20.59 20.37 21.34 20.58 20.18 21.1 19.37 20.6 21.19 20.1 19.2 20.84 20.61 20.15 20.02 21.51 19.6 20.39 D3ZDI9 Usp13 2 115.5770781 310306 + 115.5770781 115.68871 ubiquitin carboxyl-terminal hydrolase None EGRWVIYNDHKVCASERPPK None 603591 68372 16.3 14.89 16.52 16.86 16.99 15.07 16.75 15.29 15.94 15.4 17.44 15.2 16.75 16.38 14.98 15.21 16.14 16.37 16.01 17.56 16.29 16.88 16.37 15.44 17.42 16.3 15.94 16.86 15.67 17.05 15.48 Q925N3 Pex5l 2 115.7007591 286937 - 115.7007591 115.90812 pex5-related protein None YFHTENPFKDWPGAFEEGLK None 611058 9562 19.72 16.88 17.56 18.46 18.63 19.21 18.17 18.39 17.83 18.74 19.34 18.61 18.36 18.46 17.95 19.14 19.7 18.93 18.03 17.21 17.54 17.61 19.3 18.36 18.98 18.13 17.83 18.08 19.5 18.7 17.67 D3Z8K2 Ccdc39 2 116.6652621 310315 - 116.6652621 116.70335 coiled-coil domain-containing protein 39 None EYQRQEANRNQLKDELDTLK None None 12149 16.93 14.3 16.58 17.59 16.98 15.33 17.72 17.75 15.85 15.47 17.18 15.99 17.15 16.31 17.21 16.81 15.56 17.76 16.2 16.19 15.66 15.99 17.09 15.74 17.74 18.0 16.13 16.54 16.37 17.24 16.96 M0R6L8 Dnajc19 2 116.9232721 502525 + 116.9232721 116.945263 dnaj heat shock protein family (hsp40) member c19 None VGLTIAAAGFAGRYVLQAMK None None None 17.49 19.26 17.31 18.35 17.39 15.0 16.25 17.76 18.0 16.67 17.28 16.45 16.49 17.72 17.53 17.28 17.83 16.64 16.21 17.85 16.45 16.97 16.66 18.35 17.71 18.26 17.32 17.67 16.64 16.6 16.96 Q5XI81 Fxr1 2 116.8842821 361927 - 116.8842821 116.936503 fragile x mental retardation syndrome-related protein 1 None ERKDELSDWSLAGEDDRETR None 600819 3573 19.32 18.89 18.59 18.74 17.89 17.7 17.82 18.38 17.7 18.51 19.49 18.3 18.04 19.03 19.52 17.57 18.67 18.38 18.66 16.9 17.97 18.66 17.11 18.65 18.8 17.96 19.32 18.08 18.05 18.24 19.21 A0A0G2K3P7 Atp11b 2 118.6145561 361929 + 118.6145561 118.690005 phospholipid-transporting atpase None DAVLNYLLQDKVRETIEALR None 605869 32919 15.85 16.05 15.87 14.99 14.57 15.95 15.53 15.45 14.85 16.06 17.15 15.23 15.31 16.16 15.75 15.5 14.83 15.99 16.15 15.93 17.39 16.27 15.65 15.99 16.43 16.0 14.8 16.79 16.01 15.27 15.11 A0A0G2K8D6 Dcun1d1 2 118.7218221 310324 - 118.7218221 118.772602 dcn1-like protein None DWKLDVATDNFFQNPELYIR None 605905 10773 18.5 19.72 17.85 17.54 18.45 17.55 17.34 17.0 17.3 17.28 17.76 18.27 17.32 17.07 16.99 18.87 16.87 18.58 17.68 18.79 17.77 18.01 17.11 18.14 17.18 17.79 18.36 17.32 17.1 16.82 17.43 F1LP30 Mccc1 2 118.799151 294972 - 118.799151 118.851222 methylcrotonoyl-coa carboxylase subunit alpha None SEGAQANRHAPLVEFEEEEV None 609010 10603 18.19 20.53 18.73 18.98 18.52 17.26 19.42 17.11 17.97 17.79 20.03 18.03 18.2 19.72 19.22 18.98 17.1 17.9 19.69 18.93 19.11 18.21 17.8 19.1 19.25 18.06 19.51 17.33 17.56 17.94 18.76 Q5I0C3 Mccc1 2 118.799151 294972 - 118.799151 118.851222 methylcrotonoyl-coa carboxylase subunit alpha None YSLHQYNIVGLRTNVDFLLR None 609010 10603 18.19 20.53 18.79 19.01 18.53 17.27 19.42 17.12 17.97 17.72 20.02 18.02 18.2 19.71 19.22 19.01 17.1 17.9 19.69 18.93 19.07 18.19 17.8 19.1 19.32 18.08 19.51 17.33 17.56 17.94 18.76 B1WC61 Acad9 2 118.94311 294973 + 118.94311 118.966153 complex i assembly factor acad9 None RMLRDARILLIFEGTNEILR None 611103 8539 19.18 20.94 18.71 19.71 20.46 18.72 18.68 18.35 19.64 20.47 20.71 20.3 19.05 20.27 19.05 20.52 19.27 18.92 20.42 21.03 20.51 18.89 20.41 19.96 18.0 20.21 21.38 18.81 19.68 19.26 20.22 Q32KK0 Arse 2 119.0394751 310326 + 119.0394751 119.046548 arylsulfatase e None GGVLPSDREIDGRDLLPLLR None 300180 55428 16.25 15.41 16.15 16.72 15.93 14.63 17.31 16.81 15.83 16.11 18.3 15.16 17.02 16.75 14.58 15.26 16.29 16.22 17.08 16.15 16.81 16.2 17.46 16.58 16.05 15.43 16.75 14.87 15.32 16.1 14.99 P14668 Anxa5 2 119.3139921 25673 - 119.3139921 119.344661 annexin a5 None QQIAEEFKTLFGRDLVNDMK None 131230 20312 22.62 21.52 21.47 20.69 22.35 19.61 21.59 22.03 21.45 20.48 21.9 20.91 20.81 21.84 19.78 21.51 21.55 21.71 21.27 21.34 19.66 20.58 20.92 21.06 21.79 21.06 21.53 21.73 19.73 21.53 21.48 Q66HH8 Anxa5 2 119.3139921 25673 - 119.3139921 119.344661 annexin Anx5; CPB-I; LC5 None None None None 22.62 21.52 21.47 20.69 22.35 19.62 21.67 22.03 21.46 20.47 21.91 20.91 20.81 21.84 19.78 21.51 21.55 21.71 21.27 21.34 19.66 20.58 20.92 21.09 21.79 21.05 21.49 21.67 19.72 21.53 21.48 Q4QR75 Exosc9 2 119.4160531 294975 + 119.4160531 119.446239 exosome complex component rrp45 None FRCSKIAGVKVAEITELIQK None 606180 3693 15.84 14.79 16.03 15.61 14.81 16.21 14.93 15.63 15.21 15.49 16.16 15.4 14.91 15.38 17.57 15.52 15.88 15.51 15.37 15.16 17.39 15.63 15.86 15.54 17.34 15.08 16.53 14.85 16.72 16.82 16.19 Q66H90 Bbs7 2 119.4347471 361930 - 119.4347471 119.474529 bardet-biedl syndrome 7 protein homolog None ADYLQVGVTSQKTMKLLPTS None 607590 12395 17.05 15.02 17.9 17.68 16.11 16.66 17.3 16.48 16.49 16.8 16.67 16.05 17.06 15.95 17.01 16.91 17.41 16.78 16.24 17.41 16.79 18.01 16.6 16.59 17.01 16.93 17.41 16.59 16.17 17.48 17.32 Q9JMI9 Trpc3 2 119.4812351 60395 - 119.4812351 119.558841 short transient receptor potential channel 3 None YELLEDKSQATEELAILIHK None None 20708 15.64 14.61 15.79 15.79 15.91 15.18 15.8 15.61 16.49 15.3 14.93 16.65 16.23 16.72 16.63 15.17 14.92 16.01 16.94 15.28 16.94 15.79 15.8 14.86 16.06 15.84 16.74 16.93 15.32 16.31 17.23 A0A096MJT6 Rgd1307100 2 119.7081411 294978 + 119.7081411 119.9247 similar to riken cdna d630029k19 None RLPVHGTTDGPECPAAFLER None None None 17.43 16.38 18.3 18.61 17.83 18.96 17.83 16.36 18.61 16.93 19.25 17.27 18.81 17.54 18.17 17.73 18.56 17.48 18.89 16.39 19.15 17.6 18.72 18.46 17.36 17.06 17.81 17.9 17.68 17.89 18.13 P13109 Fgf2 2 120.2363291 54250 + 120.2363291 120.291221 fibroblast growth factor 2 None DGVREKSDPHVKLQLQAEER None 134920 1521 15.75 18.95 16.26 17.28 17.71 16.18 17.23 17.51 16.59 16.73 15.98 16.93 16.07 16.47 17.18 17.47 17.04 17.15 16.3 16.72 15.74 16.02 16.95 15.86 17.34 18.67 16.01 16.86 18.31 16.51 16.32 F1LWB9 Ankrd50 2 121.4659011 294988 - 121.4659011 121.500664 ankyrin repeat domain 50 None QEVLQLLIRAGAHVNSEDDR None None 16855 16.44 17.27 17.08 16.63 14.83 14.76 16.61 16.09 15.75 16.33 16.81 15.13 15.81 15.57 16.6 15.31 16.57 15.85 16.86 14.46 17.06 17.34 15.39 15.58 17.23 16.06 14.9 17.19 15.83 15.56 16.11 D3ZEH1 Fat4 2 121.9284921 310341 + 121.9284921 122.039539 fat atypical cadherin 4 None VTKNVKVGTKLIKVTAVDDK None 612411 14377 21.04 18.72 20.28 20.3 19.7 19.59 20.15 21.39 20.24 20.51 22.07 20.7 20.74 21.48 19.26 20.35 20.37 21.02 20.42 20.78 20.69 19.95 20.83 20.03 19.95 20.45 19.09 20.94 21.81 20.76 20.98 D3ZB81 Slc25a31 2 123.6954421 689108 + 123.6954421 123.711222 solute carrier family 25 member 31 None LANVIRYFPTQALNFAFKDK None 610796 69485 23.57 25.56 22.67 24.44 24.48 22.94 22.95 25.09 23.74 23.97 22.76 23.53 23.25 22.64 25.05 24.46 23.59 23.38 24.15 22.43 22.61 23.06 23.11 23.95 24.14 25.41 24.68 23.99 23.49 23.12 23.63 F7F2F3 Hspa4l 2 123.7403311 294993 + 123.7403311 123.793088 heat shock 70 kda protein 4l None LSAMLEDTENWLYEEGEDQPK None None 22610 22.34 20.9 20.95 21.52 22.98 20.95 21.58 22.21 21.46 20.94 20.4 21.32 21.84 20.98 20.61 20.72 21.44 21.92 20.72 23.04 20.88 21.12 21.3 21.17 22.14 22.36 21.34 21.7 21.27 21.83 22.48 Q5XIU9 Pgrmc2 2 124.0682611 361940 - 124.0682611 124.084155 membrane-associated progesterone receptor component 2 None LSTLGSGGERGGDGSPGGAG None 607735 38169 19.2 17.02 18.12 19.13 18.99 16.86 18.24 19.27 17.7 18.35 19.04 17.96 19.41 18.07 18.91 19.3 18.78 19.27 17.86 19.0 18.17 18.56 18.74 18.96 19.82 20.05 18.2 18.91 18.94 19.3 18.16 F1M6B6 Pcdh10 2 128.6180491 361943 + 128.6180491 128.639053 protocadherin 10 None PGYLLTRVAAVDADDGENAR None 608286 74967 18.3 16.62 17.94 18.73 17.23 16.68 17.07 16.98 17.79 18.43 17.46 17.62 18.2 18.3 17.8 16.89 18.64 16.75 18.06 17.44 17.78 18.78 18.17 19.1 17.39 18.21 17.69 17.7 16.89 17.52 17.4 D4ADU2 Slc7a11 2 134.4430431 310392 - 134.4430431 134.517358 solute carrier family 7 member 11 None KPVVATISKGGYLQGNVSGR None None 22684 17.55 16.2 16.99 15.59 17.46 15.26 16.02 15.56 15.63 16.84 16.08 15.4 15.08 17.08 16.88 15.44 17.14 14.94 16.6 15.27 17.38 15.1 16.02 17.09 16.32 17.06 17.18 15.32 15.47 16.24 16.33 Q9ET55 Noct 2 135.271191 310395 + 135.271191 135.2914 nocturnin None LCSALLLRDAPGLRRTLVPG None 608468 7661 15.5 14.79 15.55 16.63 16.73 16.9 16.85 14.93 16.73 16.84 15.66 17.18 17.18 15.85 16.87 17.67 16.82 16.88 16.11 15.48 15.59 16.8 17.36 15.75 15.44 16.56 17.35 16.26 15.37 16.47 16.38 D4A4W7 Mgarp 2 135.4312841 689931 - 135.4312841 135.439425 mitochondria-localized glutamic acid-rich protein None TKAELQPLPGETEHVAEAGK None None None 13.8 15.33 13.89 16.01 14.7 14.7 16.27 15.11 16.12 15.94 15.31 15.32 15.67 15.81 15.08 15.02 16.59 14.46 14.86 15.2 16.12 14.52 16.45 15.72 14.63 16.09 15.33 14.61 14.59 14.8 14.52 D3ZD89 Naa15 2 135.4580191 310399 + 135.4580191 135.520756 n(alpha)-acetyltransferase 15, nata auxiliary subunit None QQRNQKKKKDDDDEEIGGPK None None None 18.86 19.15 18.63 19.12 18.64 17.45 18.71 19.97 17.84 18.35 17.91 18.59 19.08 18.47 20.03 19.78 19.45 18.58 18.06 18.24 18.06 18.03 17.68 19.12 19.71 20.3 19.46 19.65 17.15 18.34 19.39 F1LW77 Rab33b 2 135.5281171 365793 + 135.5281171 135.538719 rab33b, member ras oncogene family None DLAQKFADTHSMPLFETSAK None None 9642 17.24 16.84 17.48 16.3 16.71 18.11 17.73 17.08 18.24 17.57 16.33 17.81 17.58 17.48 18.08 17.57 17.9 17.26 17.8 15.85 18.4 17.36 17.4 17.67 17.02 16.78 17.34 17.26 17.28 17.79 18.03 D4ADE5 Setd7 2 135.5626841 689954 - 135.5626841 135.605468 histone-lysine n-methyltransferase setd7 None NTVMSFYNGVRITHQEVDSR None None None 18.93 18.42 18.82 18.22 19.41 18.49 19.12 18.29 19.89 19.01 18.1 19.4 18.38 18.73 18.07 18.84 18.97 18.6 19.11 19.45 20.12 18.23 18.54 18.29 19.05 17.95 19.43 19.2 18.09 18.97 19.88 Q68FP9 Cog6 2 137.0613161 310411 - 137.0613161 137.099188 conserved oligomeric golgi complex subunit 6 None LHKILETRLENDKEMLEALK None 606977 10802 14.8 17.49 15.28 16.2 15.14 16.43 16.03 14.52 16.58 15.44 17.93 16.04 16.94 16.01 16.33 15.55 16.25 16.26 16.87 14.33 17.25 16.78 15.32 15.72 15.78 15.52 16.1 17.07 15.13 15.38 16.29 D4A2F6 Nhlrc3 2 137.531 310416 - 137.531 137.542231 nhl repeat-containing 3 None GTGPAKFNIPHSVTLDSVGR None None 35239 14.92 17.08 14.9 15.78 16.01 15.02 15.14 16.84 15.01 16.21 15.01 15.49 14.54 14.49 13.84 15.19 15.35 15.33 15.21 15.86 14.37 14.52 14.84 14.93 14.44 14.58 15.16 15.09 15.32 14.74 15.01 Q5BJP3 Ufm1 2 137.969481 365797 - 137.969481 137.97762 ubiquitin-fold modifier 1 None VPAATSAIITNDGIGINPAQTAGNVFLK None None 9594 19.16 20.49 17.84 19.38 19.22 17.79 18.32 19.48 17.59 20.2 18.11 18.89 18.11 17.7 18.56 19.47 17.39 20.1 18.05 18.22 17.05 17.66 17.84 17.65 18.63 18.67 18.56 18.95 19.28 17.62 18.43 A0A0G2K5A0 Exosc8 2 138.9303091 295050 - 138.9303091 138.936702 ribosomal rna-processing protein 43 None AVTRHKEVSKLLDEVIQSMK None 606019 12323 15.02 17.06 16.64 15.91 15.85 14.12 15.54 16.3 15.3 15.89 15.06 15.04 14.97 14.77 14.93 15.22 16.35 14.79 14.68 15.87 16.02 15.62 14.81 16.49 16.27 14.05 14.5 15.12 15.91 15.2 15.32 Q4QQS6 Alg5 2 138.9375021 295051 + 138.9375021 138.951228 dolichyl-phosphate beta-glucosyltransferase None GVFSSRGEKILMADADGATK None None 7060 17.15 15.09 16.12 15.9 16.07 16.88 16.78 14.96 15.81 17.66 16.92 16.75 16.27 17.1 18.17 16.6 16.55 16.08 16.88 15.51 17.61 17.87 16.47 15.93 16.88 16.98 16.34 17.21 16.37 17.57 17.23 G3V603 Smad9 2 138.9566011 103691556 + 138.9566011 139.002804 mothers against decapentaplegic homolog None RFCLGLLSNVNRNSTIENTR None None None 15.91 16.12 15.13 16.13 14.18 15.79 15.29 16.74 14.73 15.63 16.27 15.46 16.23 15.85 15.99 15.67 16.12 16.33 16.3 14.03 15.17 16.5 14.15 15.69 16.23 16.83 15.48 15.81 16.01 16.09 16.88 E9PT90 Spart 2 139.2923211 295053 + 139.2923211 139.319197 spartin None LRERIQPEEKPVEVSPAVTR None 607111 32243 18.68 19.04 19.36 18.51 17.92 18.85 19.63 18.77 17.87 17.81 19.67 17.23 18.4 17.7 18.81 18.82 19.16 18.26 18.26 17.69 17.63 19.37 18.07 17.89 19.04 18.58 18.94 18.19 17.52 18.69 17.43 A0A0G2KB92 Dclk1 2 139.4171811 83825 + 139.4171811 139.708494 serine/threonine-protein kinase dclk1 None VCSSMDENDGPGEEESDEGFQIPATITER None 604742 113377 21.14 20.92 20.76 21.36 20.02 20.58 20.37 20.71 20.42 20.34 20.72 20.7 20.99 20.14 21.33 21.51 20.7 21.25 20.96 19.15 20.97 20.76 20.7 21.21 21.34 21.32 21.24 20.79 19.9 19.63 20.96 A0A1W2Q6Q2 Dclk1 2 139.4171811 83825 + 139.4171811 139.708494 serine/threonine-protein kinase dclk1 None RNGDRYFKGIVYAISPDRFR None 604742 113377 21.15 20.75 20.76 21.36 20.04 20.59 20.44 20.7 20.43 20.33 20.72 20.71 21.04 20.15 21.3 21.51 20.74 21.25 20.97 19.15 20.98 20.76 20.71 21.15 21.33 21.31 21.14 20.88 19.91 19.73 20.98 O08875 Dclk1 2 139.4171811 83825 + 139.4171811 139.708494 serine/threonine-protein kinase dclk1 None KKSKCRGKEHMIQNEVSILR None 604742 113377 20.19 19.45 19.96 20.12 18.83 20.21 19.19 19.55 19.9 19.93 20.05 19.78 20.27 19.64 20.01 20.14 20.08 20.64 20.21 18.24 20.65 20.12 20.05 20.31 19.85 19.86 20.81 20.35 18.84 19.24 19.91 D3ZLN7 Commd2 2 141.8486621 688478 - 141.8486621 141.852907 comm domain containing 2, isoform cra_c None QLYLDNRKEIRTILNELAPR None None 9381 17.22 18.87 17.96 16.87 17.59 16.92 18.26 15.5 16.03 16.63 17.7 16.46 16.24 17.56 16.3 16.56 16.24 18.59 16.23 17.57 17.74 17.57 16.25 17.16 18.35 16.94 17.42 16.38 16.17 16.44 17.06 Q9EPC6 Pfn2 2 142.002661 100909840 - 142.002661 142.082384 profilin-2 None KCSVIRDSLYVDSDCTMDIR None None None 20.76 22.34 21.75 21.39 22.35 23.18 22.71 22.13 22.13 22.8 21.98 22.44 22.71 22.66 20.29 21.48 22.03 22.1 22.11 23.15 21.27 21.58 23.14 21.11 20.44 21.64 20.85 21.76 23.04 21.51 20.57 D3ZDW3 Tsc22d2 2 142.6467771 499624 + 142.6467771 142.693606 tsc22 domain family, member 2 None MDLVKSHLMYAVREEVEVLK None None 8860 20.07 17.58 19.49 20.25 20.45 18.34 19.26 20.54 20.73 18.89 19.77 19.23 20.06 18.54 19.59 20.17 19.52 18.76 19.74 20.43 18.22 18.82 20.04 18.92 19.77 19.96 20.33 20.55 18.79 19.98 19.81 D3ZUV3 Eif2a 2 142.7612121 502531 + 142.7612121 142.794506 eukaryotic translation initiation factor 2a None CKVYTFSKDGTLFAWSNGEK None 609234 5969 17.53 15.84 17.48 17.37 17.11 16.84 16.57 16.6 16.53 16.85 18.47 17.32 17.63 17.59 16.34 16.25 16.07 18.37 16.82 18.11 17.95 17.3 17.58 17.62 17.87 16.24 17.86 16.85 16.79 17.68 17.44 Q1H5H1 Selenot 2 142.80441 365802 + 142.80441 142.819263 thioredoxin reductase-like selenoprotein t None LKFQICVSUGYRRVFEEYMR None None 32304 17.25 16.6 16.55 16.32 16.09 16.29 16.66 16.15 16.93 17.79 16.21 15.86 15.98 17.27 17.37 14.7 16.56 16.4 16.95 16.22 16.71 17.15 15.85 15.63 15.64 16.27 16.53 16.55 17.1 15.18 17.15 A0A0G2JV69 Med12l 2 143.2534181 690752 + 143.2534181 143.573163 mediator complex subunit 12l None KAIMMLGDAKIGSNNVNTLK None None None 15.59 17.37 15.69 15.56 16.33 16.39 15.94 16.91 16.42 15.96 14.67 16.66 15.63 16.94 16.73 16.07 16.7 15.56 16.8 15.9 15.66 15.63 16.35 15.66 16.76 17.14 16.07 16.43 17.04 16.38 15.06 A0A0G2JX72 Mbnl1 2 144.6977611 282635 + 144.6977611 144.811269 muscleblind-like-splicing regulator 1 None PDTECKFAHPSKSCQVENGR None 606516 23186 18.04 16.95 17.89 18.44 18.77 16.43 17.33 18.89 17.9 18.03 16.87 16.83 18.4 17.23 18.11 18.25 18.05 17.94 18.44 16.72 17.01 17.19 17.75 18.47 18.9 18.63 17.85 16.46 18.97 18.12 18.73 P61227 Rap2b 2 145.5997151 170923 + 145.5997151 145.600265 ras-related protein rap-2b None DQIIRVKRYERVPMILVGNK None None 55701 20.63 19.14 19.99 19.83 18.93 20.84 20.74 20.03 19.8 21.37 19.6 19.82 20.56 19.69 20.32 20.82 20.78 19.75 20.11 18.86 19.69 20.63 20.46 19.22 18.76 20.63 19.78 21.15 19.09 19.89 19.94 D4A2Z8 Dhx36 2 146.856471 310461 - 146.856471 146.894572 atp-dependent dna/rna helicase dhx36 None SDEAVVLSIKHLMELSALDK None 612767 6356 17.61 14.85 17.04 16.67 15.48 15.59 15.55 15.86 16.62 17.32 16.79 16.02 16.99 17.08 16.74 15.94 17.41 16.64 17.37 16.43 18.21 18.1 16.9 17.54 17.98 17.2 17.47 15.62 17.5 17.33 17.52 P07861 Mme 2 147.7266111 24590 + 147.7266111 147.803636 neprilysin None TSSRYSNFDILRDELEVILK None 120520 5275 16.69 13.93 16.47 16.09 16.36 16.7 16.86 15.62 16.23 15.68 16.54 15.4 16.09 16.35 14.68 15.48 16.93 15.91 15.44 17.03 15.29 17.57 16.75 14.75 16.53 15.69 15.61 16.04 16.91 16.69 16.4 A0A096MJW8 Plch1 2 148.1489091 310463 - 148.1489091 148.314359 phosphoinositide phospholipase c None HMPEIALVRFLVWDHDPIGR None 612835 88833 16.96 19.18 16.38 17.57 17.3 16.74 18.25 16.53 16.83 17.04 16.48 17.12 16.75 18.35 17.97 16.49 17.66 16.72 17.42 16.39 17.71 16.91 16.66 15.92 18.08 18.88 16.4 17.51 18.08 16.53 17.16 Q6AYY8 Slc33a1 2 148.4155781 64018 - 148.4155781 148.43812 acetyl-coenzyme a transporter 1 None LLILTSKIGFSAADAVTGLK None 603690 3476 16.97 14.46 16.58 16.45 15.89 17.6 16.72 15.75 16.77 17.28 17.31 15.88 17.17 17.47 16.58 16.28 15.97 16.29 17.59 16.97 16.89 16.26 16.94 15.66 15.83 16.23 16.38 16.91 17.16 17.11 16.99 Q4V7C6 Gmps 2 148.4510781 295088 + 148.4510781 148.485875 gmp synthase [glutamine-hydrolyzing] None HIDNGFMRKRESQSVEEALK None 600358 68367 19.85 17.73 19.81 18.85 19.0 18.39 20.04 18.96 18.88 19.05 18.24 18.78 19.25 19.14 18.59 18.55 18.5 18.84 19.54 19.72 20.15 19.17 19.15 18.77 19.39 19.41 19.65 19.07 17.62 19.31 19.83 P63144 Kcnab1 2 149.3044461 29737 + 149.3044461 149.603534 voltage-gated potassium channel subunit beta-1 None IQVLPKMTSHVVNEIDNILR None 601141 56491 21.48 18.54 18.24 19.8 20.76 20.43 19.32 19.89 19.66 20.34 19.8 19.81 19.76 19.34 19.93 20.05 19.35 19.63 19.38 20.11 18.55 18.56 19.45 19.42 19.27 20.23 18.88 19.39 21.37 19.35 19.81 Q08013 Ssr3 2 149.6050111 81784 - 149.6050111 149.608536 translocon-associated protein subunit gamma None KREDAVSKEVTRKLSEADNR None None 2314 17.29 15.58 17.18 16.95 16.64 16.08 16.5 17.14 17.35 16.09 18.22 17.24 17.64 17.91 18.13 15.87 17.78 16.84 15.64 16.76 18.27 16.61 17.77 16.58 18.31 15.83 17.3 18.17 17.25 17.65 17.46 A0A096MJZ4 Ralbp1 9 0.3712211 - 0.3712211 0.372408 ralA binding protein 1 None EELQIILEDLQRQNEELEIK None None None 16.03 14.59 16.57 16.45 15.62 18.1 16.83 15.4 17.5 16.84 17.43 16.46 17.18 16.73 15.87 16.86 16.96 16.65 15.8 17.98 16.81 17.5 16.47 17.27 14.78 17.0 17.26 16.93 15.54 17.42 17.02 F1M8S9 Lekr1 2 149.8911071 361953 + 149.8911071 150.059469 leucine, glutamate and lysine-rich 1 None ERFELTEALSQAKEQLLELK None None None 16.96 14.97 16.77 16.21 16.42 17.46 16.1 17.92 15.51 15.73 17.19 15.96 16.99 16.0 18.24 17.19 15.72 16.3 16.5 16.24 15.49 16.3 16.69 15.57 17.49 17.35 17.57 17.43 16.39 17.11 17.27 Q5PPJ2 Rsrc1 2 151.2311321 361956 + 151.2311321 151.557964 serine/arginine-related protein 53 None TAIKYQDDNSLAHPNLFIEK None 613352 41147 15.3 14.44 15.81 15.72 15.46 15.42 16.37 15.28 15.89 14.78 15.29 16.12 15.98 15.93 15.32 14.8 16.21 16.23 15.27 15.57 17.27 16.21 16.23 15.62 16.56 15.81 15.62 15.02 16.54 16.34 16.93 Q07803 Gfm1 2 151.7005761 114017 + 151.7005761 151.745432 elongation factor g None IRRATLSRSFTPVFLGSALK None 606639 6449 18.71 20.64 18.04 19.46 19.0 18.16 19.58 17.97 17.59 17.69 18.65 18.71 17.87 19.15 18.59 18.58 18.91 17.76 19.42 19.07 18.65 18.17 18.59 19.05 20.26 19.79 18.81 18.27 17.75 18.01 18.38 Q64361 Lxn 2 151.7275581 59073 - 151.7275581 151.733426 latexin None MGQGSAPEVNFTFEGEIGKNPDEEDNTFYQR None 609305 36361 18.41 17.99 18.51 17.97 20.35 18.83 18.25 19.69 19.96 19.76 19.06 20.12 20.07 18.57 19.85 20.26 18.11 20.68 18.77 18.36 18.96 18.12 19.26 18.44 17.76 18.22 20.26 20.29 18.27 19.39 19.49 Q56R17 Kpna4 2 153.3257061 361959 - 153.3257061 153.380779 importin subunit alpha None KGRDLETMRRQRNEVVVELR None None None 19.44 17.48 20.25 18.97 18.59 19.38 19.86 18.07 19.3 19.03 20.48 18.1 20.11 19.51 17.94 19.7 19.19 19.97 19.7 19.38 20.04 20.24 19.8 18.53 19.87 18.73 18.77 19.91 19.8 19.76 19.72 M0R5V1 Ppm1l 2 153.761971 310506 + 153.761971 153.839434 protein phosphatase, mg2+/mn2+-dependent, 1l None EYVKSRLPEALKQHLQDYEK None 611931 33158 15.16 17.19 15.85 16.49 16.47 15.31 15.48 16.22 16.16 15.21 15.9 16.79 15.4 15.89 15.32 14.59 16.42 14.79 15.89 17.2 16.14 16.47 15.41 15.55 16.78 14.83 15.05 16.23 16.88 15.49 17.16 D4A250 Rgd1563620 2 153.9589561 310511 + 153.9589561 153.960757 similar to retinoblastoma-binding protein 4 None ETILASSGTDRRLNVWDLSK None None None 18.34 17.72 18.86 18.29 19.02 18.6 17.44 17.84 18.42 18.33 17.37 19.17 18.64 18.91 19.4 18.37 18.01 18.41 18.52 19.03 20.26 18.17 18.98 18.87 19.86 18.38 19.17 18.05 19.68 19.38 19.64 F6PUQ7 Nmd3 2 154.0129831 310512 + 154.0129831 154.038466 60s ribosomal export protein nmd3 None DERQYQDFLEDLEEDETIRK None 611021 6127 15.84 13.28 16.5 15.44 15.31 14.85 15.39 14.58 15.37 15.46 14.99 14.12 16.09 15.23 16.79 17.2 14.99 16.57 14.95 14.65 15.67 14.94 15.8 15.29 16.99 15.65 15.5 16.61 14.54 16.41 16.0 A0A0G2K1W6 Litd1 2 154.999371 - 154.999371 155.000628 lINE-1 type transposase domain-containing protein 1  None MEERISGAEDSIEIIDSTVK None None None 18.72 16.47 17.13 17.68 19.3 17.12 18.21 18.91 16.91 18.0 18.43 17.45 17.71 17.29 18.62 17.82 17.63 18.34 17.46 18.62 17.28 18.12 18.87 18.21 19.57 18.63 16.28 18.59 18.61 18.38 18.55 D4A062 Slitrk3 2 157.6885041 310519 - 157.6885041 157.696555 slit and ntrk-like family, member 3 None YPDLQQDARLKETLLFSAGK None 609679 8955 15.64 13.05 14.6 15.58 14.72 14.91 15.45 14.68 15.09 15.96 15.41 15.78 15.99 15.8 15.24 15.45 14.57 16.5 14.75 15.46 15.76 15.92 16.07 15.31 15.68 15.99 15.01 15.72 15.67 15.77 15.56 Q6NX65 Pdcd10 2 160.3040541 494345 - 160.3040541 160.346008 programmed cell death protein 10 None EINDRVRFLQTIKDIASAIK None 609118 10505 20.01 19.21 19.49 19.62 18.73 19.08 19.85 19.15 18.76 19.05 21.13 18.39 19.28 18.72 18.39 19.01 19.53 19.62 19.01 20.53 18.39 21.21 19.26 17.59 19.5 18.95 19.63 19.54 19.69 19.19 19.66 Q9JLD2 Serpini1 2 160.3466211 116459 + 160.3466211 160.433194 neuroserpin None KQKVEVYLPRFTVEQEIDLK None 602445 21045 16.01 18.36 15.91 17.67 16.91 15.51 16.36 16.45 17.1 16.71 16.06 16.76 15.89 16.71 16.36 16.7 15.91 17.47 17.39 15.88 17.45 15.62 16.65 17.08 17.43 17.8 15.51 18.01 16.93 16.22 17.07 Q5BJK8 Golim4 2 160.6423091 310526 - 160.6423091 160.732865 golgi integral membrane protein 4 None RQEFHEPGHQEGDPEAEADR None 606805 8716 16.02 15.25 15.93 16.49 17.17 15.76 16.09 17.39 16.84 16.03 16.39 15.86 15.68 15.93 17.29 15.95 15.06 16.85 16.51 15.27 15.24 15.09 15.78 15.43 17.23 15.38 16.73 17.28 15.22 16.56 17.62 A0A0G2JU11 Rapgef2 2 164.2075141 310533 - 164.2075141 164.428681 cyclic nucleotide ras gef None VVLLWVNNHFNDFEGDPAMTR None None 35477 19.56 18.52 18.89 19.36 18.14 19.51 19.12 18.43 18.93 19.18 19.28 19.3 19.15 19.3 18.08 19.94 19.78 19.41 19.37 18.18 19.05 19.08 19.78 18.91 18.85 19.54 18.62 19.58 19.17 18.45 18.9 F1M386 Rapgef2 2 164.2075141 310533 - 164.2075141 164.428681 rap guanine nucleotide exchange factor 2 None LTFLHEGNDSKVDGLVNFEK None None 35477 19.68 18.07 18.85 19.35 18.09 19.45 19.08 18.43 18.92 19.16 19.22 19.32 19.22 19.26 18.01 19.94 19.69 19.41 19.52 18.13 19.03 19.06 19.78 18.81 18.82 19.55 18.63 19.59 19.18 18.61 18.96 F1LUE9 Ac121415.1 2 164.5851681 - 164.5851681 164.585796 ribosomal_l30_n domain-containing protein None GKFGIICMEDLIHEIYTVGK None None None 18.42 16.97 17.74 19.0 17.78 18.72 16.65 18.27 18.85 19.14 17.62 18.58 18.12 18.3 19.07 17.53 17.92 18.28 17.65 18.13 18.99 18.34 18.81 19.05 18.16 16.8 18.86 17.22 18.56 17.99 18.05 Q6DGG0 Ppid 2 164.7278981 361967 + 164.7278981 164.739692 peptidyl-prolyl cis-trans isomerase d None CVIAECGELKEGDEWGIFPK None 601753 31283 21.78 21.73 20.52 20.48 20.13 21.77 21.89 21.1 20.73 22.17 20.47 20.6 20.56 20.61 20.0 20.89 20.3 21.79 21.18 21.85 21.42 22.03 20.27 20.12 21.09 20.88 20.82 21.79 20.03 21.18 21.23 Q6UPE1 Etfdh 2 164.7405571 295143 - 164.7405571 164.762616 electron transfer flavoprotein-ubiquinone oxidoreductase None LELHAKVTIFAEGCHGHLAK None 231675 3275 20.2 21.65 21.22 19.72 20.02 19.81 19.55 19.95 18.98 20.14 20.88 19.35 19.86 20.52 19.85 20.96 20.35 19.03 18.84 20.96 18.09 20.43 20.03 20.89 18.86 19.41 19.1 18.87 21.09 18.67 19.36 F1LNE4 Gria2 2 165.9493861 29627 - 165.9493861 166.06951 glutamate receptor None VEIERALKQVQVEGLSGNIK None 138247 20225 21.69 21.35 21.01 20.97 20.99 22.16 20.58 20.6 21.45 21.07 21.07 22.13 21.69 21.8 21.62 22.26 21.35 21.53 21.51 20.72 21.8 20.66 22.07 21.53 21.09 21.65 21.14 21.34 22.28 20.66 21.19 G3V914 Gria2 2 165.9493861 29627 - 165.9493861 166.06951 glutamate receptor None DQEYSAFRVGMVQFSTSEFR None 138247 20225 21.65 21.33 21.02 20.97 20.96 22.17 20.66 20.63 21.41 21.0 21.08 22.12 21.73 21.8 21.56 22.29 21.45 21.53 21.44 20.75 21.77 20.67 22.06 21.69 21.08 21.71 21.03 21.27 22.26 20.61 21.15 P19491 Gria2 2 165.9493861 29627 - 165.9493861 166.06951 glutamate receptor 2 None SLFQDLELKKERRVILDCER None 138247 20225 21.7 21.25 21.0 20.97 20.99 22.17 20.49 20.6 21.45 21.07 21.06 22.12 21.7 21.79 21.65 22.25 21.36 21.52 21.48 20.71 21.81 20.66 22.07 21.59 21.08 21.66 21.12 21.36 22.33 20.71 21.2 P20595 Gucy1b1 2 167.3488251 25202 - 167.3488251 167.398939 guanylate cyclase soluble subunit beta-1 None FHIIFDRDLVVTQCGNAIYR None 139397 664 20.41 18.54 19.97 19.57 19.09 19.85 20.61 19.08 20.57 19.05 19.71 20.22 19.63 20.31 19.93 18.53 19.86 18.35 20.51 18.9 20.22 20.73 20.46 19.24 18.5 19.34 19.27 19.92 18.77 19.57 19.73 P19686 Gucy1a1 2 167.4186251 497757 - 167.4186251 167.481682 guanylate cyclase soluble subunit alpha-1 None DVYKVETIGDAYCVAGGLHR None 139396 37360 18.17 17.84 18.45 17.72 17.04 17.78 19.07 17.97 18.34 18.02 18.55 16.93 17.14 18.31 18.17 17.19 18.0 18.16 18.03 16.66 18.1 19.05 18.61 17.67 16.56 18.74 18.28 17.84 16.34 17.89 17.77 Q5U330 Gucy1a1 2 167.4186251 497757 - 167.4186251 167.481682 guanylate cyclase None FKICYEEDEHILGVVGGTLK None 139396 37360 17.02 17.88 18.45 17.75 17.05 17.81 19.07 17.98 18.34 18.02 18.55 16.93 17.68 18.35 18.17 17.14 18.0 18.16 18.03 16.66 18.02 19.01 19.03 17.67 16.56 18.74 18.28 17.84 16.34 17.37 17.14 D3ZAG3 Map9 2 167.7086911 310544 + 167.7086911 167.743568 microtubule-associated protein 9 None GGFTEDDLTTDPLLSTSPSVITPTEPAEPAKK None None None 17.95 16.68 17.41 18.2 16.67 17.75 17.21 17.17 18.06 17.87 18.2 17.88 18.5 18.68 16.95 18.33 18.39 18.52 17.65 17.92 18.75 18.14 18.62 18.69 17.55 19.26 17.68 17.12 19.23 17.61 17.7 P02680 Fgg 2 168.3550181 24367 + 168.3550181 168.362316 fibrinogen gamma chain None EAQCQEPCKDSVRIHDTTGK None 134850 429 19.36 17.46 18.81 19.85 18.7 18.89 19.3 18.97 18.77 18.46 20.61 18.57 18.27 18.79 19.64 18.28 17.73 18.58 18.89 19.25 19.91 17.54 19.09 19.22 18.24 18.88 17.28 18.51 19.63 18.75 18.21 P06399 Fga 2 168.3740451 361969 + 168.3740451 168.381565 fibrinogen alpha chain None QVIAKDLLPAKDRQYLPAIK None 134820 428 20.66 18.68 19.6 20.62 19.54 19.84 19.92 19.79 19.41 19.12 21.47 19.45 18.61 19.72 20.48 18.94 18.52 19.38 19.6 20.02 20.73 18.36 19.7 20.18 19.11 19.51 18.14 19.25 20.42 19.56 18.96 P14480 Fgb 2 168.3949171 24366 - 168.3949171 168.405979 fibrinogen beta chain None TTDPRKQCSKEDGGGWWYNR None 134830 3772 20.0 17.44 18.75 19.84 18.62 18.94 19.13 18.74 18.59 18.15 20.54 18.59 17.98 18.77 19.52 18.02 17.56 18.46 18.74 19.18 19.82 17.4 18.88 19.17 18.12 18.53 17.18 18.36 19.38 18.87 18.28 Q9WUC8 Plrg1 2 168.408121 60376 + 168.408121 168.424474 pleiotropic regulator 1 None VHAAVQPGSLDSESGIFACAFDR None 605961 2004 16.66 14.64 17.54 16.83 17.09 15.41 15.56 17.08 16.73 16.08 15.78 17.19 17.0 16.54 18.1 16.61 16.14 16.59 15.72 16.34 17.45 16.59 17.19 17.1 17.13 16.39 17.29 15.76 17.75 17.24 17.44 D3ZQG6 Trim2 2 169.5006281 361970 - 169.5006281 169.553797 tripartite motif-containing protein 2 None GRNKGEFTNLQGVAASTSGK None None 22882 20.92 19.47 21.43 19.25 19.92 21.34 20.61 20.51 19.64 19.26 19.66 20.26 20.84 19.8 20.13 21.0 20.51 20.36 19.03 21.23 19.54 20.95 20.42 19.45 21.34 19.95 19.87 20.33 21.23 20.9 20.46 Q9JHU5 Arfip1 2 169.8448851 60382 - 169.8448851 169.923114 arfaptin-1 None LEAQIDILRDNKKKYENILK None None 8692 17.8 15.63 18.27 17.35 17.57 16.96 17.6 17.62 18.29 17.07 17.76 17.46 18.04 17.78 17.08 16.32 16.39 18.75 17.26 18.49 18.32 18.36 17.36 17.6 17.65 16.35 18.66 16.91 17.18 18.32 18.53 M0R4L6 Gatb 2 170.9305581 361974 + 170.9305581 171.016078 glutamyl-trna(gln) amidotransferase subunit b None DSGKSLHDDLRSQTLIDLNR None 603645 3357 16.97 15.21 15.52 15.8 16.41 16.99 16.96 15.25 15.66 15.66 15.76 16.0 17.39 17.39 15.88 15.55 15.26 15.7 17.18 17.84 15.53 17.48 15.57 14.73 17.95 16.38 16.26 16.14 17.08 16.11 17.04 P49242 Rps3a 2 171.52451 29288 - 171.52451 171.529105 40s ribosomal protein s3a None QIRKKMMEIMTREVQTNDLK None 180478 68112 20.26 20.51 20.47 20.45 19.78 19.99 19.05 20.55 20.51 20.72 21.2 20.7 20.38 20.69 21.14 20.11 21.09 20.11 20.11 20.03 21.35 20.98 20.46 21.24 20.28 21.42 20.98 19.58 21.39 19.55 19.98 A0A0G2JYI0 Lrba 2 171.6241191 361975 + 171.6241191 172.20258 lps-responsive beige-like anchor protein None SVDPPVQFRSFDRSVIIATK None None 36205 17.34 16.35 19.38 18.25 17.1 17.55 18.0 16.88 18.32 17.43 17.31 17.38 17.66 17.62 19.04 17.37 17.82 17.02 18.0 17.1 19.3 18.34 18.05 17.08 18.01 17.48 19.03 18.13 16.76 17.68 19.13 Q5MPA9 Dclk2 2 172.2087111 310698 - 172.2087111 172.33825 serine/threonine-protein kinase dclk2 None GVSVIMNTALDKEGQVFCSK None 613166 69431 19.74 17.45 19.48 18.87 19.47 18.99 18.78 18.37 19.28 19.46 18.03 18.32 19.26 18.14 19.98 20.02 18.67 19.28 19.5 17.64 20.12 19.31 19.47 19.7 19.7 19.55 20.06 18.67 18.1 18.92 19.94 F1M7K9 Elp4 2 93.5194031 + 93.5194031 93.754589 elongator complex protein 4 None TVVGLESFIGSERETNPLYK None None None 16.27 14.18 16.42 16.48 15.46 14.77 15.53 15.74 16.02 15.88 16.63 14.49 16.37 16.27 15.31 14.82 15.03 16.26 15.69 16.7 17.48 15.43 16.49 16.53 16.2 16.84 16.15 15.87 15.36 16.49 16.16 A0A0G2JZC6 Arhgef11 2 173.0753971 78966 + 173.0753971 173.195207 rho guanine nucleotide exchange factor 11 None NSVLSDPGLDSPQTSPVILAR None None 11409 19.11 17.64 17.94 17.8 19.03 17.32 17.41 17.56 18.64 17.31 17.31 16.25 16.74 17.22 18.15 17.22 17.22 18.53 18.19 16.07 18.14 16.68 16.65 18.43 18.98 17.6 17.97 17.94 16.59 18.06 18.17 Q9ES67 Arhgef11 2 173.0753971 78966 + 173.0753971 173.195207 rho guanine nucleotide exchange factor 11 None GSFHTEAARWTDYSLSPPAK None None 11409 19.12 17.6 17.67 17.7 19.43 17.85 17.49 16.99 18.28 17.54 17.01 16.37 16.71 17.18 18.27 18.09 17.15 18.51 18.23 16.07 17.44 16.5 16.63 18.45 19.0 17.98 17.91 17.96 16.66 18.12 18.18 B2RYA6 Prcc 2 173.3262621 310687 - 173.3262621 173.351799 papillary renal cell carcinoma (translocation-associated) None TPSPSAIKAAAKSAALQVTK None 179755 38120 16.34 15.25 16.53 16.89 16.88 15.54 15.86 16.41 17.0 15.0 15.38 16.89 16.84 16.4 15.76 15.75 15.01 17.21 16.88 17.07 17.33 16.17 16.55 15.75 17.37 16.26 16.72 16.68 16.64 16.88 17.47 Q8VHK7 Hdgf 2 173.3704321 114499 + 173.3704321 173.379367 hepatoma-derived growth factor None NSTPSEPDSGQGPPPEEEEGEEEAAK None 600339 3306 19.67 19.62 20.71 20.08 20.22 20.19 20.02 19.96 21.11 19.08 19.52 20.94 20.44 20.52 19.73 19.44 19.2 20.6 20.45 21.77 21.84 20.33 20.15 19.99 20.46 19.97 20.73 20.76 20.01 20.5 21.82 Q66H47 Mrpl24 2 173.3832181 295224 + 173.3832181 173.389229 39s ribosomal protein l24 None KDHRGTMIPSEAPLLHHQVK None 611836 12241 16.18 18.07 16.58 17.86 17.53 17.15 15.03 17.12 16.2 16.22 15.68 17.17 15.49 15.56 17.81 16.97 16.13 16.3 17.05 15.37 15.74 15.6 17.57 17.35 18.52 16.69 17.4 17.45 16.2 16.78 16.23 P51673 Crabp2 2 173.4170051 29563 + 173.4170051 173.421352 cellular retinoic acid-binding protein 2 None PNFSGNWKIIRSENFEEMLK None 180231 1415 17.51 15.73 17.67 17.61 16.68 15.75 18.61 18.52 16.8 16.78 19.28 17.42 17.69 18.79 16.08 16.67 17.5 18.13 16.86 17.87 16.99 16.75 17.71 17.23 17.16 16.86 16.7 17.49 16.28 17.11 18.37 P21263 Nes 2 173.4388621 100910255 + 173.4388621 173.447774 nestin None RVKTLEEQNQLLSAELGGLR None None None 15.71 15.56 15.81 15.65 15.24 14.9 16.21 14.5 14.88 14.24 16.89 15.5 14.79 15.75 15.6 15.62 15.27 16.49 15.35 14.28 15.63 16.09 15.13 14.92 16.73 15.39 15.21 16.91 14.37 15.38 15.67 G3V8G4 Bcan 2 173.4544831 25393 - 173.4544831 173.467465 brevican core protein None PIQNPREACYGDMDGYPGVR None None 7244 20.22 21.31 20.8 21.14 22.24 22.49 21.0 21.25 22.05 22.33 21.33 22.55 22.59 21.92 21.0 23.0 22.05 21.26 21.43 23.04 21.49 20.88 22.63 22.15 20.37 21.66 21.21 20.95 23.36 21.43 21.13 P55068 Bcan 2 173.4544831 25393 - 173.4544831 173.467465 brevican core protein None LIRCQENGLWEAPQISCVPR None None 7244 19.6 21.08 20.46 20.77 21.76 21.65 20.47 20.96 21.56 21.81 20.81 22.08 22.03 21.24 20.54 22.53 21.51 20.86 20.91 22.53 21.11 20.35 22.05 21.66 19.8 21.17 20.87 20.39 22.82 20.78 20.68 G3V8G6 Hapln2 2 173.4911591 64057 - 173.4911591 173.496595 hyaluronan and proteoglycan link protein 2 None DGGWLADGSVRFPITTPRPR None None 11045 19.25 18.9 17.74 17.75 19.08 18.09 17.39 18.79 16.86 17.54 19.02 16.72 17.22 17.35 17.98 18.2 17.61 17.78 16.99 19.19 16.98 17.0 17.09 18.05 18.51 18.27 17.43 16.98 19.65 18.07 17.36 Q9ESM2 Hapln2 2 173.4911591 64057 - 173.4911591 173.496595 hyaluronan and proteoglycan link protein 2 None LGGRASLRRGHRLDASLIIK None None 11045 19.25 18.9 17.74 17.76 19.07 18.1 17.39 18.8 16.86 17.54 19.02 16.72 17.22 17.36 17.98 18.19 17.61 17.78 16.99 19.19 16.99 16.99 17.09 18.05 18.51 18.27 17.43 16.98 19.65 18.07 17.36 B0BNM1 Naxe 2 173.5189751 295229 - 173.5189751 173.521022 nad(p)h-hydrate epimerase None LEKKYQLNLPAYPDTECVYR None None 70948 18.73 17.32 18.09 18.98 17.73 18.55 19.39 17.93 19.07 19.49 18.02 18.8 18.81 19.16 18.44 17.26 18.25 18.32 18.02 20.07 18.49 19.66 18.86 18.1 17.07 18.0 18.75 17.94 17.99 19.06 18.72 O89038 Mef2d 2 173.6064911 81518 + 173.6064911 173.632361 myocyte-specific enhancer factor 2d None QLGAPSRKPDLRVITSQGGK None 600663 4327 16.04 16.09 15.9 16.44 16.94 15.32 15.5 15.87 16.34 15.98 14.76 16.05 16.34 16.61 15.34 15.59 15.22 16.64 16.62 16.83 16.58 16.11 15.29 15.84 16.19 17.5 16.48 16.46 17.21 16.23 17.56 Q6P502 Cct3 2 173.7655381 295230 + 173.7655381 173.790353 t-complex protein 1 subunit gamma None MLLDPMGGIVMTNDGNAILR None 600114 4373 21.94 21.6 20.16 21.24 21.41 20.78 20.98 21.95 20.15 20.21 19.8 21.16 21.03 20.29 21.51 21.2 21.44 19.41 20.39 21.29 19.25 20.84 19.65 20.81 21.79 22.01 20.03 20.6 22.0 20.3 21.79 E9PU03 Smg5 2 173.8049811 681012 + 173.8049811 173.832102 smg5 nonsense mediated mrna decay factor None ILCNKTAYQEVFKPENVSLR None 610962 9095 15.16 15.0 14.08 15.24 16.01 15.46 15.48 16.7 15.47 14.8 14.91 15.66 15.42 15.97 14.88 14.7 15.24 15.57 16.05 14.92 15.06 14.33 16.13 15.61 17.03 16.58 15.99 15.76 14.02 14.38 15.66 D3ZSN7 Slc25a44 2 173.870371 365841 - 173.870371 173.883039 similar to cg5805-pa, isoform cra_a None RFQVRGNLEGQGLIAFGQTK None 610824 14000 16.54 14.49 15.8 17.9 15.01 15.65 16.87 15.84 15.4 15.79 15.67 16.92 17.14 17.17 16.33 16.73 16.83 15.61 15.84 17.16 16.34 15.71 17.19 16.05 17.38 17.73 15.6 16.61 16.86 16.54 16.58 F7F3I7 Sema4a 2 173.8964331 310630 - 173.8964331 173.919861 rcg62756, isoform cra_a None RVPRANCSVYKSCVDCVLAR None 607292 8425 17.25 18.01 17.03 17.47 16.0 17.34 16.46 17.21 16.11 18.42 17.17 16.07 17.11 17.06 15.95 16.79 17.6 16.69 16.33 18.31 15.73 17.9 16.89 17.72 16.16 17.66 16.46 16.39 18.15 16.78 15.71 G3V8L3 Lmna 2 173.9397531 60374 - 173.9397531 173.960387 lamin a, isoform cra_b None ALSTALSEKRTLEGELHDLR None 150330 41321 20.51 19.35 20.83 20.09 20.6 19.54 20.27 21.55 20.89 19.67 21.1 20.65 20.6 20.45 21.89 19.51 20.16 20.62 20.33 19.87 21.49 20.32 20.44 21.75 20.72 20.03 20.78 20.16 19.6 21.39 21.6 P48679 Lmna 2 173.9397531 60374 - 173.9397531 173.960387 prelamin-a/c None SMGNWQIKRQNGDDPLMTYR None 150330 41321 20.48 19.35 20.84 20.09 20.6 19.53 20.28 21.55 20.89 19.66 21.1 20.67 20.6 20.45 21.88 19.52 20.14 20.63 20.34 19.86 21.48 20.33 20.4 21.74 20.72 20.02 20.77 20.12 19.63 21.39 21.63 D4A465 Lamtor2 2 174.008561 295234 - 174.008561 174.012623 late endosomal/lysosomal adaptor, mapk and mtor activator 2 None AKAQALVQYLEEPLTQVAAS None None None 16.46 14.11 15.19 17.06 16.79 14.98 16.6 16.95 15.43 15.7 15.8 15.82 16.75 15.07 15.36 16.65 17.11 17.14 15.39 15.84 15.07 15.68 16.73 15.22 17.21 17.73 16.19 16.22 15.84 16.62 16.45 D4A3P1 Ubqln4 2 174.0127791 310633 + 174.0127791 174.028062 ubiquilin 4 None NQDRALSNLESVPGGYNALR None 605440 41346 18.46 15.54 18.79 17.67 17.06 18.06 18.03 17.64 16.67 17.49 18.96 17.13 18.19 18.07 16.15 16.79 17.76 17.82 17.89 19.1 17.95 18.82 18.22 18.12 18.61 17.08 17.25 16.94 18.17 18.19 18.11 Q5FVC2 Arhgef2 2 174.0739841 310635 + 174.0739841 174.118355 rho guanine nucleotide exchange factor 2 None EPALPVEADSGSCPGVTANGEAR None 607560 3468 19.67 18.79 18.44 18.77 18.48 19.27 18.32 18.93 19.23 18.99 19.18 19.24 18.95 19.28 19.32 19.49 19.25 19.16 19.58 17.08 19.08 18.79 19.58 19.59 18.83 19.27 19.02 18.88 19.03 18.23 18.52 O08835 Syt11 2 174.2060181 60568 - 174.2060181 174.231908 synaptotagmin-11 None KCISRGELQVSLSYQPVAQR None None 23120 18.51 17.71 17.84 18.19 16.86 18.01 16.98 16.98 17.05 18.14 18.04 16.73 16.74 17.54 17.6 17.27 18.77 16.43 17.76 16.63 16.49 18.3 17.18 17.79 18.27 17.14 17.21 17.8 18.01 17.3 16.82 D3ZMW3 Msto1 2 174.3059461 295237 - 174.3059461 174.310216 protein misato homolog 1 None NHDGETGRLEAFGQGESVLK None None 41228 17.37 15.29 16.73 17.51 17.24 17.74 17.34 17.38 18.77 18.15 17.0 16.85 17.84 18.34 18.19 16.08 16.68 17.25 18.18 16.39 17.06 17.58 17.36 16.72 17.02 17.16 17.54 19.02 16.13 17.57 18.31 A0A0G2K264 Dap3 2 174.3193481 295238 - 174.3193481 174.346461 death-associated protein 3 None PALELLGYLKNTNFAHPAVR None 602074 3404 16.84 16.58 16.7 16.06 16.54 16.52 16.27 16.2 17.73 17.08 16.81 15.66 16.3 16.39 18.13 15.11 15.94 16.39 16.8 15.92 17.99 16.52 15.1 15.74 15.42 15.77 17.14 15.62 17.76 16.5 17.95 F7EZZ0 Dap3 2 174.3193481 295238 - 174.3193481 174.346461 death-associated protein 3 None VEQGLTRVRNATDAVGVVLK None 602074 3404 16.84 16.58 16.7 16.06 16.55 16.4 16.27 16.08 17.73 17.08 16.81 15.66 16.3 16.43 18.26 15.24 16.1 16.45 16.41 15.89 18.09 16.49 15.1 15.74 15.42 15.77 17.14 15.62 17.76 16.5 17.95 P05369 Fdps 2 174.4866661 83791 - 174.4866661 174.507031 farnesyl pyrophosphate synthase None LDVHNQEKQNFIQHFSQIVK None 134629 1519 21.42 19.26 19.87 19.6 20.08 19.76 19.89 19.9 18.15 19.38 21.1 18.68 19.46 19.44 19.32 19.97 19.75 19.43 19.12 20.06 18.89 19.28 19.58 19.42 20.45 19.74 20.73 19.42 18.39 19.84 18.87 Q7TPK0 Fdps 2 174.4866661 83791 - 174.4866661 174.507031 ac2-125 None FSSSVRMNGDQKLDVHNQEK None 134629 1519 21.32 20.25 19.76 19.69 20.1 19.7 20.02 19.96 18.25 19.11 21.1 18.74 19.21 19.39 19.04 20.08 19.97 19.75 18.94 20.06 18.72 19.28 19.36 19.32 20.59 19.88 20.88 19.23 18.66 19.55 18.62 P12928 Pklr 2 174.543041 24651 + 174.543041 174.553421 pyruvate kinase pklr None VARGDLGIEIPAEKVFLAQK None 609712 37286 24.19 23.91 22.73 23.51 24.67 24.01 23.8 23.01 22.99 22.01 23.39 24.08 23.23 22.02 21.92 23.55 22.71 23.92 22.65 24.46 21.75 23.54 22.44 23.55 23.69 22.38 22.21 23.22 23.28 24.02 22.22 Q9JKA8 Hcn3 2 174.5486831 114245 - 174.5486831 174.565817 potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3 None DGEAATPARETPPAAPAQAR None 609973 22453 16.14 15.11 16.51 16.62 15.64 14.73 15.12 15.76 15.93 16.07 16.65 14.12 15.79 15.92 14.92 15.31 15.83 15.93 16.73 15.1 15.25 16.84 15.86 15.81 16.34 16.23 14.96 16.38 16.7 16.34 15.86 A0A0G2K5Q8 Scamp3 2 174.5706531 365842 + 174.5706531 174.590028 secretory carrier-associated membrane protein None EPPPAYEPPAPAPAPLPPPSAPSVQSSR None 602989 33303 19.89 18.29 20.29 18.63 19.06 19.2 18.32 19.52 19.87 19.63 18.86 17.42 19.48 19.47 18.79 18.51 19.17 20.01 18.72 18.95 18.95 19.62 19.09 19.93 19.05 19.68 19.14 19.16 19.73 19.37 19.83 E9PTW1 Scamp3 2 174.5706531 65169 + 174.5706531 174.590028 secretory carrier-associated membrane protein None PAVRTAAANAAAGAAENAFR None 606913 4164 19.87 18.35 20.33 18.72 18.96 19.38 18.07 19.48 19.84 19.54 18.89 17.38 19.54 19.52 19.0 18.48 19.41 19.83 18.7 18.81 18.99 19.62 19.1 20.08 19.03 19.73 19.25 19.55 19.44 19.33 19.81 B2RYC9 Gba 2 174.6094381 684536 + 174.6094381 174.615456 glucosylceramidase None QRLLLPRWAQVVLSDPEAAK None 606463 68040 18.34 17.16 16.16 19.26 17.3 17.79 17.58 17.42 17.82 18.47 18.7 18.32 18.03 18.03 18.6 17.9 18.51 17.15 17.44 17.67 16.84 18.5 18.44 18.15 18.59 17.32 17.07 17.47 19.04 18.45 17.6 A0A0G2JU49 Mtx1 2 174.6146411 295241 - 174.6146411 174.62105 metaxin 1 None ERLQLLCGEHRLESEEELEK None 600605 37623 19.35 18.07 18.61 18.72 16.9 19.41 18.65 18.7 19.92 20.41 18.35 18.71 19.03 19.17 19.98 18.65 18.96 18.03 19.87 17.92 19.85 19.89 19.18 19.14 18.22 18.43 19.5 19.51 17.94 19.01 19.51 A0A0G2JXN2 Trim46 2 174.6415051 310641 - 174.6415051 174.654221 tripartite motif-containing protein 46 None VLEEKRSSLLQAIEECQQER None None 11815 17.67 17.65 15.55 16.74 17.68 17.62 17.31 16.45 17.28 17.39 17.01 17.64 17.3 17.24 18.03 17.19 18.12 16.82 17.24 15.5 17.25 17.5 16.34 17.42 17.15 17.14 16.68 16.9 17.54 16.0 18.19 B2RZC9 Krtcap2 2 174.6542911 295243 + 174.6542911 174.658405 keratinocyte-associated protein 2 None INKISSTLYQATAPALTPAK None None 15494 15.89 13.31 14.69 14.63 13.8 14.93 15.66 15.35 15.09 16.14 16.9 15.34 15.75 16.33 15.12 14.64 15.91 14.56 14.83 15.45 15.43 16.63 15.54 16.11 15.09 14.2 14.9 14.97 15.23 15.78 15.82 D3ZIJ5 Dpm3 2 174.6765331 502017 + 174.6765331 174.677047 dolichol-phosphate mannosyltransferase subunit 3 None ALGTVGYRVATFHDCEDAAR None 605951 17810 15.91 15.84 18.01 17.42 17.07 16.29 16.59 17.08 17.17 17.77 16.25 15.68 16.85 17.0 17.55 15.16 16.55 16.71 17.08 16.49 15.93 17.02 17.0 17.79 16.62 16.59 17.22 15.81 15.81 16.68 17.37 D4A4P4 Flad1 2 174.8194521 751787 - 174.8194521 174.828921 fad synthase None ELYVAASEGSIAPILSEAQAHFGR None 610595 115598 16.01 16.31 17.57 17.49 16.09 17.4 18.43 15.94 15.39 15.61 18.04 17.07 17.84 17.83 16.27 17.78 18.22 16.14 16.2 18.22 15.51 17.72 18.45 15.94 17.8 17.53 16.37 16.29 17.87 16.82 16.35 A2VD12 Pbxip1 2 174.859011 310644 + 174.859011 174.868916 pre-b-cell leukemia transcription factor-interacting protein 1 None QDEVEQLQASVPPDSVPSLQSMGLLLDK None None 10740 19.75 17.09 17.5 17.93 18.72 17.73 17.26 17.62 18.06 17.85 20.24 17.38 17.78 18.48 17.54 18.51 16.79 19.3 17.97 18.24 17.31 17.8 18.02 18.89 18.38 17.46 17.37 19.25 17.37 18.96 17.58 Q5RK24 Pmvk 2 174.87671 310645 + 174.87671 174.88637 phosphomevalonate kinase None QEAYGALTQTVRVVASEQSR None 607622 4779 16.24 17.94 16.89 16.93 16.61 16.23 17.55 16.82 15.05 16.57 15.24 16.77 15.67 16.16 14.83 16.58 16.19 16.97 15.77 17.01 14.45 16.19 15.44 16.58 16.91 16.1 15.51 16.1 15.6 15.86 16.66 P70605 Kcnn3 2 174.9365991 54263 + 174.9365991 175.081325 small conductance calcium-activated potassium channel protein 3 None VKMEQRKLSDQANTLVDLSK None 602983 20516 15.51 15.89 16.91 14.26 14.26 15.14 15.89 15.04 14.9 15.38 15.74 14.37 15.37 15.47 15.93 15.25 15.47 14.9 15.57 13.88 16.45 16.26 15.38 15.27 15.38 15.31 14.79 15.74 14.17 14.5 15.41 P55266 Adar 2 175.1552741 81635 + 175.1552741 175.176068 double-stranded rna-specific adenosine deaminase None TRAICCRVTRDGNAFEDGLR None 146920 8280 17.6 16.11 18.22 18.14 16.98 16.83 16.94 17.01 17.94 18.71 17.81 16.48 17.98 17.72 17.52 17.26 18.77 17.77 17.8 16.75 18.92 18.6 18.11 18.39 17.55 18.36 18.71 16.96 17.79 18.27 18.38 P12390 Chrnb2 2 175.1814031 54239 - 175.1814031 175.189619 neuronal acetylcholine receptor subunit beta-2 None CTMKFRSWTYDRTEIDLVLK None 118507 595 16.05 13.57 15.2 16.31 16.32 14.15 15.2 16.55 15.85 16.96 15.61 15.99 15.7 14.49 14.26 16.49 16.21 15.94 15.54 15.55 14.43 14.96 16.87 14.56 15.17 15.09 15.36 16.16 16.83 15.62 15.64 B2GV55 Ube2q1 2 175.1988741 295252 + 175.1988741 175.207942 ubiquitin-conjugating enzyme e2 q1 None IASACLDELSCEFLLAGAGGAGAGAAPGPHLPSR None None 9730 18.39 16.16 18.63 18.61 17.16 19.17 18.69 17.7 17.43 16.53 19.62 18.32 19.04 18.13 17.73 17.72 19.32 17.32 17.54 18.83 17.51 19.44 18.86 18.13 17.99 18.35 17.42 17.99 18.68 18.47 18.33 Q7TSE9 Hax1 2 175.4352641 291202 - 175.4352641 175.437683 hcls1-associated protein x-1 None GSQGPFHRLDDTWPVSPHSR None None None 15.86 17.72 15.31 17.33 14.89 16.16 15.7 15.5 16.45 15.71 16.06 16.92 15.78 15.79 16.62 16.08 16.55 15.86 15.93 14.88 15.78 16.92 15.27 16.2 15.63 15.73 15.82 15.73 16.66 16.01 14.91 E9PTR4 Ubap2l 2 175.4387041 361984 - 175.4387041 175.493982 rcg62582, isoform cra_b None GKNQDECVIALHDCNGDVNR None None None 18.62 16.66 18.54 18.58 18.05 17.85 17.3 17.94 18.73 17.2 17.44 19.0 18.93 18.98 17.15 18.17 18.03 19.05 18.89 18.76 19.4 17.94 18.8 18.4 18.79 19.26 19.13 18.14 19.56 18.74 18.98 Q4KMA3 C1orf43 2 175.4943561 361985 + 175.4943561 175.50727 loc361985 protein None RMKALDAIRASEIPFHAEGR None None 41041 16.01 14.74 16.24 17.24 15.25 16.02 16.74 15.61 15.93 14.83 16.88 15.8 16.79 15.56 15.1 16.18 16.18 14.99 16.98 16.88 15.6 15.73 16.7 15.74 17.14 14.72 15.59 14.7 16.88 15.98 16.16 A0A140TAF0 Tpm3 2 175.5172271 117557 + 175.5172271 175.544703 rcg62531, isoform cra_g None ASLNRRIQLVEEELDRAQER None 191030 81889 23.96 24.45 22.81 22.27 22.51 22.93 22.0 24.4 22.62 23.78 23.29 22.84 23.28 23.15 23.58 24.24 23.8 22.61 21.78 23.28 21.97 22.74 22.46 23.43 21.93 24.15 22.61 22.96 24.37 21.93 22.76 Q63610 Tpm3 2 175.5172271 117557 + 175.5172271 175.544703 tropomyosin alpha-3 chain None ASLNRRIQLVEEELDRAQER None 191030 81889 24.14 23.72 23.27 22.13 22.0 24.11 23.15 23.83 23.19 23.98 23.7 23.1 23.75 23.45 23.73 24.25 24.09 22.58 22.04 23.47 22.74 23.29 23.02 23.6 21.51 23.46 22.14 22.86 24.37 22.63 22.92 Q71TY3 Rps27 2 175.665861 94266 - 175.665861 175.666963 40s ribosomal protein s27 None None None None 18.14 18.21 18.05 19.6 19.17 17.29 17.41 18.98 19.1 18.98 18.2 19.28 17.95 18.17 19.75 19.13 18.82 18.25 18.02 18.2 17.93 18.12 17.98 19.56 17.06 18.29 19.37 17.24 18.77 18.98 18.74 P35286 Rab13 2 175.675331 81756 + 175.675331 175.680023 ras-related protein rab-13 None QVWDTAGQERFKTITTAYYR None 602672 113882 20.06 22.52 20.45 19.47 19.24 20.17 19.35 20.7 20.66 21.39 21.04 19.91 19.75 21.15 21.08 19.83 20.45 21.21 20.23 19.22 20.87 21.26 19.92 21.31 18.96 20.4 19.58 21.53 19.93 19.31 20.08 F1LTT7 Dennd4b 2 175.7229911 361987 + 175.7229911 175.735877 denn domain-containing 4b None CSFGSTRHAALEFFDSCVDK None None 28281 15.48 16.7 17.54 17.94 16.25 17.35 16.92 15.75 16.0 16.28 17.89 16.18 17.29 17.28 17.2 16.34 17.27 16.61 17.3 15.47 15.78 17.89 17.71 16.56 17.64 16.67 16.91 16.85 16.8 16.35 15.81 Q4V8E1 Gatad2b 2 175.7494341 310614 + 175.7494341 175.826027 gata zinc finger domain-containing 2b None LRVEPFVCAQCRTDFTPHWK None None 32484 17.06 15.55 18.02 17.25 16.47 16.25 15.85 16.5 18.23 16.13 15.99 17.65 16.93 17.76 16.95 16.85 16.54 16.72 18.62 16.3 18.66 17.07 17.42 18.36 17.82 17.0 17.23 16.88 17.78 17.57 18.55 D3ZJA9 Slc27a3 2 175.8532421 295219 - 175.8532421 175.857909 solute carrier family 27 (fatty acid transporter), member 3 None YARPRFLRLQESLATTETFK None 604193 11529 15.52 16.07 16.55 16.5 15.31 15.74 17.49 15.65 14.17 15.9 16.82 15.14 16.76 16.13 16.19 16.63 17.31 15.16 15.15 16.11 14.26 16.24 16.3 15.16 15.73 17.09 15.53 16.0 15.53 15.51 15.31 D3ZUT9 Ints3 2 175.859231 361988 - 175.859231 175.911585 integrator complex subunit 3 None FSDLFSLAEEYEDSSTKPPK None None 11309 15.6 16.13 16.06 16.0 16.33 15.47 15.62 15.44 16.7 14.61 15.1 16.26 15.16 16.26 16.05 15.08 15.44 14.88 17.29 15.48 17.36 16.12 14.86 15.9 16.92 15.73 15.88 15.64 16.57 15.58 17.06 B2RZC6 Ilf2 2 175.9510031 310612 + 175.9510031 175.971159 ilf2 protein None ITTVPPNLRKLDPELHLDIK None None 26894 19.07 18.27 20.25 19.05 18.76 18.59 17.79 18.48 19.99 18.91 18.66 19.71 18.93 19.42 19.27 18.22 18.8 19.19 19.34 19.73 20.85 19.5 19.01 19.87 18.46 18.15 20.06 18.0 19.72 19.43 20.75 Q7TP98 Ilf2 2 175.9510031 310612 + 175.9510031 175.971159 interleukin enhancer-binding factor 2 None YKKGTMTTGHNVADLVVILK None None 26894 18.75 17.52 19.96 18.92 18.59 18.61 17.62 18.36 19.99 18.68 18.76 19.72 18.96 19.32 19.38 18.12 18.67 18.98 19.09 19.59 20.73 19.44 19.16 19.74 18.32 17.85 19.9 17.92 19.66 19.51 20.47 P60192 Snapin 2 175.9715851 295217 - 175.9715851 175.974159 snare-associated protein snapin None RESQVELREQIDNLATELCR None 607007 None 17.75 16.32 17.55 16.86 17.1 17.52 17.09 16.14 16.94 17.01 16.86 16.52 17.59 17.3 16.92 17.48 17.93 16.72 16.23 18.83 18.68 17.02 17.73 17.24 17.45 18.26 17.79 17.5 16.63 17.15 17.75 Q498T2 Chtop 2 175.9812741 361990 - 175.9812741 175.992742 chromatin target of prmt1 protein None GHLDAELDAYMAQTDPETND None None None 16.2 16.4 17.63 15.88 15.75 15.4 17.07 16.12 17.64 16.78 16.48 16.92 16.51 17.15 15.51 15.57 16.93 15.7 16.14 18.07 18.36 17.24 16.94 15.8 16.17 15.28 16.36 15.88 17.44 16.66 16.62 P35467 S100a1 2 175.9940851 295214 - 175.9940851 175.996636 protein s100-a1 None KKELKDLLQTELSSFLDVQK None 176940 4566 18.76 17.21 19.27 19.42 18.27 18.61 19.78 18.13 17.75 17.1 19.52 18.0 18.86 18.68 16.98 19.33 19.05 18.63 17.93 19.7 16.92 18.62 19.22 17.84 19.28 18.42 17.37 17.94 19.47 19.03 18.75 D3ZTB5 S100a13 2 175.999441 295213 + 175.999441 176.005933 s100 calcium-binding protein a13 None FFTFAGREGRKGSLSTNEFK None 601989 7523 20.21 22.25 22.05 22.3 21.03 21.31 21.32 21.72 20.87 20.22 21.43 20.82 20.23 19.72 21.16 21.66 21.93 21.22 19.49 22.24 21.27 20.69 20.79 21.92 21.87 21.9 21.14 20.57 21.01 21.14 22.33 B0BMX3 S100a16 2 176.0162621 361991 + 176.0162621 176.022115 s100 calcium binding protein a16, isoform cra_a None SFRKMLQKELNHMLTDTGNR None None 12201 18.89 17.42 18.2 18.01 18.02 16.99 18.35 17.31 17.8 17.21 17.77 16.82 17.77 17.31 16.65 19.04 18.2 18.18 17.64 18.82 18.37 18.2 17.79 18.16 18.56 19.52 17.17 18.0 17.76 18.13 18.68 P05942 S100a4 2 176.0908031 24615 + 176.0908031 176.093275 protein s100-a4 None LTRELPSFLGRRTDEAAFQK None 114210 7924 16.53 18.68 16.44 15.82 16.87 18.01 16.89 17.34 16.08 16.36 17.72 16.19 15.51 17.51 16.97 16.39 16.71 15.86 18.24 16.4 17.54 16.23 16.76 17.11 18.08 16.49 16.22 17.44 16.77 17.37 16.39 P63083 S100a5 2 176.0968931 295211 + 176.0968931 176.09954 protein s100-a5 None TLSRKELKELIKTELSLAEK None 176991 2224 16.46 16.31 17.68 17.57 17.08 16.19 16.06 16.78 17.36 17.21 16.55 16.19 16.29 16.22 17.45 16.28 15.87 17.29 16.13 17.52 17.51 17.38 17.19 16.95 17.2 16.63 17.72 16.91 16.5 16.3 17.36 P05964 S100a6 2 176.1008861 85247 + 176.1008861 176.10218 protein s100-a6 None TIGAKLQDAEIARLMDDLDR None 114110 7925 19.62 18.73 18.79 17.54 17.84 17.87 19.35 19.54 17.84 18.34 20.34 17.49 17.54 18.56 18.53 18.04 18.3 18.21 17.9 18.59 18.0 18.63 18.49 18.21 17.86 18.08 18.52 17.71 17.55 16.96 17.67 P05943 S100a10 2 179.2210131 81778 + 179.2210131 179.229659 protein s100-a10 None MEREFPGFLENQKDPLAVDK None 114085 2228 18.65 16.39 16.99 16.76 17.67 15.86 18.34 18.59 16.62 16.15 19.05 17.63 17.37 18.21 16.91 17.16 16.9 18.22 17.74 17.29 17.08 16.89 17.13 17.95 17.95 17.65 16.91 17.84 15.63 17.18 17.48 Q8VIF7 Selenbp1 2 182.4972841 103689947 - 182.4972841 182.504601 methanethiol oxidase None SHIHVWDWQRHEIIQTLQMK None None None 19.13 18.78 18.69 18.99 18.74 17.96 19.34 19.84 18.22 19.48 20.49 18.03 17.93 19.81 18.4 17.64 17.43 19.64 20.17 18.77 19.05 18.24 18.44 19.74 18.8 19.03 19.18 18.85 17.16 19.99 19.98 Q566R0 Them4 2 181.953431 361992 + 181.953431 181.975678 acyl-coenzyme a thioesterase them4 None TIQSTDEKTLHTQATALFIK None None 14208 19.02 18.19 18.3 18.31 19.27 18.0 16.94 17.43 18.64 19.4 17.18 17.31 18.19 18.56 17.57 18.69 16.99 19.15 18.87 18.93 19.39 17.27 18.77 19.06 18.92 18.62 18.62 19.48 17.49 18.57 18.42 G3V8T7 Tdrkh 2 182.0492161 310652 + 182.0492161 182.071903 rcg51933, isoform cra_a None LELVRKGYAVELPEDMEENR None None 4999 18.43 16.03 18.03 18.03 18.88 17.89 18.55 17.38 17.74 17.42 18.11 18.46 18.72 18.89 18.37 18.16 18.02 17.47 17.86 18.89 18.09 18.53 18.56 18.22 19.02 17.77 16.62 18.17 19.27 18.85 18.7 Q641X9 Mrpl9 2 182.0814991 310653 + 182.0814991 182.08634 39s ribosomal protein l9 None NLGVVVAPHALRLPEDPITR None 611824 12696 17.03 18.38 15.92 16.86 16.91 16.13 14.77 16.55 16.08 16.04 15.37 16.56 16.02 16.03 17.74 17.88 16.27 16.47 16.6 14.99 15.18 16.84 15.96 17.16 18.18 17.81 17.3 16.89 16.72 15.85 16.5 Q8K4V4 Snx27 2 182.1359111 260323 - 182.1359111 182.218906 sorting nexin-27 None KQAVPISVPTYKHVEQNGEK None 611541 12797 19.84 21.1 18.88 19.46 18.54 19.76 20.37 20.08 19.07 19.54 18.3 18.52 18.68 18.95 19.93 19.71 18.71 19.63 18.81 20.37 18.62 19.14 18.56 18.46 20.48 20.7 19.45 18.54 19.68 18.78 19.68 D4A4X4 Cgn 2 182.3083251 310655 - 182.3083251 182.334576 cingulin None EQQLKEARGLVEGGEAVEAR None None 41394 16.02 13.97 16.07 15.99 15.86 15.44 14.6 16.04 16.52 16.14 16.54 15.31 16.14 16.66 16.13 15.84 15.91 15.84 15.06 16.28 16.32 15.59 16.52 16.52 16.59 15.67 15.52 16.39 16.5 16.79 15.86 A0A0G2JY58 Pogz 2 182.395911 310658 + 182.395911 182.440708 pogo transposable element-derived with znf domain None ESSMKVTSSIPVFDLQDGGR None None 9022 15.38 15.8 16.66 15.53 16.34 17.2 15.58 14.82 17.1 15.39 15.48 16.52 15.77 16.7 17.19 16.27 16.29 16.33 17.22 14.66 17.83 16.78 16.54 16.68 17.7 16.3 16.91 16.37 16.33 16.74 18.09 G3V8U9 Psmb4 2 182.442831 58854 - 182.442831 182.445523 proteasome subunit beta None QPLLREVLEKQPVLSQTEAR None 602177 2090 19.01 17.88 19.66 18.69 18.14 18.54 19.23 18.97 18.05 17.92 18.81 18.26 18.58 16.77 17.35 19.1 17.86 19.22 18.55 19.77 18.88 18.97 18.68 18.49 18.9 18.81 19.26 17.17 18.45 19.34 19.15 P34067 Psmb4 2 182.442831 58854 - 182.442831 182.445523 proteasome subunit beta type-4 None ELFGDGHSYSPRAIHSWLTR None 602177 2090 18.67 18.25 19.53 18.39 17.86 18.4 18.84 18.95 18.31 18.84 18.23 18.7 18.83 16.86 17.49 18.98 17.59 19.16 18.79 19.7 19.12 19.05 18.54 18.86 17.55 18.99 19.45 17.04 18.38 18.76 19.14 O08561 Pi4kb 2 182.5403781 81747 + 182.5403781 182.57234 phosphatidylinositol 4-kinase beta None THQRSKSDATASISLSSNLK None None 6741 16.98 15.1 16.86 17.13 17.86 16.01 16.96 17.06 16.18 15.55 16.61 16.87 17.27 15.71 16.34 17.84 17.03 16.52 17.69 15.65 15.47 16.88 17.16 16.28 18.34 17.39 17.05 17.67 15.86 17.64 17.35 O88321 Psmd4 2 182.598671 83499 - 182.598671 182.608191 26s proteasome non-atpase regulatory subunit 4 None TTLTPDTGRILSKLHTVQPK None None 55691 19.67 17.99 18.65 18.94 18.19 17.51 18.0 18.3 18.15 18.59 17.62 18.27 19.34 18.79 18.31 18.45 20.09 17.62 18.35 18.23 19.59 18.17 18.48 19.51 19.61 19.69 19.41 17.79 18.23 19.25 18.2 D3ZSI8 Pip5k1a 2 182.6283011 365865 - 182.6283011 182.671461 phosphatidylinositol 4-phosphate 5-kinase type-1 alpha None TPAHHYNDFRFKTYAPVAFR None 603275 93492 19.14 18.09 19.43 19.18 19.34 19.36 18.66 18.98 20.18 18.72 18.87 19.29 19.96 20.17 20.33 19.05 19.75 19.37 19.9 18.03 20.66 18.93 20.04 19.92 19.16 20.71 19.59 19.77 19.37 19.4 19.53 B1WC45 Vps72 2 182.6786151 310661 + 182.6786151 182.690197 transcription factor-like 1 None REEKTLLPLELQDDGSDSRK None 600607 110905 14.35 16.14 14.33 14.72 16.11 14.0 14.1 14.05 15.96 13.9 13.99 14.12 13.92 15.11 15.79 14.34 15.2 14.48 14.12 14.58 15.26 14.18 13.76 14.57 16.47 14.07 14.95 14.8 15.73 14.59 15.07 Q5HZA4 Lysmd1 2 182.7051371 499671 + 182.7051371 182.710435 lysm and putative peptidoglycan-binding domain-containing protein 1 None PGDTLAGLALKYGVTMEQIK None None 41742 18.2 15.94 17.88 18.75 17.07 18.21 18.34 16.98 18.2 17.26 18.12 18.17 18.44 18.33 17.36 18.26 18.5 17.81 18.46 17.35 17.63 18.56 18.71 17.76 18.16 17.86 18.63 17.78 17.03 17.92 18.11 Q6AYG3 Prune1 2 182.8305721 310664 - 182.8305721 182.859348 exopolyphosphatase prune1 None DECPLDQGLPKLSAEAVFEK None None None 19.69 17.85 19.72 18.56 18.99 19.94 21.1 19.75 17.96 19.33 18.96 19.18 20.35 19.41 18.76 19.58 19.82 18.93 19.51 19.56 18.5 19.07 20.14 18.7 19.48 20.33 18.9 19.41 18.61 19.83 19.41 Q5BJQ2 Mindy1 2 182.8654221 310665 + 182.8654221 182.872997 ubiquitin carboxyl-terminal hydrolase mindy-1 None HGLCELTATAKEDELSVFFR None None 32409 17.33 15.3 16.39 16.77 16.28 17.81 17.16 17.36 16.51 15.94 17.52 16.99 17.29 17.91 16.07 15.56 16.91 17.03 16.17 18.35 16.4 17.15 17.25 16.38 17.32 17.5 17.65 16.67 16.59 17.46 17.39 A0A0G2K5A7 Setdb1 2 182.8987391 689883 - 182.8987391 182.929999 set domain bifurcated histone lysine methyltransferase 1 None GPPHVPITPSGSVGGCNPPSSEETPK None 604396 32157 17.4 14.6 17.15 15.82 16.64 16.92 16.79 17.49 15.8 17.76 16.75 16.16 17.24 16.05 17.02 17.27 17.65 15.6 16.88 16.02 16.34 16.97 16.78 17.15 15.85 16.9 16.62 15.58 16.95 16.96 17.24 Q66H74 Golph3l 2 183.1488911 310669 + 183.1488911 183.183123 golgi phosphoprotein 3-like None KQNFLLFDMTTHPVTNTTEK None 612208 23082 15.57 14.58 16.06 15.99 15.26 16.16 16.84 16.4 15.67 15.26 16.74 16.72 16.57 15.76 16.09 15.9 16.07 16.77 16.85 14.81 16.57 17.08 16.08 15.4 16.91 16.39 16.44 16.47 15.61 17.2 17.04 P60841 Ensa 2 183.1855531 60334 + 183.1855531 183.192888 alpha-endosulfine None MKRLQKGQKYFDSGDYNMAK None 603061 37924 20.98 20.06 19.87 20.23 19.26 20.73 19.59 20.45 19.87 20.61 19.66 20.27 20.69 20.52 19.9 20.92 21.22 19.97 19.42 20.87 20.04 20.73 20.77 20.43 20.18 21.74 20.1 20.58 20.76 19.99 19.99 Q62894 Ecm1 2 183.2874841 116662 - 183.2874841 183.292723 extracellular matrix protein 1 None NPNVGKVDPALPQEAIPLQK None 602201 3260 15.83 15.04 16.43 15.45 15.79 16.96 17.44 14.93 15.43 15.62 16.66 15.93 15.99 16.27 15.69 14.43 15.93 15.36 14.76 16.97 15.93 16.5 16.4 15.69 14.91 15.83 14.68 15.48 15.73 14.8 15.68 Q68FW7 Tars2 2 183.293141 310672 - 183.293141 183.310166 threonine--trna ligase None LLTNSSALWRSSEAPETLQR None 612805 23520 17.58 19.24 17.49 18.51 17.11 18.59 18.69 18.7 17.44 18.94 17.73 18.69 18.7 17.91 17.71 18.66 19.28 17.17 17.22 19.43 16.86 18.66 18.95 17.54 17.31 19.11 17.14 17.73 19.7 17.01 16.84 A0A0G2JTD1 Rprd2 2 183.3181851 100364568 - 183.3181851 183.367598 regulation of nuclear pre-mrna domain-containing 2 None TGSAVKGRNLLSNTQSFISK None None None 16.17 14.67 16.58 16.73 16.72 15.89 16.36 16.33 16.22 14.93 16.44 17.09 16.94 16.98 16.96 15.6 16.03 15.63 16.98 16.52 17.67 16.17 16.6 14.96 17.63 16.69 17.37 16.56 16.82 17.11 17.65 A0A0G2JTI7 Prpf3 2 183.3790421 361995 - 183.3790421 183.403496 pre-mrna-splicing factor 3 None QQLKEKPSEDMESNTFFDPR None None 3447 16.7 16.31 17.64 16.83 16.54 16.64 16.17 16.27 17.95 16.37 16.92 18.0 15.94 17.66 18.32 16.1 16.59 16.37 17.58 15.84 18.88 17.47 17.09 17.26 16.61 16.82 18.31 16.93 16.48 17.23 18.07 B2RYT0 Mrps21 2 183.4067951 689432 - 183.4067951 183.414413 mitochondrial ribosomal protein s21 None GAYRTLNRILTTDGLIDVIK None 611984 45365 17.12 15.84 15.36 17.41 17.39 15.21 16.34 16.83 16.43 16.93 15.46 17.16 17.16 16.45 18.14 17.31 16.14 16.68 16.29 16.75 15.83 15.73 15.7 15.36 16.45 18.15 17.39 16.35 17.7 16.53 17.88 A0A0G2K6H8 Aph1a 2 183.4384381 365872 + 183.4384381 183.441951 anterior pharynx defective 1a homolog (c. elegans), isoform cra_a None YYKLLKKADEGLASLSEDGR None 607629 9345 15.51 13.28 15.24 16.47 14.13 14.69 15.17 15.78 15.8 14.77 14.98 15.71 15.68 15.16 15.24 16.25 14.94 15.96 15.27 14.34 14.26 15.24 15.93 15.52 14.42 16.23 14.87 15.28 15.94 15.6 15.82 A2IBE0 Ca14 2 183.4424711 791259 - 183.4424711 183.449019 carbonic anhydrase 14 None SVPPFNVRELLPQQLEQFFR None None 69105 18.23 15.81 17.25 17.56 16.88 16.19 17.12 17.55 16.18 16.24 18.44 16.09 16.96 17.2 15.78 16.15 17.22 16.57 16.35 18.13 15.41 16.37 17.33 16.53 17.54 16.44 16.46 15.58 18.1 17.42 15.85 Q5XIE0 Anp32e 2 183.4726241 361999 + 183.4726241 183.489055 acidic leucine-rich nuclear phosphoprotein 32 family member e None KNLKSLDLFNCEITNLEDYR None 609611 41519 16.88 16.22 16.91 17.39 17.03 16.96 17.19 16.72 18.03 17.76 16.87 18.25 17.52 17.44 17.22 16.75 15.69 17.53 17.89 18.23 18.95 17.54 17.4 16.29 15.88 17.03 18.22 16.89 17.46 17.78 18.44 O08700 Vps45 2 183.5559211 64516 - 183.5559211 183.616269 vacuolar protein sorting-associated protein 45 None GKRVRGSDLFSPKDAVAITK None 610035 5250 19.15 20.43 19.33 18.45 17.8 18.51 19.17 19.29 19.47 20.39 18.67 17.85 18.25 19.24 20.29 17.73 19.03 19.52 18.77 17.87 19.95 19.26 17.9 18.7 17.77 19.22 19.08 20.05 17.67 18.51 19.59 D3ZH40 Otud7b 2 183.653841 310677 + 183.653841 183.720563 ubiquitinyl hydrolase 1 None LLEGKNWDVSAALSDFEQLR None 611748 10624 18.74 16.74 18.02 17.2 18.3 18.04 18.56 18.03 16.31 16.7 18.41 16.53 16.85 17.12 16.66 17.71 18.27 16.98 16.63 18.8 16.33 17.15 17.76 16.35 18.61 17.4 17.42 17.05 17.77 18.1 16.61 Q6AYL5 Sf3b4 2 183.7327921 295270 + 183.7327921 183.737545 splicing factor 3b subunit 4 None VTGQHQGYGFVEFLSEEDADYAIK None 605593 134086 15.54 14.53 15.89 15.8 15.89 15.32 14.79 15.15 15.84 14.57 15.61 16.63 16.13 16.17 16.05 14.77 15.57 15.09 15.65 16.64 17.37 15.79 16.03 15.67 16.44 15.73 17.09 14.58 16.63 16.36 16.77 Q02563 Sv2a 2 183.7415081 117559 + 183.7415081 183.757314 synaptic vesicle glycoprotein 2a None AIGALTTQPESPRFFLENGK None None 32237 22.39 20.8 20.83 22.38 20.86 20.56 20.57 21.48 21.91 22.34 20.51 21.05 21.51 21.0 21.46 22.1 20.48 21.81 22.24 21.51 20.42 22.19 21.71 21.22 21.45 22.88 21.32 22.53 21.88 21.25 22.05 Q06C60 Bola1 2 183.7585161 365875 - 183.7585161 183.759531 bola family member 1 None AQWRENPQLDISPPCLGGSK None 613181 41103 17.98 17.1 19.12 18.58 17.74 17.41 18.84 17.67 17.6 17.54 18.02 17.3 18.12 18.08 17.43 16.42 17.99 17.2 17.34 19.58 18.15 18.42 17.82 16.92 18.83 17.46 18.19 18.07 17.88 19.43 18.04 D4A817 Hist2h2be 2 183.780631 295274 + 183.780631 183.781009 histone h2b None IANEASRLAHYNKRSTITSR None None None 22.24 24.2 22.66 22.49 22.76 21.74 23.22 22.92 23.0 22.05 21.52 22.98 22.27 22.5 22.53 22.41 21.51 22.52 23.17 23.57 23.52 22.56 21.72 21.81 22.89 23.4 22.17 23.0 23.22 22.28 23.87 D3ZJ08 Hist2h3c2 2 183.8000541 102548682 - 183.8000541 183.800463 histone h3 None FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK None None None 21.62 20.95 23.0 21.67 21.82 21.67 22.36 21.68 23.12 21.8 21.53 22.41 21.55 22.04 21.63 21.3 21.16 21.77 22.52 22.75 23.93 22.15 21.94 21.29 21.21 21.85 21.09 22.29 22.94 22.13 23.26 P0CC09 Hist2h2aa2 2 183.8084421 365877 + 183.8084421 183.808833 histone h2a type 2-a None TRIIPRHLQLAIRNDEELNK None None 116071 21.05 21.42 20.75 21.93 21.74 20.94 21.89 21.58 21.4 20.29 20.47 21.8 21.68 21.51 20.63 21.66 20.53 21.79 21.33 22.96 21.12 20.98 20.95 20.26 22.27 22.52 21.04 21.49 22.6 21.19 23.26 Q5BJT1 Ankrd34a 2 184.1316441 295283 + 184.1316441 184.135074 ankyrin repeat domain-containing protein 34a None MESVELDTPGHFCPDSPESSR None None 82882 17.06 15.29 16.59 17.09 16.27 17.09 16.51 15.88 17.35 17.06 17.35 16.92 17.37 17.46 15.61 16.91 17.23 17.8 17.56 15.77 17.42 17.42 17.51 17.42 15.65 16.4 16.99 16.72 16.85 17.0 16.76 Q27W01 Rbm8a 2 184.1651941 295284 + 184.1651941 184.167959 rna-binding protein 8a None HEEATEEDIHDKFAEYGEIK None None None 16.77 16.2 16.87 17.04 17.29 15.89 16.22 17.02 17.29 16.24 15.75 17.3 16.72 16.68 17.99 16.65 16.37 16.9 17.32 17.33 18.31 16.59 17.19 17.12 17.78 17.6 18.35 15.69 17.24 17.73 18.3 Q4KM24 Pex11b 2 184.1720711 310682 + 184.1720711 184.180958 peroxisomal biogenesis factor 11 beta None ACSLLGHALQRHGASPELQK None None 2852 16.26 15.2 16.63 16.23 15.69 16.62 15.87 16.33 15.88 16.68 15.49 15.73 16.37 16.29 16.76 16.49 15.54 16.57 17.91 15.35 17.08 16.16 16.41 16.63 16.97 17.36 16.67 16.99 15.74 16.34 17.28 A0A0H2UHM7 Tuba1 2 130.195761 100909441 + 130.195761 130.199551 tubulin alpha chain None TAIAEAWARLDHKFDLMYAK None None None 27.18 25.52 27.18 26.25 25.37 26.72 26.44 26.18 25.6 26.99 26.41 25.21 26.34 26.46 26.43 25.15 26.41 26.2 26.64 24.79 25.88 27.3 26.95 25.69 26.73 25.93 25.51 25.6 27.54 26.71 25.34 Q4FZU0 Acp6 2 184.7117141 295305 + 184.7117141 184.733073 acid phosphatase 6, lysophosphatidic None QESKEWFVRLSYNGQEQVPR None None 41128 17.96 19.44 17.19 17.08 17.73 18.03 18.52 17.96 17.59 18.46 16.34 16.78 17.02 16.36 16.82 18.95 17.33 17.89 16.82 19.41 16.63 17.72 16.98 16.45 17.91 18.15 17.21 17.11 18.44 16.72 17.76 Q9QZH4 Prkab2 2 185.2572141 64562 + 185.2572141 185.272852 5'-amp-activated protein kinase subunit beta-2 None LSATHRYKKKYVTTLLYKPI None None 38046 17.44 15.07 16.61 17.26 16.52 16.68 17.36 17.0 15.35 17.13 16.66 16.32 17.56 16.99 16.54 18.28 17.86 15.87 17.55 15.92 15.78 16.04 17.61 16.87 17.56 18.43 17.12 17.39 15.97 16.92 17.06 A0A0G2K463 Pde4dip 2 185.2932441 64183 - 185.2932441 185.427886 myomegalin None None None None 16.22 15.3 16.7 16.1 15.75 16.92 15.7 16.16 16.97 16.18 17.58 15.16 17.57 17.74 17.23 15.76 17.2 16.84 16.34 14.8 17.57 17.22 15.99 17.8 17.22 16.67 17.09 16.07 16.05 17.41 16.45 Q9WUJ3 Pde4dip 2 185.2932441 64183 - 185.2932441 185.427886 myomegalin None GSENRRQQLLLMLEGLVDER None None 66961 16.22 15.3 16.7 16.1 15.75 16.92 17.03 16.16 16.97 16.18 17.58 15.16 17.57 17.74 17.41 15.76 17.06 16.7 16.44 14.81 17.57 17.22 15.99 17.5 17.22 16.67 16.01 15.28 16.61 17.41 16.45 Q4KM74 Sec22b 2 185.5000051 310710 + 185.5000051 185.522026 vesicle-trafficking protein sec22b None RVADGLPLAASMQEDEQSGR None 604029 3597 19.68 18.37 19.86 19.57 19.77 18.95 19.29 18.84 19.83 18.51 18.68 20.12 19.96 19.65 20.66 19.26 19.84 18.96 19.41 18.25 20.42 18.88 19.59 19.99 19.89 18.93 19.74 19.68 19.01 19.8 20.2 Q9QW30 Notch2 2 185.610591 29492 + 185.610591 185.7439 neurogenic locus notch homolog protein 2 None NKEETPLFLAAREGSYEAAK None 600275 376 16.08 16.4 14.79 15.27 14.84 16.34 16.5 16.48 16.15 15.38 17.58 16.25 15.07 14.9 15.41 16.87 16.39 16.18 16.0 15.28 15.55 17.14 14.82 16.22 15.59 15.66 15.75 16.76 14.32 16.09 16.88 P22791 Hmgcs2 2 185.8756111 24450 + 185.8756111 185.902142 hydroxymethylglutaryl-coa synthase None KLPWDAVGRLEVGTETIIDK None 600234 38066 18.1 16.61 19.4 18.27 17.78 18.08 18.03 17.81 18.11 17.65 17.21 18.12 18.18 17.57 18.59 17.57 16.7 18.92 18.29 18.05 19.02 18.51 17.58 17.54 18.05 17.7 19.23 17.59 18.14 18.73 19.54 O08651 Phgdh 2 185.9069661 58835 - 185.9069661 185.93616 d-3-phosphoglycerate dehydrogenase None GAVFRPEVPLRRGQPLLLFR None 606879 39318 18.88 19.07 19.55 19.93 20.54 20.6 20.97 21.08 20.18 20.18 19.43 20.64 20.7 19.48 20.3 20.19 19.91 19.21 20.36 20.12 19.19 19.59 20.52 19.94 19.0 20.06 20.92 19.6 18.52 20.2 20.31 F1M8H2 Wars2 2 186.4616631 690654 + 186.4616631 186.543162 tryptophanyl-trna synthetase None EKLKMDKDHLRKVLLVGSAK None 604733 5673 17.21 16.94 16.21 17.27 17.77 16.49 16.71 16.52 16.24 15.53 16.09 17.05 16.84 15.83 17.37 17.19 16.91 15.72 16.91 17.11 16.43 16.99 15.72 16.24 18.12 17.43 16.99 17.35 16.47 16.35 17.95 Q66H63 Gdap2 2 187.5285221 362004 + 187.5285221 187.585271 ganglioside-induced differentiation-associated-protein 2 None LTDKNPVSESIFMLAGPDLK None None 7728 16.0 13.76 16.24 15.67 14.74 15.91 15.8 14.91 15.85 15.81 16.32 15.58 16.16 16.06 15.75 15.65 16.11 15.74 17.03 14.33 16.37 16.16 15.66 16.18 16.24 14.8 15.6 16.25 14.85 16.2 15.79 D3ZR49 Man1a2 2 188.3310211 295319 - 188.3310211 188.481323 alpha-1,2-mannosidase None AGKGAKDPGVFLIHGPDEHR None 604345 55982 16.16 15.12 16.81 16.31 16.29 15.25 16.5 16.42 15.22 16.61 15.72 15.54 15.98 14.59 16.8 15.59 15.25 15.28 15.45 15.46 15.63 15.42 15.11 15.6 14.59 15.41 15.17 15.15 15.6 16.09 15.67 F1M790 Ptgfrn 2 188.4695221 29602 - 188.4695221 188.544795 prostaglandin f2 receptor negative regulator CD9P-1; EWI-F None None None None 18.27 16.52 16.96 18.16 17.54 17.08 16.88 17.11 17.87 17.49 18.43 18.27 18.05 18.75 16.93 16.91 17.91 17.7 17.38 18.73 18.45 17.69 18.51 17.75 17.33 17.89 16.62 18.07 18.92 17.59 17.54 Q62786 Ptgfrn 2 188.4695221 29602 - 188.4695221 188.544795 prostaglandin f2 receptor negative regulator None LSSPNETKYIISLDQDSVVK None 601204 7908 18.27 16.52 16.96 18.16 17.54 17.08 16.88 17.11 17.87 17.49 18.43 18.27 18.05 18.75 16.93 16.91 17.91 17.7 17.38 18.73 18.45 17.69 18.51 17.75 17.33 17.89 16.62 18.07 18.92 17.59 17.54 A0A0G2K7L2 Igsf3 2 188.8121431 295325 + 188.8121431 188.899645 immunoglobulin superfamily, member 3 None REAKGQLKVAKEGDGVFVLK None 603491 1182 16.26 16.97 17.24 17.36 16.13 15.85 15.79 16.16 16.92 16.81 16.44 15.63 15.72 16.05 16.88 16.07 15.67 16.61 15.78 17.78 17.74 16.79 16.51 16.28 16.93 16.59 17.27 16.28 16.72 15.33 17.14 P06685 Atp1a1 2 189.0207231 24211 - 189.0207231 189.048826 sodium/potassium-transporting atpase subunit alpha-1 None WADLVICKTRRNSVFQQGMK None 182310 564 23.65 24.19 24.04 24.83 25.6 24.21 24.41 24.44 25.58 25.41 24.28 25.68 25.58 25.17 24.68 24.04 24.67 24.39 24.93 24.58 25.16 24.06 25.52 24.36 23.38 24.2 23.67 25.57 25.46 24.9 24.47 F1M944 Casq2 2 189.5259451 29209 + 189.5259451 189.582289 calsequestrin None IEDQIKLLGFFKNEDSEYYK None 114251 20330 17.17 16.74 16.95 16.88 18.18 18.09 17.35 16.3 18.87 19.38 17.35 17.01 18.21 17.92 18.38 16.93 17.5 18.33 17.73 16.65 19.26 18.01 17.27 16.07 16.69 17.09 17.23 18.87 18.38 17.79 18.87 Q9JJW1 Tspan2 2 190.1777851 64521 + 190.1777851 190.219641 tetraspanin-2 None DVAIRHVQSMYEEAYSDYVR None 613133 21169 19.46 16.91 17.84 18.44 19.01 19.97 18.39 18.14 18.05 18.09 19.24 18.09 18.1 18.52 18.07 18.88 17.56 19.44 18.44 19.03 17.81 18.36 18.72 18.4 19.52 18.62 18.3 17.36 20.08 19.93 17.98 Q5FWT9 Sike1 2 190.5180031 362007 + 190.5180031 190.525832 suppressor of ikbke 1 None CEMGAVMRRAVQVDDNQFCK None 611656 None 15.37 14.05 15.11 14.99 15.76 16.14 15.02 14.36 16.14 15.53 16.43 15.97 16.27 15.98 15.34 15.63 15.69 16.43 15.35 16.19 17.06 16.64 16.98 15.42 14.54 16.1 16.42 15.33 17.13 16.4 15.86 P18395 Csde1 2 190.5549961 100364335 + 190.5549961 190.582784 cold shock domain-containing protein e1 None PFGDKDTKSKVTLLEGDHVR None None None 20.75 18.98 19.05 18.61 19.67 19.95 19.0 19.29 20.22 20.06 21.41 19.74 20.09 21.01 20.71 19.03 19.78 20.02 20.42 18.01 21.09 19.35 19.34 20.66 19.6 18.57 20.74 19.61 18.74 19.82 19.98 Q04970 Nras 2 190.5829571 24605 + 190.5829571 190.590584 gtpase nras None SALTIQLIQNHFVDEYDPTIEDSYR None 164790 55661 20.2 18.88 19.5 19.71 19.12 19.45 19.72 19.62 20.03 20.99 18.28 19.41 20.19 19.72 18.73 19.98 19.9 19.58 19.69 20.56 19.32 20.16 20.02 18.73 19.09 20.24 19.77 19.0 20.92 19.84 19.83 B5DFM8 Bcas2 2 190.6924591 295334 + 190.6924591 190.700383 pre-mrna-splicing factor spf27 None PIELLSMKRYELPAPSSGQK None 605783 4291 16.78 15.04 17.79 16.87 16.66 16.37 15.57 16.94 17.52 16.08 15.98 16.91 17.32 16.94 17.13 15.9 17.09 16.61 16.63 17.37 18.31 16.71 17.16 17.7 17.79 15.89 17.78 15.84 17.45 17.51 17.72 D3ZUK4 Trim33 2 190.8124671 365894 + 190.8124671 190.887664 tripartite motif-containing 33 None LVDNYFVKDTSEAPSSSDEK None 605769 9296 16.23 15.14 16.63 17.54 16.43 15.66 15.73 17.29 17.71 15.99 15.15 16.53 16.83 17.03 16.04 16.0 16.73 16.8 16.74 15.62 17.03 15.33 16.62 16.01 16.55 17.75 17.39 16.33 16.96 16.82 17.88 D3ZUM5 Trim33 2 190.8124671 365894 + 190.8124671 190.887664 tripartite motif-containing 33 None QFLEEAFQNQKGAIENLLAK None 605769 9296 16.3 14.63 16.86 17.53 16.41 15.65 16.17 17.27 17.75 16.01 15.07 16.3 16.89 17.02 16.02 15.99 16.71 16.78 16.72 15.61 17.01 15.31 16.96 15.46 16.5 17.6 17.41 16.56 16.86 17.0 17.44 Q62746 Syt6 2 191.0930081 60565 + 191.0930081 191.152293 synaptotagmin-6 None NMADKLKDPSALGFLEAAVK None 607718 10301 17.52 17.22 17.03 16.92 16.3 16.48 17.38 16.05 16.86 17.63 16.98 15.47 16.38 16.82 17.66 16.29 16.88 16.19 15.98 17.98 17.48 18.61 17.12 16.5 17.84 17.06 16.57 16.98 17.12 16.37 17.37 D4A1U7 Rsbn1 2 191.4166321 310749 + 191.4166321 191.470711 round spermatid basic protein 1 None PLPSELHLQDLKTQPIPVFK None None 10154 14.88 16.02 15.42 16.48 16.21 13.68 14.79 16.52 15.11 15.13 15.23 14.46 14.54 14.4 15.19 14.93 15.13 15.17 15.48 15.39 14.75 14.78 14.73 15.08 16.75 16.03 14.71 14.83 16.16 15.39 16.29 F1M7S0 Magi3 2 191.5185071 245903 - 191.5185071 191.716725 membrane-associated guanylate kinase inverted 3 Slipr None None None None 18.01 16.72 17.72 18.27 16.24 16.61 17.58 17.37 17.38 17.2 18.56 16.4 17.89 17.94 16.53 17.57 18.43 18.01 17.11 16.19 18.17 16.81 16.9 17.84 16.81 17.79 17.87 17.68 15.59 17.13 17.03 Q9JK71 Magi3 2 191.5185071 245903 - 191.5185071 191.716725 membrane-associated guanylate kinase, ww and pdz domain-containing protein 3 None PSEVYLKSKTLYEDKPPNTK None None 26431 18.01 16.72 17.72 18.27 16.24 16.61 17.58 17.37 17.38 17.2 18.56 16.4 17.89 17.94 16.5 17.57 18.46 17.94 17.17 16.23 18.17 16.81 16.9 17.84 16.81 17.79 17.87 17.68 15.59 17.13 17.03 P53987 Slc16a1 2 192.124311 25027 + 192.124311 192.143819 monocarboxylate transporter 1 None EKKRDGKEDETSTDVDEKPK None 600682 20662 20.01 17.92 19.45 19.82 19.47 18.87 19.63 19.7 18.74 19.19 21.22 18.49 19.8 20.18 19.53 18.65 18.85 19.2 20.37 19.24 18.9 19.19 19.7 19.83 19.54 19.3 19.01 19.79 18.73 20.22 19.67 A0A0G2K6E0 Rhoc 2 192.2871361 295342 + 192.2871361 192.294596 ras homolog family member c None None None None 18.51 19.66 20.7 19.23 18.84 20.97 21.48 18.76 19.72 20.08 20.54 19.8 20.71 20.74 19.15 20.33 20.01 20.33 19.3 20.63 20.93 21.26 20.72 19.3 19.74 19.3 19.37 19.53 20.41 19.63 19.47 D3ZUC2 Mov10 2 192.2934441 310756 - 192.2934441 192.314802 rna helicase None SIYRLLAPSRDIRMVPEDIK None 610742 10365 18.43 15.72 17.28 17.48 18.16 17.05 17.6 18.28 17.74 18.74 16.35 16.91 17.74 16.42 17.77 18.44 17.47 18.31 16.73 17.09 16.44 17.16 17.39 17.56 16.91 18.63 18.4 17.2 16.77 17.28 18.4 B2GUZ5 Capza1 2 192.3197011 691149 - 192.3197011 192.364755 f-actin-capping protein subunit alpha-1 None AKFITHAPPGEFNEVFNDVR None 601580 24376 19.62 17.91 20.08 19.45 18.75 19.33 19.17 19.47 19.23 18.62 20.15 18.46 19.75 19.41 19.6 18.73 19.09 18.98 18.01 20.83 19.32 19.75 20.14 19.1 19.67 19.2 19.67 18.32 19.92 20.14 19.34 Q68FW3 St7l 2 192.3645951 295344 + 192.3645951 192.486908 suppressor of tumorigenicity 7 protein-like None EINAVEAIHRAVEFNPHVPK None None 14910 15.87 17.2 16.55 15.34 14.58 15.23 15.83 15.0 15.4 15.12 16.12 15.62 15.09 16.17 16.67 15.06 15.97 15.96 14.92 14.48 17.49 16.01 14.77 14.38 15.96 14.98 15.3 15.43 16.97 14.99 15.39 D4A8X8 Cttnbp2nl 2 192.5079631 310760 - 192.5079631 192.554551 cttnbp2 n-terminal like, isoform cra_a None LFSILEGELEARDLVIEALK None None 36371 17.08 14.65 17.88 17.84 17.04 16.51 16.13 15.7 16.31 15.92 17.57 16.03 16.76 15.93 16.59 16.86 16.68 16.63 17.22 16.9 17.8 16.64 16.86 16.8 17.02 16.92 16.53 17.33 17.01 17.43 17.33 Q62897 Kcnd3 2 192.9379511 65195 + 192.9379511 193.155345 potassium voltage-gated channel subfamily d member 3 None NGLLNEALELTGTPEEEHMGK None 605411 21036 16.23 18.44 17.82 18.2 16.4 16.94 18.09 16.82 17.97 17.54 16.64 17.13 17.58 18.11 17.88 16.94 18.0 16.95 18.6 16.4 19.09 17.69 17.04 16.31 17.96 18.15 17.2 18.11 18.3 18.57 17.05 P62836 Rap1a 2 193.2086361 295347 - 193.2086361 193.229869 ras-related protein rap-1a None QFVQGIFVEKYDPTIEDSYR None 179520 2162 22.68 20.23 21.28 20.1 21.31 21.38 21.43 21.82 19.96 21.42 21.98 19.85 20.32 20.49 20.14 21.22 20.46 21.35 20.06 21.64 19.8 20.79 20.02 19.73 21.0 20.12 20.0 20.29 22.14 21.47 20.26 P19511 Atp5pb 2 193.4241391 100911417 - 193.4241391 193.435417 atp synthase f(0) complex subunit b1 None IGEFIDKLNEEKIAQLEEIK None None None 22.96 23.05 21.57 21.34 22.33 20.53 22.03 20.68 21.83 22.76 21.48 21.27 21.66 22.91 23.42 22.11 22.21 20.97 21.64 21.28 23.23 21.92 21.64 22.0 22.62 22.35 22.48 22.23 21.04 21.63 22.13 Q7TPI7 Wdr77 2 1.0 310769 + 1.0 1.0 ac2-269 None DTKNASCTLSSAVHSQCVTR None 611734 11466 16.37 14.58 17.45 15.67 16.49 15.99 17.3 15.82 16.24 16.91 15.72 15.06 17.19 17.28 15.89 16.11 16.38 17.59 16.55 16.93 17.97 16.95 17.38 16.04 17.84 16.71 15.51 16.29 17.44 16.75 16.57 P15384 Kcna3 2 194.6321061 29731 + 194.6321061 194.635304 potassium voltage-gated channel subfamily a member 3 None AAGEQDCCGERVVINISGLR None 176263 128570 18.19 19.77 18.44 19.79 20.42 18.58 19.64 20.28 19.14 20.09 19.97 18.48 20.21 18.77 19.57 19.9 19.07 18.91 18.79 20.72 17.95 18.34 19.73 18.76 19.98 20.07 19.36 18.24 20.67 18.82 18.56 P63142 Kcna2 2 194.7047861 25468 + 194.7047861 194.718387 potassium voltage-gated channel subfamily a member 2 None DPEADHECCERVVINISGLR None None 21034 20.74 17.94 18.78 19.97 20.84 20.09 20.42 19.82 19.86 19.77 20.92 19.77 20.16 19.56 19.33 20.19 19.77 19.42 19.5 21.07 18.88 18.76 20.37 18.52 20.13 19.67 19.65 19.35 20.84 20.59 19.45 D3ZF11 Lamtor5 2 194.9000391 295357 + 194.9000391 194.905394 late endosomal/lysosomal adaptor and mapk and mtor activator 5 None GTLSDEHAGVISVLAQQAAK None 608521 4668 17.66 15.88 17.89 17.38 16.21 17.38 17.94 17.07 16.56 16.98 17.94 17.19 17.42 18.01 16.55 15.78 17.79 16.51 17.65 16.79 17.62 17.94 17.68 15.8 17.66 16.81 17.0 17.56 17.73 17.94 17.54 M0R3Z8 Rbm15 2 194.9466491 684233 - 194.9466491 194.953828 rcg28930, isoform cra_b None SYLKQKQAAGVISLPVGGNK None None None 16.21 15.89 16.33 15.89 16.31 16.13 15.54 15.4 17.04 14.93 15.97 16.67 15.82 16.84 17.19 16.01 16.58 16.03 16.86 15.01 17.51 16.32 15.85 17.27 17.21 15.3 16.91 15.51 16.04 16.01 17.93 M0RB63 Ci-b9 2 194.9692831 684509 - 194.9692831 194.969536 complex i-b9 None TKYASMINKATPYNYPVPVR None None None 17.27 14.7 15.86 16.58 17.67 17.09 15.98 16.05 16.64 15.84 15.83 17.61 17.36 16.7 16.78 17.04 16.35 17.03 17.15 17.0 16.03 17.5 17.28 17.99 18.19 17.26 17.9 16.43 15.98 17.27 17.39 Q63734 Kcnc4 2 195.0789731 684516 - 195.0789731 195.099233 potassium voltage-gated channel subfamily c member 4 None QRLGPHEGGSGPGAGSGGCR None None None 16.0 16.11 15.35 16.48 17.07 14.84 16.17 17.14 16.05 15.49 15.4 16.29 16.88 15.47 16.63 16.72 15.44 15.56 17.23 15.44 15.35 15.33 15.58 15.3 16.99 17.38 15.57 16.2 17.6 15.78 17.47 P31662 Slc6a17 2 195.1074381 613226 - 195.1074381 195.155697 sodium-dependent neutral amino acid transporter slc6a17 None FSHLTTKDYSEMYNVIMTVK None None 27775 19.5 17.54 19.04 19.36 18.48 19.79 19.09 18.45 20.44 19.2 18.82 19.38 19.55 20.12 19.14 18.9 19.3 19.42 20.19 18.31 20.22 19.05 19.83 18.84 18.89 19.01 18.78 19.86 19.69 19.7 19.65 G3V8E2 Strip1 2 195.2483661 362012 - 195.2483661 195.268661 striatin-interacting protein 1 None TAQPPPGAPRAAGGLLPAGK None None 35064 18.31 16.54 18.47 18.22 16.87 18.55 17.15 18.01 19.43 19.11 18.29 17.8 18.62 18.82 17.88 18.71 17.86 19.02 19.54 17.06 18.73 17.51 18.66 19.07 17.68 17.74 19.02 18.38 17.59 17.94 17.8 B5DFN2 Ahcyl1 2 195.2941591 362013 - 195.2941591 195.327926 s-adenosylhomocysteine hydrolase-like protein 1 None AMNVNDSVTKQKFDNLYCCR None None 77353 20.5 20.41 21.23 21.66 21.85 21.66 21.3 21.57 22.16 22.11 21.23 22.44 22.44 21.55 21.39 20.82 21.36 21.72 20.75 23.01 22.67 21.4 22.18 22.14 20.31 21.23 20.81 21.87 21.76 22.01 22.14 Q9Z1B2 Gstm5 2 195.5314871 108348148 + 195.5314871 195.534561 glutathione s-transferase mu 5 None AILRYIARKHNMCGDTEEEK None None None 20.76 19.09 20.76 20.22 20.45 21.12 21.32 19.69 19.47 20.39 19.98 20.9 20.98 21.03 19.42 19.94 19.58 21.12 21.5 21.47 21.82 21.13 21.05 20.48 20.48 21.61 21.38 20.84 19.18 21.31 21.61 A0A0G2K6L4 Gstm6l 2 195.5444271 295362 - 195.5444271 195.549877 glutathione transferase None AILRYLGRKHNLCGETEEER None None None 18.29 19.57 19.33 20.06 19.46 19.47 20.79 20.41 20.38 20.37 19.44 20.55 20.51 19.76 18.86 19.8 18.79 19.79 19.75 21.24 20.1 19.98 20.46 19.99 18.27 19.66 19.73 19.8 18.5 19.32 19.84 P08009 Gstm7 2 195.5666861 81869 - 195.5666861 195.62883 glutathione s-transferase mu 7 None GMMRLYSEFLGKRPWFAGDK None None 41816 21.29 21.2 21.93 21.78 21.85 21.97 23.67 22.31 21.29 22.46 21.53 21.62 21.76 21.65 20.55 22.5 21.35 21.89 22.49 23.32 20.96 22.85 22.39 21.41 21.67 23.55 21.77 21.49 21.07 22.49 22.76 P08010 Gstm7 2 195.5666861 24424 - 195.5666861 195.62883 glutathione s-transferase mu 2 None TDTSYEDKKYSMGDAPDYDR None 138380 37357 20.11 20.06 20.59 20.38 19.69 18.79 21.11 21.24 20.29 20.68 21.33 19.99 19.65 20.63 19.5 20.06 18.98 21.12 20.65 21.12 20.58 20.52 19.98 20.1 19.99 20.38 20.96 20.18 19.03 19.68 22.28 B0BN47 Gstm6 2 195.5795671 499688 - 195.5795671 195.58435 glutathione s-transferase None TETSYEEKRYAMGDAPDYDR None None None 18.32 17.41 17.88 18.23 18.74 19.21 20.03 18.29 17.78 18.58 16.93 19.18 18.4 18.39 17.89 19.47 18.44 17.96 18.34 20.35 17.87 18.23 18.69 18.16 18.56 19.7 18.26 18.39 17.56 18.55 19.88 D3ZVQ8 Gstm3 2 195.6077041 - 195.6077041 195.612475 glutathione S-transferase mu 3 None None None None 17.73 20.25 17.71 17.92 17.52 18.62 19.49 18.24 18.73 18.79 17.86 18.65 17.85 18.25 16.88 18.39 17.44 18.04 17.98 19.66 18.11 18.67 17.5 18.39 16.42 17.94 17.82 17.88 16.84 17.81 18.05 G3V8H3 Gstm3l 2 195.6077041 - 195.6077041 195.612475 glutathione transferase None None None None 19.94 19.25 19.14 20.02 19.6 18.6 20.86 20.36 19.15 19.44 17.72 18.82 18.95 18.9 18.08 19.67 19.29 19.09 19.17 20.99 18.51 18.72 18.61 19.35 20.08 20.63 18.98 18.99 18.43 18.6 20.74 G3V983 Gstm1 2 195.6498471 24423 - 195.6498471 195.655285 glutathione transferase None ETEEERIRADIVENQVMDNR None 138350 37357 21.89 21.08 21.6 22.44 22.17 21.62 23.46 22.48 21.14 21.27 20.85 22.75 22.35 21.76 20.81 22.32 22.65 21.55 21.75 23.55 21.37 21.55 22.34 21.78 22.51 23.27 21.27 22.14 21.21 22.35 23.03 P04905 Gstm1 2 195.6498471 24423 - 195.6498471 195.655285 glutathione s-transferase mu 1 None GLTHPIRLLLEYTDSSYEEK None 138350 37357 21.97 20.93 21.6 22.43 22.22 21.64 23.49 22.55 21.14 21.27 20.85 22.75 22.26 21.68 20.8 22.38 22.65 21.57 21.76 23.54 21.32 21.51 22.21 21.75 22.51 23.27 21.28 22.16 21.24 22.38 23.2 Q5BK56 Gstm4 2 195.679871 499689 - 195.679871 195.68528 glutathione s-transferase mu 4 None KRYTMGDAPDYDRSQWLSEK None 138333 37357 19.53 20.1 20.36 20.54 20.11 19.9 21.58 20.9 19.7 20.02 19.59 20.85 20.44 20.46 19.13 21.05 20.1 20.63 20.48 22.15 19.66 21.3 20.87 20.2 20.52 22.12 20.48 20.19 19.52 20.88 21.62 Q02356 Ampd2 2 195.7076111 362015 - 195.7076111 195.720289 amp deaminase 2 None KYPFKKRASLQASAAAPEAR None 102771 2979 19.36 19.3 20.58 19.92 19.09 19.14 19.44 19.23 19.33 19.75 18.76 18.93 19.5 18.49 19.65 19.05 19.19 19.31 18.94 21.01 20.59 20.34 19.1 19.41 19.72 20.05 19.8 19.27 19.62 19.06 20.71 D4AA42 Gnat2 2 195.7267631 365901 + 195.7267631 195.735866 g protein subunit alpha transducin 2 None PNEQDVLRSRVKTTGIIETK None 139340 21092 19.32 21.64 19.52 20.75 19.35 19.73 18.92 20.14 19.22 20.43 19.18 19.14 19.18 20.2 19.0 18.8 20.31 20.04 20.7 18.61 19.57 19.17 19.23 18.93 20.14 20.49 19.86 19.79 20.8 18.88 19.13 P08753 Gnai3 2 195.7426431 25643 - 195.7426431 195.780736 guanine nucleotide-binding protein g(i) subunit alpha None NRRKDTKEVYTHFTCATDTK None 139370 55975 20.81 22.81 22.77 22.01 21.17 21.34 21.9 21.17 20.81 22.44 20.71 20.98 21.07 22.37 21.47 20.72 20.49 22.03 21.52 21.64 22.67 21.58 21.59 20.83 21.77 22.04 20.78 22.41 21.95 21.18 21.13 Q80ZD7 Amigo1 2 195.8239521 295365 + 195.8239521 195.828592 amphoterin-induced protein 1 None GQNGKLKPGNTLPVPEATGK None None 46421 15.31 13.42 15.0 16.53 15.33 14.5 14.34 16.16 15.31 15.58 15.35 15.46 15.79 15.57 14.89 14.96 15.47 15.77 15.52 15.14 15.46 14.66 16.0 15.89 15.93 16.16 15.5 16.0 16.35 15.52 15.26 P34064 Psma5 2 195.8963861 29672 + 195.8963861 195.919741 proteasome subunit alpha type-5 None KGPQLFHMDPSGTFVQCDAR None 176844 2084 19.49 18.04 20.88 20.14 19.96 18.96 19.8 20.25 18.87 18.97 20.38 18.98 20.42 20.47 18.81 18.3 18.75 19.62 19.6 21.21 20.3 18.57 20.38 20.6 20.73 19.47 19.29 18.56 19.94 20.04 19.94 Q6P9V6 Psma5 2 195.8963861 29672 + 195.8963861 195.919741 proteasome subunit alpha type None IVEIDAHIGCAMSGLIADAK None 176844 2084 19.68 18.22 21.09 20.24 20.03 19.12 20.07 20.55 19.05 19.23 20.5 19.18 20.61 20.44 18.95 18.71 18.95 19.88 19.84 21.27 20.35 18.77 20.56 20.58 20.85 19.71 19.49 18.73 20.14 20.23 20.13 O54861 Sort1 2 195.9243631 83576 + 195.9243631 196.002354 sortilin None ECVEQPELKGHELEFCLYGK None 602458 136097 19.38 16.61 18.19 18.26 18.19 18.89 17.72 19.21 18.36 18.55 19.14 18.48 18.57 19.44 18.75 18.41 18.18 19.1 18.14 18.22 18.74 17.45 19.39 18.8 18.52 18.26 17.99 18.23 19.6 19.02 18.17 G3V8P3 Celsr2 2 196.0291081 83465 - 196.0291081 196.053262 cadherin egf lag seven-pass g-type receptor 2 None ENHYRPPSSPTCLLCDCYPTGSLSR None 604265 1078 17.57 16.34 16.54 17.36 16.16 16.79 16.48 16.1 17.26 16.73 17.82 16.87 16.56 18.25 17.13 16.72 17.76 17.14 17.77 15.54 17.57 17.4 17.62 16.63 17.26 17.27 16.4 17.4 18.14 16.51 16.77 Q9QYP2 Celsr2 2 196.0291081 83465 - 196.0291081 196.053262 cadherin egf lag seven-pass g-type receptor 2 None LSLMFRTRQADGVLLQAVTR None 604265 1078 17.23 16.02 16.36 17.0 16.03 16.39 16.35 16.01 16.91 16.36 17.42 16.28 16.32 18.09 16.59 16.32 17.48 16.85 17.43 15.35 17.07 17.05 17.4 16.33 17.3 17.16 15.83 16.95 18.17 16.35 17.03 A0A0G2JZG7 Sars1 2 196.0655511 266975 - 196.0655511 196.081267 seryl-trna synthetase None ALKVSQIKKVRLLVDEAIQK None 607529 4751 21.28 18.65 21.13 21.17 21.46 19.76 21.0 20.21 18.76 19.22 20.74 20.44 20.15 19.73 19.29 20.27 20.19 20.59 19.81 22.02 19.75 20.64 20.75 19.02 21.45 20.9 20.21 20.4 20.68 20.96 20.75 F1MAB2 Elapor1 2 196.091871 - 196.091871 196.168308 riken cdna 5330417c22 gene None KIKSFTSKRTPDGFDSVPLK None None None 14.58 14.49 14.87 15.95 15.06 16.2 16.41 14.17 16.18 16.93 16.2 15.81 16.46 16.28 15.81 15.82 15.31 16.35 14.83 16.58 16.75 16.27 16.71 15.49 14.34 15.22 14.3 15.73 16.49 15.31 15.26 G3V9M3 Wdr47 2 196.2268681 310785 + 196.2268681 196.287737 rcg28460 None LEKESGVINGLFSDDMLFLR None None 8984 17.61 19.27 18.65 18.81 18.54 19.89 18.0 18.81 19.66 20.0 18.63 19.6 19.96 19.05 18.79 19.71 19.7 19.82 18.41 19.09 19.08 19.14 19.97 19.56 17.67 18.85 18.87 18.63 20.55 18.18 18.34 A0A140TAF5 Clcc1 2 196.2964071 170927 + 196.2964071 196.326913 chloride channel clic-like protein 1 None KETSELPRESTLAECSQCAK None None 9032 17.49 17.82 18.59 17.16 16.97 16.4 17.63 17.1 17.49 18.05 17.16 16.06 16.61 17.67 18.3 16.34 15.95 17.46 18.12 17.35 18.37 17.89 16.36 18.19 17.66 17.62 17.65 15.89 17.59 17.37 18.29 Q9WU61 Clcc1 2 196.2964071 170927 + 196.2964071 196.326913 chloride channel clic-like protein 1 None TNFVTEPLKYIGKGTGEFIK None None 9032 17.37 18.65 18.59 17.16 16.97 16.4 17.63 17.1 17.49 18.05 17.16 16.06 16.62 17.67 18.35 16.34 15.79 17.62 18.18 17.26 18.37 17.89 16.45 18.19 17.66 17.62 17.65 15.89 17.59 17.07 17.78 Q99PV2 Stxbp3 2 196.4426351 114095 - 196.4426351 196.485765 syntaxin binding protein 3, isoform cra_a None IDENGLIKGKTQSQLLIIDR None None 5260 18.63 16.5 17.67 18.08 18.95 17.72 17.85 19.07 16.83 17.29 18.53 16.93 18.12 17.7 17.94 18.47 17.69 17.9 18.18 18.48 16.82 17.35 17.62 18.53 19.35 18.72 18.58 18.37 16.66 18.79 18.84 Q6AXY7 Prpf38b 2 196.5532081 499691 - 196.5532081 196.56229 pre-mrna-splicing factor 38b None LTKLEWFSTLFPRIPVPVQK None None 9986 16.08 16.29 17.04 16.41 16.6 16.89 15.39 16.08 17.43 16.05 15.98 17.45 16.7 17.12 15.95 16.23 16.6 17.14 17.2 17.34 18.35 16.86 16.42 17.49 16.88 16.22 17.4 16.32 17.42 17.01 18.37 B1WC67 Slc25a24 2 196.7612551 310791 + 196.7612551 196.799232 rcg29001 None AVKFWAYEQYKKLLTEEGQK None None 92693 17.93 18.72 17.66 18.2 17.77 16.21 18.27 18.9 17.28 18.23 16.92 16.64 17.33 16.52 18.79 17.96 17.53 17.22 17.65 16.84 16.07 17.64 16.77 16.95 17.82 18.56 18.19 17.57 16.57 16.79 17.97 F1LWB1 Vav3 2 197.0127361 295378 + 197.0127361 197.354321 vav guanine nucleotide exchange factor 3 None LAEIRQTEEKYTETLESIEK None 605541 38143 16.62 14.53 15.98 15.79 16.63 15.73 16.51 15.56 15.9 16.91 16.64 14.55 15.27 15.05 16.65 17.57 15.47 15.94 16.41 14.88 14.92 15.61 16.53 15.14 16.3 15.27 15.78 16.37 15.48 16.49 16.61 F1LWK9 Ntng1 2 197.4639461 295382 - 197.4639461 197.620692 netrin g1 None YGQLDTTKKLRDFFTVTDLR None 608818 8949 16.78 17.18 16.14 16.14 15.27 16.85 17.52 15.24 16.12 16.71 16.98 15.86 16.27 17.16 15.38 15.96 15.58 16.95 17.4 16.61 17.29 17.11 17.11 15.7 16.47 17.03 15.1 16.64 16.69 15.67 15.86 P63057 Olfm3 2 202.9106741 252920 + 202.9106741 202.95238 noelin-3 None KSIADFVSGAESRTYNLPFK None None 17103 17.43 17.84 17.34 17.04 17.86 16.48 18.32 17.36 17.54 16.98 16.82 17.81 17.22 18.07 18.37 16.36 16.66 16.37 18.29 17.04 17.83 17.36 16.39 16.22 17.39 17.28 17.45 17.79 17.14 17.87 18.33 P48303 S1pr1 2 203.6249021 29733 - 203.6249021 203.62911 sphingosine 1-phosphate receptor 1 None KDDGDNPETIMSSGNVNSSS None 601974 1071 17.43 18.94 17.56 16.72 17.75 17.29 17.65 17.48 17.9 17.14 16.73 18.1 17.03 17.9 18.47 16.47 17.22 17.38 18.08 16.2 18.42 17.21 16.15 17.44 17.26 17.03 17.92 17.37 17.08 17.05 18.35 Q569A7 Dph5 2 203.8046211 295394 + 203.8046211 203.83862 diphthine methyl ester synthase None RARGEAPAITEETLCVGLAR None 611075 6471 17.16 14.94 17.7 17.58 17.37 15.8 17.63 16.8 15.34 15.65 16.31 16.47 17.25 15.55 15.68 17.38 17.55 16.09 16.18 18.14 15.5 17.1 17.51 15.04 18.14 16.93 17.14 16.87 16.27 17.07 16.38 B1WC59 Extl2 2 203.9222211 310803 + 203.9222211 203.942966 exostoses (multiple)-like 2, isoform cra_a None SMVLIGASFFHSKYLDLFQK None 602411 1102 16.67 17.02 16.82 16.29 16.7 15.42 15.67 15.81 16.3 16.2 16.55 16.07 15.41 16.64 15.73 16.0 16.19 16.42 16.8 16.2 15.25 17.52 16.67 15.77 15.85 16.03 16.47 16.79 16.73 16.28 15.55 P29534 Vcam1 2 204.0381211 25361 - 204.0381211 204.057852 vascular cell adhesion protein 1 None YPFDHLEIELLKGETTLLNK None 192225 838 18.46 18.47 18.9 19.75 18.28 17.28 17.66 18.19 18.37 18.16 18.15 18.75 18.93 18.47 17.99 18.86 19.84 18.06 18.07 19.34 18.7 19.1 19.3 19.71 18.88 19.59 18.68 19.39 17.68 17.58 18.23 Q68FS8 Rtca 2 204.4551691 295395 - 204.4551691 204.476636 rna 3'-terminal phosphate cyclase None TEITFTPEKIRGGVHTADTK None None 2766 18.22 17.18 17.43 18.74 18.88 17.87 18.74 19.16 17.4 17.04 17.68 18.21 19.06 17.2 18.88 18.11 18.35 18.03 18.26 17.2 16.7 18.01 17.63 17.71 19.65 18.98 18.45 17.02 18.75 18.24 19.46 B2GV15 Dbt 2 204.4817451 29611 + 204.4817451 204.510611 dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex None FSNLWKSYLENPAFMLLDLK None 248610 1444 19.21 21.57 19.57 20.47 19.91 17.62 18.7 19.82 18.93 18.71 19.01 18.51 18.79 19.87 19.46 19.05 18.93 18.55 18.63 20.9 18.19 18.29 18.8 19.08 20.59 20.08 19.6 18.11 20.85 18.4 19.22 D4AEH9 Agl 2 204.7050541 362029 - 204.7050541 204.760828 4-alpha-glucanotransferase None GPNEYIQEIEFENLSPGSVIIFR None 610860 536 19.56 18.34 20.07 19.69 20.49 18.5 19.52 20.29 19.27 20.0 19.08 19.17 20.79 18.62 18.87 20.12 19.82 19.49 18.99 21.5 19.19 19.18 19.84 19.78 20.35 19.97 19.68 20.54 18.88 19.73 20.14 G3V864 Plppr4 2 205.3713141 295401 + 205.3713141 205.412295 2-lysophosphatidate phosphatase plppr4 None VTPVEGSEIGSETLSVSSSR None 607813 8895 18.67 16.9 18.23 17.86 18.01 19.01 17.08 17.5 18.34 17.66 17.88 18.28 18.54 17.89 18.23 19.87 17.97 18.9 18.12 17.26 18.3 17.81 18.86 19.43 18.42 18.91 18.45 18.61 17.6 17.81 18.46 Q7TMB7 Plppr4 2 205.3713141 295401 + 205.3713141 205.412295 2-lysophosphatidate phosphatase plppr4 None EPSRVGVNGDHHVPGNQYLK None 607813 8895 18.67 16.9 18.23 17.86 18.01 19.01 17.23 17.5 18.34 17.66 17.88 18.28 18.54 17.89 18.16 19.87 17.98 18.88 18.21 17.24 18.3 17.81 18.86 19.42 18.42 18.91 18.34 18.53 17.68 17.81 18.46 A0A0G2JZ34 Palmd 2 204.8898511 - 204.8898511 204.941102 palmdelphin None MEEAELVKGRLQAITDKRKI None None None 18.05 16.54 17.71 17.11 17.49 18.84 18.47 18.01 17.4 16.1 18.58 17.61 18.75 17.2 18.04 19.58 17.52 18.55 17.83 16.69 16.98 17.57 17.94 18.45 18.77 18.19 18.17 18.05 16.09 17.57 17.19 Q4KM62 Palmd 2 204.8898511 310811 - 204.8898511 204.941102 palmdelphin None RPMTPQRERVISPGPNSQER None None 9804 18.06 17.13 17.81 17.16 17.71 18.89 18.78 18.06 17.5 16.19 18.68 17.71 18.87 17.29 17.77 19.7 17.5 18.91 17.94 17.1 17.17 17.56 17.84 18.38 18.87 18.29 18.04 18.21 16.14 17.51 17.2 Q66H41 Snx7 2 205.8700021 310815 - 205.8700021 205.927662 rcg28719 None QNMQNDLRSAFTDTAEENIR None None 22941 17.74 15.64 16.36 16.45 15.71 17.84 16.78 16.6 16.49 17.74 18.73 16.89 17.46 17.83 17.86 16.81 18.01 16.76 16.86 15.45 16.84 18.36 17.39 16.76 16.17 16.81 18.26 17.65 15.59 16.95 16.45 F1LUI2 Gapdh 4 157.9623581 + 157.9623581 157.96623 gp_dh_c domain-containing protein None DNEYGYSNRVVDLMAYMASK None None None 24.47 22.56 23.19 23.74 24.37 22.9 24.11 24.75 23.19 24.2 22.13 23.41 23.65 22.51 22.61 23.99 23.19 24.21 23.31 24.06 22.33 22.79 22.91 24.32 23.74 24.79 24.38 22.76 22.1 23.38 24.76 Q66H20 Ptbp2 2 207.814071 310820 - 207.814071 207.873535 polypyrimidine tract-binding protein 2 None SKHQTVQLPREGLDDQGLTK None 608449 23162 18.65 17.28 19.99 18.36 18.73 19.19 17.71 18.25 19.67 18.53 18.27 19.33 19.2 19.37 19.61 17.83 18.11 19.29 19.68 18.84 20.6 19.25 19.16 19.72 18.29 17.63 20.12 17.79 19.07 19.33 20.16 P37397 Cnn3 2 209.5188991 54321 + 209.5188991 209.550072 calponin-3 None LQMGTNKGASQAGMSAPGTR None 602374 37533 19.09 16.58 18.84 19.0 18.13 18.6 18.9 18.38 19.02 18.97 17.79 18.76 18.63 19.04 18.78 18.35 18.51 18.66 20.18 17.52 20.16 18.25 19.16 18.87 18.27 19.06 19.9 18.42 17.15 19.15 19.47 P42533 F3 2 209.8271 25584 + 209.8271 209.838657 tissue factor None TECDLTDEIVKDVNWTYEAR None 134390 1511 16.03 17.47 16.02 17.45 18.0 15.87 15.7 17.37 15.93 15.82 17.91 17.52 17.83 15.81 16.55 17.83 16.39 16.72 16.52 18.81 15.79 16.59 18.17 17.4 17.94 17.73 16.19 17.81 17.71 16.17 15.84 Q66HI4 F3 2 209.8271 25584 + 209.8271 209.838657 tissue factor None None None None 16.03 17.47 16.02 17.45 18.0 15.87 15.7 17.37 15.93 15.82 17.91 17.52 17.83 15.81 16.56 17.83 16.49 16.69 16.47 18.81 15.79 16.59 18.17 17.4 17.94 17.73 16.19 17.81 17.71 16.17 15.84 P16970 Abcd3 2 209.8521091 25270 - 209.8521091 209.905643 atp-binding cassette sub-family d member 3 None GNLDNRIANPDQLLTQDVEK None 170995 2140 19.18 17.43 19.32 18.21 18.92 18.5 17.8 19.53 17.58 18.07 19.09 18.08 18.84 17.84 19.42 18.47 18.71 18.54 18.5 16.78 17.85 17.95 17.96 18.62 18.88 17.53 19.26 18.15 18.36 19.11 18.84 P48508 Gclm 2 210.3474831 29739 + 210.3474831 210.367535 glutamate--cysteine ligase regulatory subunit None DLTAFAKQFDIQLLTHNDPK None 601176 1557 19.29 19.41 17.84 18.29 19.0 18.1 18.82 19.41 18.19 18.93 18.86 18.86 17.68 17.8 18.45 18.49 17.97 19.03 18.32 18.56 17.47 17.83 17.77 18.66 17.06 18.08 18.64 18.18 17.34 17.86 17.77 D3ZAZ5 Bcar3 2 210.525261 310838 + 210.525261 210.638798 breast cancer anti-estrogen resistance protein 3 homolog None PNSPVFRTGSEPTLSPALVR None None 31181 15.39 15.22 15.2 16.03 16.66 15.16 15.64 14.98 15.59 14.49 15.23 15.73 15.59 15.42 15.3 15.27 15.99 14.72 15.52 14.77 15.35 14.86 16.6 14.45 16.27 15.5 16.25 15.02 15.6 16.1 15.3 Q2HWF0 Fnbp1l 2 210.6480791 310839 - 210.6480791 210.738436 formin-binding protein 1-like None EAEKAQQSYERLDNDTNATK None None None 18.13 17.08 17.31 18.24 16.44 17.22 16.84 17.22 17.72 18.09 17.13 16.97 17.29 18.32 17.42 17.19 17.55 18.36 18.12 15.92 17.64 18.01 18.05 18.6 17.48 18.02 16.96 17.06 17.94 17.08 16.82 O54735 Pde5a 2 210.859421 171115 + 210.859421 210.999701 cgmp-specific 3',5'-cyclic phosphodiesterase None KDAYEDPRFNAEVDQITGYK None 603310 842 16.09 15.51 15.93 15.77 16.5 15.88 16.75 16.37 17.09 15.07 15.87 17.12 16.24 16.69 17.1 15.31 15.35 16.46 17.1 15.03 17.52 15.43 15.45 14.69 16.49 15.63 16.97 17.0 15.64 16.61 17.62 D4A702 Synpo2 2 211.2170851 499702 - 211.2170851 211.371307 synaptopodin-2 None PEKADTSLTSGTTVQTSSGR None None 15400 15.16 16.09 15.65 15.13 15.07 14.68 16.27 15.83 15.44 16.54 16.62 14.7 15.03 15.96 14.72 15.88 15.86 15.26 15.18 16.38 14.41 16.68 15.94 15.76 15.04 15.14 15.5 16.01 14.1 15.35 15.56 G3V9S9 Sec24d 2 211.4186231 310843 + 211.4186231 211.526106 sec24 homolog d, copii coat complex component None NSLLKNCVLLSRPEISPDER None None 40986 15.51 16.71 17.31 17.02 16.42 16.06 16.98 17.08 16.0 16.28 17.96 16.41 17.49 17.24 16.49 16.11 16.42 16.95 16.65 17.49 17.99 16.99 17.39 17.37 18.38 16.52 16.11 17.44 16.58 16.41 16.67 B2RYI4 Mettl14 2 211.5306031 295428 - 211.5306031 211.546704 methyltransferase-like 14 None ELTPKFDVILLEPPLEEYYR None None None 15.9 13.96 15.26 15.59 15.68 14.82 14.82 15.92 15.53 16.13 14.8 16.19 15.89 15.42 14.67 14.89 15.98 15.97 15.07 16.96 16.94 15.66 16.15 15.98 16.48 16.35 16.37 14.89 16.3 16.29 16.58 D3ZW15 Sec24b 2 218.5630811 295461 - 218.5630811 218.632784 sec24 homolog b, copii coat complex component None YSSAVSSVPRSTLTAPSSLK None None 55968 17.76 16.53 18.15 17.88 16.01 16.08 17.58 17.45 17.01 15.99 17.69 16.64 17.81 17.47 18.98 17.08 16.43 17.17 17.36 16.58 19.02 16.69 16.8 17.24 18.04 18.39 18.23 17.96 15.62 17.41 18.43 P15791 Camk2d 2 215.0240051 24246 + 215.0240051 215.293865 calcium/calmodulin-dependent protein kinase type ii subunit delta None ICDPGLTAFEPEALGNLVEGMDFHR None 607708 55561 21.5 24.3 22.53 22.25 22.08 23.09 22.47 22.57 23.92 22.89 22.66 23.78 23.71 23.46 23.23 23.24 24.02 22.64 22.75 22.04 24.31 22.9 23.38 23.9 22.11 23.07 22.65 23.3 22.75 22.38 22.25 A0A0G2JZ56 Ank2 2 215.3803351 303135 - 215.3803351 215.799208 ankyrin 2 None PGTKFLGPVIVEIPHFAALR None 608418 57205 20.88 20.7 21.35 20.82 20.5 21.31 21.13 20.57 21.2 21.04 19.81 21.77 21.97 21.9 22.4 20.98 20.33 20.4 20.99 22.25 21.77 21.53 21.14 20.34 20.96 22.15 21.29 21.99 21.55 21.79 22.18 A0A0G2K6R9 Ank2 2 215.3803351 303135 - 215.3803351 215.799208 ankyrin 2 None GSSQRRKRPKKSDSNASFLR None 608418 57205 20.76 21.37 21.53 21.1 20.2 21.6 21.36 20.29 21.39 21.7 19.44 21.61 21.88 21.87 22.5 21.22 20.72 20.38 20.57 22.14 21.49 21.87 21.04 20.79 20.63 22.41 21.56 22.14 20.41 21.72 21.72 A0A0G2KBB9 Ank2 2 215.3803351 691335 - 215.3803351 215.799208 ankyrin 2 None QEKTVDEQEDMDLQISPDRK None 300683 62617 20.68 20.83 21.47 20.97 20.21 21.59 21.32 20.26 21.39 21.61 19.35 21.64 21.92 21.84 22.41 21.13 20.7 20.31 20.53 22.15 21.5 21.75 21.17 20.75 20.56 22.3 21.53 22.12 20.29 21.79 21.77 D4A4Q9 Ank2 2 215.3803351 - 215.3803351 215.799208 ankyrin 2 None EGANINAQSQNGFTPLYMAAQENHIDVVK None None None 19.82 19.03 20.34 19.74 19.56 20.17 19.52 19.82 19.91 20.03 18.78 20.23 20.59 21.04 21.24 19.42 19.27 19.37 19.3 21.16 20.85 20.0 19.89 19.56 20.15 21.03 20.32 21.29 20.11 20.88 21.24 F1LM42 Ank2 2 215.3803351 362036 - 215.3803351 215.799208 ankyrin 2 None QHHIFSFFAFKENRLPLFVK None 106410 81655 20.68 20.84 21.53 20.97 20.19 21.6 21.32 20.24 21.4 21.61 19.35 21.63 21.92 21.85 22.4 21.12 20.71 20.31 20.52 22.15 21.52 21.78 21.2 20.75 20.55 22.29 21.54 22.12 20.28 21.8 21.72 F1M9N9 Ank2 2 215.3803351 362036 - 215.3803351 215.799208 ankyrin 2 None SEIREDDAAFEARVKEEEQK None 106410 81655 20.75 21.35 21.6 21.09 20.18 21.6 21.36 20.28 21.38 21.68 19.44 21.58 21.89 21.87 22.47 21.22 20.71 20.37 20.57 22.17 21.5 21.88 21.09 20.8 20.66 22.42 21.57 22.13 20.4 21.74 21.67 M0R511 Ank2 2 215.3803351 362036 - 215.3803351 215.799208 ankyrin 2 None ALHLAAKEGHVGLVQELLGR None 106410 81655 19.88 18.9 20.25 19.71 19.54 20.15 19.55 19.76 20.01 20.02 18.78 20.15 20.6 21.12 21.12 19.39 19.33 19.44 19.19 21.2 20.89 20.03 20.03 19.62 20.12 21.08 20.3 21.2 20.11 20.96 21.09 Q5XI01 Larp7 2 215.9979521 686883 - 215.9979521 216.012746 la-related protein 7 None STQEKVSAQGPQFVTGVIVK None 612026 88843 17.01 16.25 17.93 17.35 16.72 17.0 16.5 17.08 17.15 16.6 17.34 18.37 17.65 17.57 18.1 16.68 17.22 17.12 17.27 16.5 18.88 17.46 17.29 16.82 17.11 16.82 17.89 17.69 17.77 17.59 18.96 A0A0G2JTI8 Enpep 2 217.7820061 64017 - 217.7820061 217.851947 aminopeptidase None NISLIHPKEYSALSNMPVEK None 138297 68216 17.43 16.55 15.68 17.88 17.69 16.9 17.33 17.67 17.81 16.62 16.45 18.22 15.38 16.22 15.41 17.23 17.61 17.62 17.44 15.93 15.8 15.89 17.31 17.57 17.27 16.95 16.48 17.09 16.02 17.6 17.42 P50123 Enpep 2 217.7820061 64017 - 217.7820061 217.851947 glutamyl aminopeptidase None WKNFRLPDFIQPVHYDLEVK None 138297 68216 17.53 16.26 15.73 17.78 17.88 16.95 17.2 17.54 17.9 16.63 16.5 18.21 15.44 16.25 15.45 17.35 17.61 17.67 17.42 15.89 15.74 15.84 17.42 17.6 17.2 16.84 16.25 17.14 16.21 17.64 17.45 Q6AYA1 Gar1 2 218.3752321 499709 - 218.3752321 218.382509 h/aca ribonucleoprotein complex subunit 1 None ENMKASSFKKLQKFYIDPYK None 606468 None 15.27 16.99 16.63 17.08 17.39 15.45 15.17 16.67 16.13 15.18 17.17 16.35 16.57 16.14 15.34 17.19 16.71 16.81 17.28 16.95 16.13 16.24 16.46 17.13 17.56 17.02 17.39 16.03 16.85 15.87 17.43 Q9WUW3 Cfi 2 218.3890011 79126 + 218.3890011 218.430567 complement factor i None KGCRGQAFLCKSGVCIPNQR None 217030 171 16.44 15.86 17.12 17.59 17.4 16.73 18.35 17.65 16.73 16.83 18.75 16.69 17.41 16.42 17.2 16.86 16.55 17.19 16.85 17.6 17.99 15.93 17.81 17.32 16.76 17.43 15.98 16.77 16.85 16.39 16.73 M0R7F6 Etnppl 2 219.1730811 687071 + 219.1730811 219.194647 ethanolamine-phosphate phospho-lyase None MELLNTNSRFLHDNIIEFAK None None None 14.24 16.42 15.9 15.0 14.14 14.25 15.36 14.84 14.22 14.03 15.55 13.61 14.92 15.22 15.57 14.44 13.87 14.74 14.63 15.97 15.35 16.06 14.21 13.94 15.81 15.66 15.24 14.99 14.82 14.96 14.74 B0K025 Ostc 2 219.2505581 362040 - 219.2505581 219.266095 oligosaccharyltransferase complex subunit ostc None VPFLVLECPNLKLKKPPWVH None None None 14.54 15.35 15.11 15.9 15.37 16.52 15.91 14.85 16.42 16.72 15.57 16.86 16.74 16.59 16.4 16.58 16.76 15.39 16.85 14.61 16.36 16.21 16.94 15.92 14.71 15.88 15.92 15.39 16.92 15.81 15.65 B2RZD4 Rpl34 2 219.2844211 362041 - 219.2844211 219.286795 60s ribosomal protein l34 None RLSKTKKHVSRAYGGSMCAK None None 105146 18.92 20.97 19.2 19.19 19.05 18.07 17.52 18.09 19.47 20.32 18.58 19.23 18.32 18.67 20.41 19.81 19.07 18.51 18.48 18.51 18.84 19.5 18.56 19.89 17.4 19.39 19.51 18.07 19.78 18.16 18.65 P11250 Rpl34 2 219.2844211 362041 - 219.2844211 219.286795 60s ribosomal protein l34 None HVRQVCPDRIKRAFLIEEQK None None 105146 19.04 20.01 18.84 18.48 18.76 18.23 17.29 19.38 19.11 19.96 18.22 18.87 17.79 17.66 19.78 19.35 19.41 17.92 18.23 18.46 18.33 18.55 18.47 19.55 17.04 19.03 19.18 17.56 19.38 17.55 18.76 Q9WVK7 Hadh 2 219.7879361 113965 - 219.7879361 219.830335 hydroxyacyl-coenzyme a dehydrogenase None VDQTEDILAKSKKGIEESLK None None 55888 20.41 19.59 21.16 20.91 18.93 19.56 20.04 20.81 19.21 19.69 21.33 19.26 21.04 20.6 21.29 20.33 19.48 19.93 19.38 21.79 21.02 20.57 20.15 21.18 21.14 20.53 20.71 19.62 19.62 19.82 20.65 A0A0G2K0L0 Papss1 2 220.0403851 295443 + 220.0403851 220.114395 3'-phosphoadenosine-5'-phosphosulfate synthase None TRGGFRGCTVWLTGLSGAGK None 603262 81740 18.96 18.02 18.39 17.73 18.82 18.07 17.82 19.24 18.58 16.07 18.62 17.96 17.46 18.02 17.24 18.1 18.17 18.14 17.39 19.73 18.17 16.91 17.17 17.73 19.23 17.94 19.16 17.44 18.02 17.78 18.14 Q4G079 Aimp1 2 221.151891 114632 - 221.151891 221.175509 aminoacyl trna synthetase complex-interacting multifunctional protein 1 None KHPDADSLYVEEVDVGEAAPR None 603605 None 19.35 17.38 19.63 19.8 17.83 17.54 18.46 19.6 17.57 17.93 20.1 19.08 19.95 19.85 20.85 18.72 19.08 17.98 18.46 19.09 19.48 19.08 19.29 19.96 20.27 19.13 19.43 19.97 17.48 19.43 19.35 A0A0G2K9Q0 Tbck 2 221.1757851 295446 + 221.1757851 221.348126 tbc1 domain-containing kinase None RISAEDLIDLCELTVTGHFK None None None 16.62 17.26 16.13 16.93 16.16 15.29 15.94 18.17 17.17 16.52 16.71 17.09 16.82 16.02 16.57 17.96 16.18 17.87 17.45 16.43 16.83 16.92 16.77 16.33 17.08 18.37 16.51 17.62 18.17 15.62 17.35 D4A830 Ppa2 2 221.8008531 310856 + 221.8008531 221.878081 inorganic diphosphatase None IKQDTKNGRLRYTPNIFPHK None 609988 5356 19.24 21.63 20.42 19.66 19.12 18.81 19.58 18.01 19.4 19.88 19.11 18.04 19.0 20.12 18.7 19.52 18.61 19.71 19.22 21.33 19.78 20.42 18.82 18.7 20.85 19.51 19.8 19.58 20.07 19.22 19.05 D4A1J4 Bdh2 2 223.7024131 295458 + 223.7024131 223.723072 3-hydroxybutyrate dehydrogenase type 2 None RVLDVTKKRQIDQFASEIEK None None 56036 16.38 16.5 16.46 16.44 16.5 15.87 16.59 15.74 15.35 15.37 17.82 16.68 15.51 15.58 15.45 16.57 15.39 16.33 16.41 17.32 16.27 16.59 14.93 16.27 16.17 15.47 16.03 16.5 15.37 16.07 17.64 D4AAE9 Cisd2 2 223.8289381 295457 - 223.8289381 223.853768 cdgsh iron sulfur domain 2 None QKENPKVVNEINIEDLNLTK None 611507 36436 20.3 18.68 20.69 19.08 18.66 19.29 19.56 19.93 19.74 19.31 20.42 18.49 20.2 20.6 20.05 19.11 19.54 19.81 18.93 20.65 20.61 20.47 19.85 20.07 20.21 19.48 18.96 20.06 20.19 20.32 20.35 P61078 Ube2d3 2 223.8696541 81920 + 223.8696541 223.897463 ubiquitin-conjugating enzyme e2 d3 None TRIYHPNINSNGSICLDILR None None 2506 18.06 17.75 16.57 18.18 18.43 16.53 18.75 18.98 17.33 17.1 17.23 17.57 17.71 16.73 16.51 18.1 17.09 18.32 18.06 18.23 16.77 17.24 17.32 16.67 18.52 19.32 17.07 18.49 17.3 16.82 18.84 F1LQH2 Nfkb1 2 224.0161511 81736 - 224.0161511 224.108418 nuclear factor nf-kappa-b p105 subunit None QEDVVEDLLRVGADLSLLDR None 164011 2971 17.0 16.68 16.28 16.7 16.11 16.24 15.61 16.26 15.64 15.69 17.04 15.15 15.66 16.25 16.8 15.78 14.95 16.75 16.74 15.49 15.36 16.93 15.59 17.18 17.81 16.95 17.2 15.98 15.23 16.07 16.92 P63329 Ppp3ca 2 225.1661121 24674 + 225.1661121 225.438974 serine/threonine-protein phosphatase 2b catalytic subunit alpha isoform None EESVALRIITEGASILRQEK None 114105 55497 22.67 21.14 21.18 22.04 22.42 22.92 21.68 21.74 22.76 22.24 21.81 22.79 22.52 22.0 20.56 22.78 22.45 22.29 22.74 22.35 22.07 21.73 22.7 21.71 21.37 22.13 21.38 22.78 23.22 22.42 22.4 A0A0G2JTM9 Dnajb14 2 226.2703681 499716 + 226.2703681 226.40248 dnaj heat shock protein family (hsp40) member b14 None IRNNCWKERQQKTDMQYAAK None None None 17.53 15.56 17.2 17.51 17.19 15.77 17.01 16.57 16.0 16.96 17.35 16.41 17.74 17.44 18.01 18.19 17.58 17.23 17.05 15.64 15.68 16.86 17.36 16.84 17.92 18.22 16.83 17.37 17.31 17.3 17.52 Q5U204 Lamtor3 2 226.4114691 362045 + 226.4114691 226.4236 ragulator complex protein lamtor3 None FLYKKLPSVEGLHAIVVSDR None None None 18.74 16.11 18.35 19.8 17.7 18.41 18.74 17.3 16.64 17.99 18.7 18.51 18.73 18.44 18.23 17.93 17.79 18.66 18.3 17.81 18.47 19.47 18.96 19.21 19.68 18.14 17.04 18.0 19.03 18.9 18.72 P12711 Adh5 2 226.9474671 100145871 + 226.9474671 226.987583 alcohol dehydrogenase class-3 None GRTWKGTAFGGWKSVESVPK None 103740 20162 20.67 22.72 21.87 20.68 20.23 20.81 21.25 20.89 20.76 21.24 19.62 20.34 20.22 20.37 19.9 20.03 19.97 21.17 20.49 22.3 22.13 21.47 19.78 20.19 20.67 20.95 20.89 20.31 21.12 20.14 21.21 Q7TQ90 Adh5 2 226.9474671 100145871 + 226.9474671 226.987583 alcohol dehydrogenase 5 None LCQKIRVTQGKGLMPDGTSR None 103740 20162 20.61 22.7 21.87 20.68 20.23 20.81 21.25 20.89 20.76 21.24 19.62 20.34 20.25 20.37 19.9 20.03 19.97 21.17 20.49 22.3 22.13 21.47 19.77 20.19 20.67 20.95 20.89 20.31 21.12 20.14 21.23 D3ZE72 Metap1 2 226.9913061 295500 - 226.9913061 227.02436 methionine aminopeptidase None VCETDGCSSEAKLQCPTCIK None None 6488 15.89 17.49 16.98 17.7 16.45 17.27 16.8 17.18 17.93 18.18 17.38 17.6 17.99 17.43 16.66 16.7 18.66 17.07 17.6 17.22 17.97 17.95 17.99 17.83 16.21 16.87 16.33 18.1 17.53 16.71 16.36 P63074 Eif4e 2 227.067351 117045 + 227.067351 227.099261 eukaryotic translation initiation factor 4e None PMWEDEKNKRGGRWLITLNK None 133440 100945 19.28 18.88 18.68 19.67 18.87 18.99 18.22 19.81 17.9 18.63 19.53 18.77 19.27 18.77 19.38 17.64 18.21 19.66 18.92 17.56 19.16 17.22 18.91 19.84 19.2 18.51 19.87 18.46 17.6 18.98 18.57 Q68VK5 Tspan5 2 227.2942181 362048 + 227.2942181 227.465663 tetraspanin-5 None CGYDARQKPEVDQQIVIYTK None 613136 4182 16.89 14.98 15.16 14.59 15.83 16.08 16.32 16.55 16.42 16.29 15.39 16.69 16.43 16.08 15.73 16.36 15.2 15.71 16.92 15.36 16.67 14.33 15.69 14.95 14.47 15.36 14.79 15.33 16.75 15.08 15.68 A0A0G2K1D2 Rap1gds1 2 227.5003681 310909 - 227.5003681 227.612994 rap1, gtp-gdp dissociation stimulator 1, isoform cra_a None LKTASDLMVLLLLGDESMQK None 179502 41422 22.35 20.71 21.31 21.14 22.02 21.55 22.29 21.02 21.68 22.02 21.75 21.1 21.62 21.63 19.82 20.28 21.09 22.34 21.81 21.38 21.79 21.82 22.32 19.96 21.56 20.37 21.58 22.33 20.67 21.27 21.52 F1M7Y3 Rap1gds1 2 227.5003681 310909 - 227.5003681 227.612994 rap1, gtp-gdp dissociation stimulator 1, isoform cra_b None None None None 22.31 20.82 21.38 21.08 21.97 21.59 22.34 20.89 21.67 21.95 21.85 21.2 21.65 21.65 19.78 20.29 21.0 22.41 21.89 21.49 21.94 21.89 22.3 20.01 21.56 20.28 21.34 22.19 20.86 21.2 21.56 Q06437 Pdha2 2 229.8723111 117098 - 229.8723111 229.873848 pyruvate dehydrogenase e1 component subunit alpha, testis-specific form None NRYGMGTAIERSAASTDYHK None 179061 129539 16.92 14.42 16.82 16.02 16.2 17.16 15.66 16.39 16.46 15.69 16.76 16.5 17.15 15.76 16.82 16.77 16.97 16.87 15.45 16.73 17.6 16.96 17.36 16.46 17.31 16.39 17.55 16.61 17.27 17.21 16.48 A0A0G2JTK0 Unc5c 2 230.3841751 362049 + 230.3841751 230.535217 netrin receptor unc5 None None None None 15.7 16.25 16.38 16.5 16.61 17.07 17.73 16.47 15.92 15.69 17.14 17.34 17.87 16.64 17.72 18.05 17.2 16.17 15.9 17.39 16.53 17.08 16.51 17.07 17.5 17.45 16.42 16.87 15.84 15.94 17.24 Q761X5 Unc5c 2 230.3841751 362049 + 230.3841751 230.535217 netrin receptor unc5c None PMAEVEWLKNEDIIDPVEDR None 603610 2765 15.7 16.25 16.38 16.5 16.61 17.07 17.73 16.47 15.92 15.69 17.14 17.34 17.87 16.64 17.76 18.05 17.19 16.12 16.01 17.23 16.53 17.08 16.51 17.07 17.5 17.45 16.42 16.87 15.84 15.94 17.24 M0R3J4 Bmpr1b 2 230.5416571 310914 - 230.5416571 230.584064 serine/threonine-protein kinase receptor CFK-43a None None None None 15.49 14.19 14.22 15.83 15.71 15.09 15.85 15.08 14.45 16.17 16.14 16.19 15.86 16.98 15.0 14.9 16.09 13.86 15.54 16.27 15.31 14.93 16.26 14.54 15.26 15.7 14.77 15.93 15.34 16.27 15.5 Q62920 Pdlim5 2 230.9552791 64353 - 230.9552791 231.120223 pdz and lim domain protein 5 None ANSTPEPSQQSASPLSAAESLESPGSNRPVVAGLR None None 21289 18.33 18.32 19.6 17.57 17.29 18.21 16.67 18.33 19.09 18.34 17.37 17.22 16.61 19.03 16.42 17.25 18.21 18.87 19.07 17.39 19.64 17.35 17.95 18.81 17.3 17.62 18.88 18.15 17.89 18.86 17.79 D3ZV82 Gbp6 2 231.2796471 685067 + 231.2796471 231.295905 similar to guanylate-binding protein family, member 6 None QVMESQERSYKENIVQLHEK None None None 15.49 13.22 14.96 14.86 14.72 14.61 14.81 15.47 15.29 14.19 15.01 14.85 15.38 16.0 15.29 15.47 15.96 16.15 14.97 13.81 14.54 16.22 16.15 15.84 16.32 15.66 16.17 15.1 14.39 15.18 15.43 Q63663 Gbp2 2 231.3324031 171164 + 231.3324031 231.348573 guanylate-binding protein 1 None LEKKYNQAPGKGLEAEAVLK None 600412 10289 16.94 15.45 17.25 16.13 15.84 17.14 16.63 17.28 17.06 16.36 18.39 15.99 16.13 16.7 18.38 16.1 15.94 16.66 17.01 15.93 18.14 17.07 17.0 17.46 16.73 15.82 17.46 17.17 15.2 17.06 18.23 F1M572 Kyat3 2 231.7064791 541589 + 231.7064791 231.747027 cysteine-s-conjugate beta-lyase 2 Ccbl2; Kat3 None None None None 18.43 15.97 18.6 16.95 17.0 18.94 15.6 16.79 18.56 18.6 16.88 16.5 16.96 18.85 16.22 16.8 18.3 18.34 18.33 16.38 18.91 16.88 18.81 17.87 16.89 16.58 18.34 18.07 17.8 18.57 16.84 Q58FK9 Kyat3 2 231.7064791 541589 + 231.7064791 231.747027 kynurenine--oxoglutarate transaminase 3 None DGMKWTSSDWTFNPQELESK None 610656 2994 19.98 17.81 19.82 18.2 18.27 20.14 16.83 18.12 19.78 19.94 18.01 17.77 17.79 20.09 17.39 18.03 19.52 19.6 19.57 17.71 20.18 18.01 19.71 19.25 18.14 17.9 19.45 19.13 19.31 19.7 18.32 F1LPA4 Pkn2 2 231.7935851 207122 - 231.7935851 231.898953 protein kinase c None WRSLCAVKFLRLEDFLDNQR None 602549 2054 17.02 14.84 16.31 15.68 16.54 16.86 17.29 16.73 15.58 15.02 17.63 16.03 16.09 16.53 16.23 16.77 15.79 16.4 16.9 15.64 15.42 15.75 16.78 16.04 17.7 15.94 15.85 16.69 15.54 17.28 16.83 O08874 Pkn2 2 231.7935851 207122 - 231.7935851 231.898953 serine/threonine-protein kinase n2 None RIKREIRKELKIKEGAENLR None 602549 2054 16.8 14.62 16.14 15.3 16.04 16.94 16.66 16.55 15.25 14.88 17.3 15.69 15.87 16.31 16.06 16.68 15.51 16.38 16.73 15.49 15.31 15.3 16.56 15.79 17.56 15.84 16.31 16.33 15.3 17.06 16.61 Q923V8 Selenof 2 233.6420761 113922 + 233.6420761 233.674847 selenoprotein f None LPLDPVCRGCCQEEAQFETK None 606254 3145 18.2 16.22 17.42 17.08 17.24 17.68 17.88 17.25 18.06 17.83 19.29 18.17 18.25 18.38 17.55 17.69 16.83 18.21 17.41 18.15 19.01 18.82 18.21 16.31 17.12 16.6 17.9 18.26 18.56 18.26 18.19 Q6AYE2 Sh3glb1 2 233.7504661 292156 - 233.7504661 233.784784 endophilin-b1 None TIAKERKLLQNKRLDLDAAK None None 9337 20.83 19.72 20.55 18.99 19.78 20.43 18.53 20.36 20.66 20.56 20.11 19.06 19.7 20.77 18.9 19.25 20.03 19.84 19.5 20.81 19.51 19.06 19.99 20.89 19.43 18.33 20.05 18.93 20.04 20.13 19.72 O08557 Ddah1 2 234.6675631 64157 + 234.6675631 234.800327 n(g),n(g)-dimethylarginine dimethylaminohydrolase 1 None ESLCRHALRRSQGEEVDFAR None 604743 8120 20.98 22.15 20.52 20.83 19.51 20.45 21.96 20.33 19.68 22.09 20.68 19.81 20.68 20.95 19.66 20.45 20.97 20.89 19.8 22.31 20.44 22.16 20.4 20.48 20.79 21.79 20.27 19.61 20.81 20.72 19.44 Q9QYN5 Bcl10 2 234.8409571 83477 + 234.8409571 234.85052 b-cell lymphoma/leukemia 10 None LLDYLQENPKGLDTLVESIR None 603517 2912 16.54 14.76 16.68 16.98 15.75 15.03 17.94 17.57 16.2 15.46 17.93 16.24 17.33 16.45 15.58 15.88 15.43 16.23 16.9 17.66 16.46 16.15 16.89 15.12 16.7 16.22 16.06 15.88 16.92 17.74 15.7 D4A6E8 Rgd1560065 2 234.8532581 499724 + 234.8532581 234.860045 similar to riken cdna 2410004b18 None AIKWSNIYEDNGDDAPQNAK None None 11968 16.63 15.21 17.6 16.27 15.74 17.94 16.33 15.38 16.42 16.44 15.52 16.29 16.75 17.23 15.05 16.05 16.64 17.71 16.71 16.34 18.01 17.0 17.07 15.91 16.65 16.73 15.99 16.63 18.19 16.87 17.64 Q01460 Ctbs 2 235.3405761 81652 + 235.3405761 235.355088 di-n-acetylchitobiase None KVPFRGAPCSDAAGHQVPYR None 600873 3231 16.12 15.2 15.57 16.66 16.11 13.64 16.3 16.18 14.8 15.9 15.54 14.63 15.05 14.9 14.91 15.78 15.83 15.92 14.7 15.95 15.27 15.05 14.53 13.84 15.48 16.24 14.98 15.78 16.03 15.62 15.83 P68182 Prkacb 2 235.6398661 293508 - 235.6398661 235.726052 camp-dependent protein kinase catalytic subunit beta None ATTDWIAIYQRKVEAPFIPK None 176892 121718 22.45 22.2 21.99 21.5 20.4 21.19 21.77 21.12 22.35 22.14 20.83 20.17 21.0 22.25 21.29 20.77 22.53 21.54 21.77 20.0 22.1 22.56 21.28 21.54 21.26 21.89 21.4 22.04 20.45 21.22 21.54 Q5XIP0 Dnajb4 2 241.1294121 295549 - 241.1294121 241.159089 dnaj (hsp40) homolog, subfamily b, member 4 None GKDYYHILGIEKGATDEDIK None None None 20.24 19.02 19.05 19.8 20.17 19.16 20.24 19.13 18.87 17.81 20.26 19.65 20.05 19.04 20.6 21.11 20.23 19.49 18.81 18.91 18.33 19.68 19.49 19.14 20.55 20.71 20.53 19.86 18.08 19.87 20.01 Q32PX7 Fubp1 2 241.1595271 654496 + 241.1595271 241.183414 far upstream element-binding protein 1 None TGTPESVQSAKRLLDQIVEK None 603444 48253 19.39 19.39 21.01 19.85 20.13 19.15 18.91 20.02 20.66 19.47 18.6 20.01 19.95 19.73 20.55 19.24 18.98 20.3 19.79 20.84 21.3 19.75 19.57 20.27 20.04 19.7 20.76 19.39 20.43 19.84 21.69 Q9Z2J4 Nexn 2 241.1871941 246172 - 241.1871941 241.218203 nexilin None QRKRTEEERKRRIEQDLLEK None 613121 44892 18.16 16.87 16.67 16.14 17.45 16.31 17.66 17.38 17.77 18.01 16.82 16.32 16.64 17.72 17.42 16.61 17.51 15.66 16.48 18.19 16.88 18.25 17.55 16.55 16.65 16.73 16.74 17.14 17.15 17.02 17.94 A0A0G2K2T2 Miga1 2 241.2272651 362058 - 241.2272651 241.27691 mitoguardin 1 None CCFFKNQVLFFLKDIFDFEK None None None 16.72 14.49 15.77 17.16 16.07 17.18 16.66 15.94 16.38 16.62 17.1 14.73 16.34 15.65 16.38 15.99 16.36 15.64 17.43 15.08 16.04 16.63 17.17 16.16 16.45 16.5 15.91 16.62 16.03 16.47 16.05 F1LPJ7 Usp33 2 241.2944071 310960 + 241.2944071 241.328472 ubiquitin carboxyl-terminal hydrolase None ASEYITDVHLNDLSTPQILPSNESVNPR None None 8996 15.54 16.06 15.63 15.33 15.31 14.83 15.19 16.18 15.56 15.68 16.13 14.89 15.06 16.49 14.89 15.62 16.63 15.09 15.15 16.05 15.46 15.82 15.0 16.29 16.66 14.77 14.92 15.4 16.07 15.1 16.14 M0R7U1 Ak5 2 241.3972981 365985 - 241.3972981 241.581458 nucleoside-diphosphate kinase None VEDLRKCKIIFLMGGPGSGK None None 76103 19.33 18.26 18.07 18.66 18.01 18.82 18.62 19.18 18.34 18.51 18.59 18.93 19.51 18.45 19.03 19.91 19.37 19.14 18.58 17.04 18.04 18.15 18.51 19.23 18.62 19.64 18.69 18.89 17.99 17.92 18.16 O88923 Adgrl2 2 237.6960571 171447 - 237.6960571 237.900288 adhesion g protein-coupled receptor l2 None GEHVDVPFPNQYQYIAAVDYNPR None None 22712 17.04 15.19 16.18 17.45 16.62 16.71 16.18 16.71 15.88 16.09 17.36 17.46 17.58 16.31 16.24 16.59 17.12 15.62 17.08 15.77 15.39 16.36 16.81 16.59 16.21 16.15 16.56 16.45 16.59 16.41 15.97 Q08603 Rabggtb 2 242.8447591 25533 - 242.8447591 242.850025 geranylgeranyl transferase type-2 subunit beta None IASYGSKKDDYEYCMSEYLR None 179080 3371 19.35 18.11 19.1 18.09 18.58 19.61 18.79 18.61 17.62 18.67 20.03 17.58 17.67 17.83 17.4 19.07 19.29 18.59 18.27 19.93 18.85 19.18 18.67 18.38 18.96 17.85 18.36 17.83 18.93 18.82 17.91 P08503 Acadm 2 242.8588661 24158 - 242.8588661 242.883036 medium-chain specific acyl-coa dehydrogenase None ELNMGQRCSDTRGITFEDVR None 607008 3 18.96 17.86 19.17 17.56 17.69 18.43 19.1 17.36 18.51 17.98 18.25 18.95 18.36 19.11 20.09 17.07 17.53 17.88 17.94 17.67 19.45 18.87 18.26 17.48 16.88 17.63 19.18 18.77 16.85 17.31 19.13 Q6AYT0 Cryz 2 243.552111 362061 + 243.552111 243.579723 quinone oxidoreductase None QIARAHGLKVLGTAGSEEGK None 123691 133907 19.19 17.19 19.4 18.38 18.9 18.86 19.21 18.89 18.0 18.04 19.09 18.64 18.85 18.51 18.38 18.81 18.05 19.03 18.28 20.32 19.0 18.41 19.11 18.43 18.88 18.9 18.86 17.92 18.99 19.3 19.59 A0A0G2K0C0 Fpgt 2 244.0990771 310935 - 244.0990771 244.119899 fucose-1-phosphate guanylyltransferase None GKPVAAGEFWDVVAITAADEK None None 2847 16.11 15.59 16.53 17.21 16.83 16.73 16.21 16.52 15.73 15.61 17.51 16.25 16.46 15.86 14.73 16.33 16.79 17.34 16.44 16.57 15.7 15.45 15.64 16.74 17.61 15.37 15.94 15.25 17.71 17.94 15.18 Q9Z0J8 Negr1 2 245.6246811 59318 + 245.6246811 246.35673 neuronal growth regulator 1 None FAGGDKWSVDPRVSISTLNK None 613173 41447 18.55 20.86 19.65 20.4 19.93 19.79 20.36 20.67 20.75 20.9 19.8 21.06 21.16 20.2 19.97 20.35 20.23 20.36 21.13 19.55 20.99 20.16 20.45 19.23 18.83 20.23 19.72 20.58 21.59 19.61 19.77 O35986 Zranb2 2 246.573381 58821 + 246.573381 246.586868 zinc finger ran-binding domain-containing protein 2 None DDADLSKYNLDASEEEDSNK None None 135921 17.89 16.65 18.43 17.69 17.3 17.66 17.32 17.34 18.66 17.08 17.19 18.48 18.35 18.57 17.77 17.35 17.06 18.48 18.44 18.6 19.81 18.44 18.43 18.4 18.52 18.18 18.24 17.94 18.33 18.5 18.92 P18757 Cth 2 246.9834621 24962 - 246.9834621 247.002225 cystathionine gamma-lyase None LATTFKQDSPGQSSGFVYSR None 607657 1432 17.81 18.98 17.76 17.75 16.48 18.33 18.03 16.7 16.84 18.85 17.54 16.73 17.08 17.61 17.17 17.81 18.04 17.2 17.19 17.69 17.23 18.68 17.87 17.86 17.1 18.46 17.21 17.42 17.68 16.62 16.73 A0A0G2QC38 Srsf11 2 247.0746331 502603 - 247.0746331 247.101426 serine and arginine-rich-splicing factor 11 None STVDPKLNHVAAGLVSPSLK None None None 17.74 16.54 18.83 17.96 18.13 17.17 16.51 17.82 18.26 16.74 17.79 18.08 18.04 18.08 17.99 17.49 18.23 17.79 17.49 18.78 19.25 17.86 17.99 18.7 19.05 17.51 19.13 17.52 18.13 18.33 19.51 G3V7I7 Lrrc40 2 247.1015131 310946 + 247.1015131 247.130454 leucine-rich repeat-containing 40 None AGFRTESKDRGPTVPQGLLK None None 9825 18.01 18.73 18.55 17.39 17.35 17.9 17.29 17.15 17.49 16.92 17.4 16.48 17.45 17.73 18.94 16.46 17.19 17.45 17.85 16.49 17.45 19.47 17.25 17.95 18.21 17.46 18.17 18.48 16.26 16.62 18.19 P70587 Lrrc7 2 247.1477531 117284 - 247.1477531 247.53334 leucine-rich repeat-containing protein 7 None MSLRSNKLEFLPEEIGQMQR None None 10817 18.86 18.24 17.51 18.31 17.88 18.71 18.0 17.94 18.81 19.47 18.77 18.08 18.79 18.71 18.32 19.28 18.98 17.82 19.36 17.39 18.41 18.39 19.16 19.41 17.89 18.7 18.54 18.55 17.52 17.55 17.86 Q6P689 Wls 2 248.9319031 362065 + 248.9319031 249.048298 protein wntless homolog None GRHYECDVLPFMEIGSVAHK None 611514 None 17.15 14.44 17.3 15.76 17.1 16.44 16.97 18.6 15.51 16.84 17.68 16.27 17.07 16.32 16.56 16.75 16.86 16.92 17.34 16.72 16.05 16.32 17.43 17.04 18.07 16.21 17.04 16.34 16.31 17.05 17.19 Q01984 Hnmt 3 6.5914591 81676 - 6.5914591 6.623885 histamine n-methyltransferase None SNMENIKFAWHKETSSEYQK None 605238 5032 16.59 15.51 17.32 16.98 15.96 17.65 18.06 15.42 16.26 16.71 16.58 15.82 16.32 16.18 16.4 16.46 16.08 17.0 16.13 17.82 17.1 17.96 17.33 16.1 16.94 17.1 16.99 16.48 15.23 16.67 16.49 Q02294 Cacna1b 3 7.3809191 257648 - 7.3809191 7.545957 voltage-dependent n-type calcium channel subunit alpha-1b None GNKSKPEGTEATEGADPPRR None 601012 20184 18.14 17.84 17.47 18.39 17.23 17.62 16.98 17.27 17.8 18.12 18.04 18.33 18.23 18.19 17.71 18.15 18.06 17.92 18.96 16.27 18.02 18.02 17.87 18.37 17.06 18.3 18.1 18.89 17.05 17.35 17.37 B0BNL6 Arrdc1 3 7.7350111 366001 - 7.7350111 7.742066 arrestin domain-containing protein 1 None AKRWIYDVRTIAEVEGTGVK None None 34835 17.01 17.83 16.5 16.73 17.37 17.33 18.19 16.6 16.33 15.99 16.79 17.48 17.55 17.34 17.81 16.82 17.0 16.9 17.62 16.1 17.32 18.24 17.31 16.42 18.69 18.34 16.5 18.47 16.44 17.14 17.02 Q5BJX1 Mrpl41 3 7.780661 296551 - 7.780661 7.781576 39s ribosomal protein l41 None APAIEKDFKEGTFDANNLEK None 611846 13036 16.71 15.25 16.85 16.36 16.09 17.1 15.21 16.77 16.1 16.19 15.75 17.93 16.65 16.65 17.39 17.17 16.5 16.96 16.76 16.07 17.35 17.85 18.23 17.46 18.57 16.75 17.35 17.52 17.04 17.53 17.16 D4A9M2 Nsmf 3 7.8618731 117536 + 7.8618731 7.870614 nmda receptor synaptonuclear-signaling and neuronal migration factor Jac; Jacob; Nelf None None None None 16.34 15.21 15.65 16.07 14.96 17.01 16.28 15.29 16.6 16.75 16.24 16.17 16.37 16.22 16.03 17.43 16.67 16.0 17.16 14.53 16.37 15.78 17.26 16.31 15.76 16.08 15.96 16.35 15.7 15.43 16.19 D4AAJ2 Nsmf 3 7.8618731 117536 + 7.8618731 7.870614 nmda receptor synaptonuclear-signaling and neuronal migration factor None HKKLERMYSVDGVSDDVPIR None 608137 10648 16.34 15.21 15.65 16.07 14.96 17.01 16.01 15.29 16.6 16.75 16.24 16.17 16.37 16.22 16.1 17.43 16.51 16.2 17.1 14.51 16.37 15.78 17.26 16.05 15.76 16.08 15.88 16.46 16.24 15.43 16.19 Q9EPI6 Nsmf 3 7.8618731 117536 + 7.8618731 7.870614 nmda receptor synaptonuclear signaling and neuronal migration factor None DTEKGLEATACDTEGFLPPK None 608137 10648 16.3 15.17 15.56 16.1 14.77 17.04 15.98 15.36 16.69 16.82 16.1 16.24 16.34 16.17 16.06 17.33 16.48 16.17 17.07 14.47 16.27 15.77 17.23 16.02 15.65 15.91 15.85 16.43 16.21 15.4 16.16 D4ACV0 Nelfb 3 8.0108871 311796 - 8.0108871 8.027403 negative elongation factor complex member b None LHNFFSPSPKTRRQGEVVQK None 611180 121600 16.04 15.58 17.1 16.02 16.7 15.97 17.02 16.5 17.18 16.37 16.45 15.58 16.38 16.56 17.95 15.52 16.59 15.96 16.73 15.63 18.05 16.97 16.37 16.56 17.02 16.57 17.51 17.07 14.97 17.42 17.93 Q6P9T8 Tubb4b 3 8.0379891 296554 - 8.0379891 8.040227 tubulin beta-4b chain None KYVPRAVLVDLEPGTMDSVR None None 68504 22.98 25.45 24.48 24.5 23.8 25.34 24.51 24.66 23.85 25.97 23.74 24.69 25.4 23.97 25.31 25.44 24.61 24.85 25.21 23.22 24.83 25.27 25.3 24.84 24.87 25.34 24.49 23.88 25.93 24.22 24.08 B2RYJ1 Anapc2 3 8.0864511 296558 + 8.0864511 8.098182 anaphase-promoting complex subunit 2 None SKRKGEGGTDPELEGELDSR None 606946 8359 17.39 14.71 17.61 17.84 15.83 16.48 16.02 17.42 16.2 16.16 17.73 15.86 16.84 16.3 17.37 17.09 16.92 16.32 17.8 15.48 17.99 15.89 17.16 16.52 18.29 16.81 17.17 16.28 17.9 17.28 17.67 P35439 Grin1 3 8.1028321 24408 - 8.1028321 8.130603 glutamate receptor ionotropic, nmda 1 None RRSSKDTSTGGGRGALQNQK None 138249 7187 18.73 19.74 17.68 18.44 17.96 18.76 17.46 18.12 18.94 19.16 18.55 19.0 18.72 18.46 18.78 19.78 19.51 18.35 18.66 17.2 18.8 17.9 18.53 19.5 17.75 18.96 18.8 18.37 18.61 17.18 18.13 Q62648 Grin1 3 8.1028321 24408 - 8.1028321 8.130603 glutamate receptor None GINDPRLRNPSDKFIYATVK None 138249 7187 18.78 19.72 17.68 18.46 18.05 18.52 17.52 18.08 18.82 19.35 18.49 18.98 18.72 18.36 18.78 19.81 19.51 18.35 18.66 17.2 18.89 17.9 18.47 19.5 17.75 18.99 18.77 18.35 18.6 17.19 18.19 B2GUY0 Man1b1 3 8.1439431 499751 + 8.1439431 8.165005 endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase None ELSRLTGIKKFQEAVEEVTK None None 5230 16.38 14.4 16.89 16.73 16.68 15.25 16.23 17.03 15.41 15.31 16.48 15.21 16.96 15.71 14.86 16.93 16.6 16.99 15.35 16.27 14.37 15.62 16.3 15.77 17.01 17.16 17.08 15.85 15.43 16.84 16.24 Q9EPB1 Dpp7 3 8.1650921 83799 - 8.1650921 8.169343 dipeptidyl peptidase 2 None GNPDQFFRDVTADFYGQSPK None None 22748 18.26 16.64 17.77 17.44 17.68 19.12 18.47 17.67 17.43 17.76 18.43 19.18 17.94 18.0 17.54 17.27 16.6 19.29 17.49 18.68 19.02 17.77 18.47 18.14 18.57 16.36 17.95 17.27 17.78 18.73 18.28 B5DEH4 Uap1l1 3 8.1752191 296560 - 8.1752191 8.180483 udp-n-acetylglucosamine pyrophosphorylase 1-like 1 None FKEHDFFHLDPANVVLFEQR None None 71313 18.36 15.32 17.74 16.57 18.36 16.98 18.88 18.73 17.51 15.91 18.81 16.51 17.51 16.52 16.84 16.4 17.13 18.56 17.48 16.66 18.03 17.61 18.08 16.57 17.87 18.1 17.18 18.18 16.28 18.13 17.51 O35795 Entpd2 3 8.2135841 64467 + 8.2135841 8.219223 ectonucleoside triphosphate diphosphohydrolase 2 None TARVLEAVTQTLTQYPFDFR None 602012 20333 16.03 15.89 16.81 16.6 16.89 17.24 17.53 16.97 17.89 17.85 17.13 17.66 18.08 17.46 15.9 16.77 18.09 17.36 17.09 17.37 18.23 18.05 17.69 17.76 15.84 16.77 16.04 17.54 17.07 17.31 17.57 Q6AY81 Npdc1 3 8.2207941 296562 + 8.2207941 8.226444 neural proliferation, differentiation and control, 1 None CPPGAHACGPCLQSFQEDQR None 605798 32050 16.52 17.43 16.02 16.83 15.61 17.54 16.54 16.6 16.73 17.29 16.01 17.13 17.28 16.8 15.79 16.02 16.86 16.14 15.65 17.94 15.7 17.45 15.49 16.72 15.24 16.26 17.27 16.17 16.04 16.33 16.15 Q9ESR9 Abca2 3 8.244661 79248 + 8.244661 8.264584 atp-binding cassette sub-family a member 2 None EYRLRLSPDASPQQLVSTFR None 600047 55590 19.08 16.31 17.53 18.11 18.05 18.49 18.63 18.75 16.89 17.61 18.68 18.37 17.63 17.53 17.13 18.41 18.49 17.09 17.89 18.48 16.67 17.16 17.7 17.75 18.83 16.92 17.38 16.97 18.71 19.07 17.68 A0A0G2QC22 Paxx 3 8.2747321 296565 - 8.2747321 8.276397 paxx, non-homologous end joining factor None TEDIHSRFRAACQQQAVTVR None None 17788 15.34 16.49 15.28 15.49 16.48 16.36 14.56 16.07 15.13 15.93 15.88 17.03 14.34 14.77 16.53 15.99 14.77 15.25 15.45 15.83 14.63 14.78 14.54 15.9 14.6 14.68 16.34 14.09 16.36 15.23 16.5 P22057 Ptgds 3 8.2818981 25526 - 8.2818981 8.284858 prostaglandin-h2 d-isomerase None FSKGTKGPGQDFRMATLYSR None 176803 737 17.96 18.78 18.26 17.48 18.2 17.13 19.26 19.58 18.57 17.83 19.75 17.29 17.56 19.26 17.7 17.42 19.02 17.91 17.61 18.46 17.76 17.78 17.7 17.06 18.48 17.31 18.44 18.5 17.3 17.97 17.69 D3ZPI8 C8g 3 8.3204961 296545 - 8.3204961 8.323495 complement c8 gamma chain None AEATTLHIAPQGAAMAASTFR None 120930 505 16.45 16.05 15.07 16.4 15.68 15.15 16.81 16.14 14.97 15.12 17.13 16.36 15.1 15.11 15.68 14.83 15.18 15.47 15.24 16.47 16.69 14.82 15.43 15.94 15.61 15.8 14.47 15.42 15.64 15.54 14.58 P69736 Edf1 3 8.3770591 296570 + 8.3770591 8.381363 endothelial differentiation-related factor 1 None IERAIGLKLRGKDIGKPIEK None None 2809 17.39 19.11 17.85 18.54 18.33 17.91 17.2 17.94 18.81 16.66 18.6 18.15 18.0 18.77 18.05 18.85 18.58 18.77 17.53 18.76 17.55 18.45 17.51 19.06 18.81 18.76 18.42 17.56 18.99 18.2 18.12 D3ZP47 Phpt1 3 8.3928871 296571 - 8.3928871 8.394359 14 kda phosphohistidine phosphatase None TEKIKAKYPDYEVTWADDGY None 610167 8573 19.97 21.02 20.21 18.85 19.44 19.91 20.95 20.03 19.62 20.78 18.54 18.67 18.89 18.65 18.91 20.21 20.09 19.19 18.97 21.16 19.25 20.71 18.7 18.57 19.13 20.82 19.55 19.73 19.27 19.14 19.95 D3ZTF0 Ajm1 3 8.396541 362083 - 8.396541 8.399463 apical junction component 1 homolog None SFDFLEALDEPTMETHPEPPPPEPAPPR None None 19943 16.95 17.63 16.79 16.54 17.13 16.82 16.47 16.55 18.0 17.15 16.02 17.69 17.4 17.55 16.78 16.99 17.2 17.14 18.1 16.16 18.27 16.82 16.42 17.88 16.97 16.87 17.02 17.2 17.16 16.85 17.87 D3ZKQ4 Rabl6 3 8.4026671 362084 - 8.4026671 8.428588 rab, member ras oncogene family-like 6 None LFGTSPAAEATISPPEPAPALEAPVR None None None 19.37 17.48 19.89 19.03 18.53 18.4 19.07 17.86 19.51 18.7 18.19 18.92 19.41 19.32 17.6 18.73 19.23 18.64 18.98 20.14 19.71 19.48 19.25 17.88 19.07 18.64 18.48 19.03 20.34 19.59 19.49 D3ZK53 Tmem141 3 8.4395341 499755 - 8.4395341 8.441491 transmembrane protein 141 None VDDAVAAKHPGLEEYAACQS None None 75339 17.74 16.12 17.44 17.57 16.66 16.36 17.38 18.13 17.07 17.58 18.02 17.38 18.33 17.51 18.2 18.3 18.23 17.01 17.09 16.66 17.94 16.45 16.04 18.29 17.43 18.18 16.71 17.38 17.77 18.04 17.81 D3ZNI9 Kcnt1 3 8.6831891 60444 + 8.6831891 8.737548 potassium channel subfamily t member 1 None GSTHGRHGGSADPVEHPLLR None 608167 11055 16.09 15.86 15.94 15.7 16.65 16.02 16.85 16.62 17.66 15.98 16.66 16.23 17.09 16.55 16.03 15.64 16.43 16.91 16.93 16.38 17.47 16.25 15.92 15.86 16.99 15.99 15.01 17.59 16.96 17.0 17.76 Q9Z258 Kcnt1 3 8.6831891 60444 + 8.6831891 8.737548 potassium channel subfamily t member 1 None AGPGDTPAGSAAPEEPHGLSPLLPTR None 608167 11055 15.59 15.3 15.58 15.2 17.27 15.46 16.59 16.91 17.6 16.69 15.8 15.89 16.74 16.32 15.78 15.6 16.17 16.66 16.67 16.13 17.02 15.55 16.14 15.61 16.71 15.4 14.75 17.33 16.7 16.89 17.17 A0A0G2K5T1 Camsap1 3 8.7461771 296580 - 8.7461771 8.806072 calmodulin-regulated spectrin-associated protein 1 None TFGLSSCKDANIVSEQMNFK None None 19202 17.24 18.74 18.13 18.16 16.78 18.77 16.86 16.8 18.28 17.81 17.39 17.8 17.63 18.69 18.42 17.6 18.21 18.19 18.57 15.95 18.96 18.64 18.05 18.41 18.14 18.42 18.41 17.76 18.16 18.92 16.95 D3Z8E6 Camsap1 3 8.7461771 296580 - 8.7461771 8.806072 calmodulin-regulated spectrin-associated protein 1 None EGLDTSVQEAELSSSAITGK None None 19202 17.23 18.72 18.2 18.15 16.75 18.88 16.9 16.79 18.21 17.81 17.6 17.9 17.72 18.61 18.46 17.67 18.19 18.04 18.61 15.98 18.93 18.69 18.13 18.4 18.12 18.24 18.41 17.83 18.05 18.88 16.87 Q5XIR9 Ubac1 3 8.8254481 362087 - 8.8254481 8.848028 ubiquitin-associated domain-containing protein 1 None RDFQTELRKILVSLIEVAQK None 608129 9409 18.23 19.51 17.69 17.06 18.18 16.56 19.0 17.94 18.15 17.74 18.2 17.3 17.2 17.72 16.77 17.15 16.85 18.41 18.24 18.54 17.89 17.97 16.96 17.11 17.07 18.79 17.62 18.34 16.68 16.8 17.63 Q562B4 Nacc2 3 8.881911 296583 - 8.881911 8.94666 nucleus accumbens-associated protein 2 None FEQRIYAERRNDAATIVALR None None None 15.65 14.29 15.87 15.73 15.04 15.14 15.04 16.0 15.68 14.82 14.68 15.51 15.74 15.12 15.96 15.53 15.76 15.47 15.73 14.66 16.76 15.05 15.28 16.68 17.35 15.67 15.5 14.67 16.38 15.9 17.24 Q9R080 Gpsm1 3 9.1408651 246254 + 9.1408651 9.167827 g-protein-signaling modulator 1 None DEAIVCCQRHLDIAQEQGDK None None 16987 17.07 18.49 19.09 18.32 17.74 17.25 17.75 17.64 18.67 17.83 17.16 17.5 18.19 17.87 18.41 17.24 17.19 18.45 18.77 17.63 19.59 18.6 17.04 17.83 18.58 18.05 18.84 18.42 17.58 18.74 19.26 D3ZWJ1 Dnlz 3 9.1699491 296587 - 9.1699491 9.171707 dnl-type zinc finger None LSWFSDLKGKRNIEEILAAR None None 36864 17.19 14.18 17.37 16.97 16.29 15.54 16.94 16.93 16.85 17.01 16.68 15.52 16.99 17.59 17.08 15.48 16.1 15.82 15.81 17.4 15.9 16.37 16.65 16.76 17.51 16.41 15.66 15.95 17.45 16.97 17.12 P20069 Pmpca 3 9.2075481 296588 + 9.2075481 9.215547 mitochondrial-processing peptidase subunit alpha None LLADVVLHPRLTDEEIEMTR None 613036 6078 19.24 18.76 18.13 19.06 20.46 19.01 18.48 18.49 18.65 17.65 19.6 18.73 19.31 19.31 18.82 18.68 18.32 18.69 19.06 20.58 18.6 18.53 18.11 18.25 20.51 19.24 19.24 18.56 20.44 18.78 20.59 Q68FX8 Pmpca 3 9.2075481 296588 + 9.2075481 9.215547 alpha-mpp None None None None 19.24 18.76 18.13 19.06 20.46 19.01 18.48 18.49 18.65 17.65 19.6 18.73 19.31 19.31 18.73 18.68 18.27 18.83 19.06 20.59 18.6 18.53 18.11 18.25 20.51 19.24 19.24 18.56 20.44 18.78 20.59 Q9WVR1 Inpp5e 3 9.2167771 114089 - 9.2167771 9.22945 phosphatidylinositol polyphosphate 5-phosphatase type iv None LKQDPEVDVLALLQHDQLTR None 612854 10533 15.34 16.58 15.14 14.73 14.69 14.23 15.89 15.58 14.85 14.75 15.63 13.61 14.44 14.55 15.14 14.28 14.38 15.0 15.17 14.77 15.09 16.81 14.58 14.71 16.29 15.48 15.15 14.43 14.71 14.99 14.47 D3ZN76 Sec16a 3 9.2296881 100360302 - 9.2296881 9.264233 protein transport protein sec16 None VWDEKKNQWVNLNEPEEEKK None None None 17.45 16.11 17.22 17.43 16.56 16.16 15.78 17.36 18.18 15.77 17.07 17.81 17.69 17.78 16.75 16.67 18.04 17.83 17.56 15.98 18.08 17.1 17.55 17.8 18.32 17.01 17.37 17.16 18.58 17.33 18.24 Q07008 Notch1 3 9.2779671 25496 - 9.2779671 9.323541 neurogenic locus notch homolog protein 1 None KFRFEEPVVLPDLDDQTDHR None 190198 32049 14.49 14.1 14.24 15.69 14.87 15.41 13.83 13.37 15.69 14.95 14.53 15.2 14.65 15.48 13.92 15.7 14.4 16.61 15.2 14.78 15.67 14.61 14.53 15.9 15.33 14.35 15.29 15.9 13.97 15.79 16.37 Q5FVL3 Dipk1b 3 9.4564771 362090 + 9.4564771 9.464901 divergent protein kinase domain 1b None KAWPDAVPRRELVLFDKPTR None None 10516 13.29 14.85 15.87 14.86 14.24 14.05 15.04 14.78 14.06 15.05 14.99 14.24 15.74 15.25 16.35 14.57 15.06 14.61 14.43 13.93 14.54 15.18 14.9 14.02 14.59 14.54 14.61 15.54 15.12 14.36 14.15 P62278 Rps13 3 10.1281041 161477 - 10.1281041 10.128625 40s ribosomal protein s13 None QIYKLAKKGLTPSQIGVILR None None 135387 19.13 21.21 21.08 21.59 20.43 19.01 19.06 21.6 21.26 21.16 20.78 19.02 20.35 19.51 20.95 20.87 20.77 20.74 20.19 19.8 19.9 19.3 20.08 21.12 19.83 21.08 21.04 19.37 21.42 19.69 21.42 Q9QXU2 Surf1 3 10.2417991 100912008 - 10.2417991 10.244635 surfeit locus protein 1 None LESRVMAEPIPLPADPMELK None None None 17.45 19.37 17.75 17.22 17.69 15.87 18.45 17.51 18.09 17.02 18.71 16.4 17.01 17.65 18.5 16.81 17.98 16.46 17.02 18.2 18.4 18.8 16.77 17.5 17.45 17.94 18.01 18.03 15.87 16.82 17.51 Q5BJZ4 Surf6 3 10.2214561 303076 - 10.2214561 10.232232 surfeit 6 None QESGLIFNKVEVAGEEPASK None 185642 133981 15.72 16.25 14.49 15.05 15.05 16.04 13.76 14.66 16.6 15.61 14.48 15.69 13.87 16.23 16.07 14.58 15.32 14.78 15.54 15.84 16.63 15.57 13.8 16.43 14.48 15.27 16.08 15.38 15.0 15.63 16.31 A0JPN6 Med22 3 10.2336911 100911917 - 10.2336911 10.238858 mediator of rna polymerase ii transcription subunit 22 None LDLDTDSADGLSAPLLASPETGAGPLQSAAPVHSHGGGPGPTEHT None None None 14.33 15.59 16.33 15.21 15.91 15.26 16.4 15.33 15.61 15.4 15.81 13.9 15.44 16.23 15.02 14.95 15.77 17.36 14.7 15.68 16.72 15.57 16.37 16.41 16.78 15.6 15.06 15.31 15.16 16.64 16.1 P62425 Rpl7a 3 10.2390621 296596 + 10.2390621 10.241703 60s ribosomal protein l7a None None None None 20.81 20.55 19.52 20.84 20.85 18.71 18.75 21.08 19.82 20.31 19.41 19.91 19.93 19.17 20.84 20.66 20.49 20.19 19.14 19.74 19.38 19.38 20.15 21.31 20.81 21.65 20.79 19.1 20.52 19.82 19.74 Q7TP91 Surf4 3 10.2418471 619346 - 10.2418471 10.263315 surfeit locus protein 1 None RPVKVRGHFDHSKELYIMPR None None None 17.69 19.5 17.8 17.28 17.88 16.16 18.43 17.02 18.26 17.16 18.85 16.45 16.98 17.89 18.85 17.03 17.74 16.66 17.94 16.91 18.7 18.81 16.89 17.48 17.44 17.89 18.03 18.03 16.39 16.98 17.4 G3V9S4 Dbh 3 10.4882611 25699 + 10.4882611 10.505248 dopamine beta-hydroxylase None NWNLQPLPKITSAVEEPDPR None 609312 615 14.66 14.47 17.23 15.86 16.71 15.06 16.22 16.45 15.24 15.94 15.85 15.53 16.48 15.14 16.49 15.82 15.99 15.33 14.99 14.85 14.42 14.85 16.32 14.47 15.04 15.24 15.91 15.77 15.94 15.14 15.7 Q64380 Sardh 3 10.5105511 114123 - 10.5105511 10.575314 sarcosine dehydrogenase None AKHGLVNAGYRAIDSLSIEK None 604455 5149 16.51 17.19 18.22 18.58 16.69 16.36 15.94 16.57 15.7 18.44 16.62 18.04 16.56 17.79 16.08 18.21 16.97 17.03 17.8 18.43 16.52 16.53 16.3 17.96 16.77 16.61 17.51 16.11 17.8 16.51 18.03 B5DF71 Brd3 3 10.7752731 362092 - 10.7752731 10.821285 brd3 protein None KRKMDSREYPDAQGFAADIR None None 81801 16.15 14.65 16.11 15.72 15.8 16.37 16.26 15.68 17.25 15.32 15.73 16.43 16.32 16.58 15.25 15.92 16.43 15.81 16.92 16.81 18.0 17.14 16.69 16.15 16.96 17.29 17.24 17.37 15.15 16.97 17.45 D3ZWU1 Brd3 3 10.7752731 362092 - 10.7752731 10.821285 bromodomain containing 3, isoform cra_b None LSTSGKKQAAKSKEELAQEK None None 81801 16.19 14.69 16.16 15.77 15.84 16.41 16.28 15.73 17.29 15.36 15.77 16.48 16.36 16.62 15.44 15.96 16.54 15.75 16.95 16.8 18.04 17.18 16.73 16.2 17.0 17.33 17.41 17.28 15.1 17.02 17.49 Q498M4 Wdr5 3 10.8370441 362093 + 10.8370441 10.846583 wd repeat-containing protein 5 None KCLKTLPAHSDPVSAVHFNR None None 59931 16.3 16.21 17.66 16.56 16.51 16.45 15.98 16.21 17.19 15.99 15.5 16.28 16.47 16.73 17.51 15.63 17.03 16.16 16.02 17.36 18.25 16.65 16.2 15.9 17.28 16.57 17.54 16.16 17.92 16.47 18.24 Q62609 Olfm1 3 11.5333091 93667 + 11.5333091 11.558239 noelin None SGSRFGSWMTDPLAPEGDNR None 605366 8612 19.87 18.48 18.68 19.59 19.19 19.88 19.01 18.89 19.93 19.43 19.17 20.15 20.0 19.7 20.02 19.93 18.87 19.25 20.45 18.77 19.84 19.18 20.21 18.77 19.08 19.84 19.35 21.13 19.04 18.98 19.59 Q9Z136 Tsc1 3 11.9867171 60445 + 11.9867171 12.014669 hamartin None DLASEEDSIEKDKEEAAISK None 605284 314 18.73 16.05 19.24 19.2 17.42 17.01 17.75 18.63 17.3 16.83 17.83 17.2 18.33 18.15 18.54 18.3 18.76 17.72 17.85 16.33 16.17 17.73 18.0 18.29 19.12 18.13 17.76 17.21 18.4 18.34 17.71 D3ZD80 Gtf3c4 3 12.1547881 685539 - 12.1547881 12.172684 general transcription factor iiic subunit 4 None LLESSVQNLFKQVDLIDLVR None None 8147 14.67 16.18 16.38 16.32 15.98 15.42 15.36 16.25 16.01 15.22 15.01 16.49 15.6 15.99 16.89 15.87 15.87 16.19 16.38 14.44 16.52 15.16 15.9 16.67 16.37 15.72 15.78 15.13 16.89 15.71 16.57 D4A9F4 Ntng2 3 12.492641 311836 - 12.492641 12.546517 netrin g2 None YTRMESAKGLKEFFTFTDLR None None None 16.61 16.48 15.82 16.37 15.87 17.47 15.75 15.29 17.26 17.06 16.22 17.33 16.13 17.16 16.08 16.46 16.83 16.59 16.31 16.33 18.1 15.91 17.41 17.18 14.97 16.21 15.6 17.13 17.02 15.38 15.65 F1M8L9 Rapgef1 3 12.9215131 63881 + 12.9215131 13.014133 rap guanine nucleotide exchange factor 1 None SSLPVGINRQDFDVECYTQR None 600303 50501 16.02 16.29 17.35 17.66 15.66 17.15 16.2 15.28 16.38 16.42 16.49 16.78 16.94 17.32 16.63 15.64 16.2 17.04 17.28 15.61 17.46 17.33 16.87 17.32 15.82 17.24 17.33 16.72 15.44 15.52 16.57 G3V7V3 Slc27a4 3 13.0750231 311839 + 13.0750231 13.087943 solute carrier family 27 (fatty acid transporter), member 4 None WTFRQLDDYSSSVANFLQAR None 604194 68437 18.18 20.32 17.73 19.0 17.77 17.56 17.49 18.55 17.99 18.9 17.4 17.53 17.82 18.82 19.29 17.55 18.78 17.92 18.16 17.13 17.39 18.39 17.77 18.5 19.31 19.39 19.35 18.4 17.77 17.72 17.74 Q4KLN4 Gle1 3 13.2093441 362098 + 13.2093441 13.233548 nucleoporin gle1 None ERVLQEMRDLLSNLEQEITR None 603371 5525 14.71 15.02 14.55 15.92 14.66 15.74 14.31 15.51 16.37 14.06 15.29 15.49 14.73 15.45 15.83 15.13 16.28 15.3 15.41 14.47 14.97 15.55 15.27 14.74 15.96 15.25 16.21 14.54 16.55 15.12 15.69 A0A0G2K1Y8 Sptan1 3 13.2412181 64159 + 13.2412181 13.306048 spectrin alpha chain, non-erythrocytic 1 None GAAEVQRFNRDVDETIGWIK None None 2353 24.4 22.73 23.18 23.62 24.15 24.3 23.97 23.62 24.41 23.88 22.83 24.84 24.39 24.45 25.02 24.25 23.28 23.03 23.91 24.46 24.16 23.18 24.33 23.6 23.85 24.59 23.66 24.58 23.92 24.43 24.46 P16086 Sptan1 3 13.2412181 64159 + 13.2412181 13.306048 spectrin alpha chain, non-erythrocytic 1 None VGADLEQVEVLQKKFDDFQK None None 2353 24.38 22.71 23.16 23.61 24.13 24.33 23.98 23.6 24.42 23.89 22.83 24.86 24.41 24.47 25.02 24.24 23.28 23.04 23.91 24.48 24.18 23.19 24.35 23.57 23.82 24.58 23.67 24.58 23.92 24.42 24.45 Q6IRK8 Sptan1 3 13.2412181 64159 + 13.2412181 13.306048 spectrin alpha chain, non-erythrocytic 1 None RLQRFLADFRDLTSWVTEMK None None 2353 24.35 22.67 23.14 23.59 24.11 24.3 23.96 23.57 24.4 23.84 22.81 24.85 24.38 24.45 25.0 24.21 23.27 23.0 23.89 24.45 24.17 23.15 24.33 23.53 23.81 24.55 23.63 24.56 23.9 24.4 24.43 D3ZC07 Set 3 13.3351381 307947 + 13.3351381 13.366226 protein set None DEEALHYLTRVEVTEFEDIK None None None 19.8 17.91 20.49 19.68 18.93 19.49 19.63 18.85 20.12 18.6 19.68 20.36 20.07 20.08 19.24 19.28 19.05 19.83 19.89 20.54 21.15 20.36 20.12 18.99 20.01 18.88 19.71 19.63 19.97 20.16 20.51 F1LQI6 Zer1 3 13.3696891 311842 - 13.3696891 13.39742 zyg-11-related, cell cycle regulator None VYPDKYCPLLIKEGGMPLLR None None 4621 18.97 17.55 17.47 17.63 16.77 18.47 17.84 17.31 17.22 17.63 18.33 17.96 17.27 17.41 16.2 18.46 18.0 17.81 17.99 17.17 16.07 18.48 17.48 17.76 17.11 17.76 16.1 18.34 17.85 17.03 16.86 D4AEG7 Tbc1d13 3 13.4089711 499768 + 13.4089711 13.424639 tbc1 domain family, member 13 None EIRDNFIKSLDDSQCGITYK None None None 18.74 16.16 17.71 17.2 18.43 18.18 19.18 18.49 18.68 17.38 18.91 16.39 18.17 17.08 16.83 16.86 17.64 18.61 17.8 19.06 18.52 18.36 18.71 17.05 18.39 18.03 17.69 18.58 17.02 18.81 17.78 Q3V5X8 Endog 3 13.4490471 362100 + 13.4490471 13.451893 endonuclease None ELRSYVMPNAPVDETLPLER None 600440 55823 14.4 16.85 16.58 16.62 14.73 15.4 14.21 14.66 14.68 16.58 14.56 16.63 14.92 16.69 14.68 16.7 15.42 15.27 16.12 16.22 14.55 14.66 14.96 16.09 14.61 14.59 16.23 14.16 16.21 14.43 16.64 Q08415 Kyat1 3 13.4599281 311844 - 13.4599281 13.473735 kynurenine--oxoglutarate transaminase 1 None KGKLGASNDWQLDPAELASK None 600547 37872 19.2 18.89 20.78 19.61 18.98 18.84 17.93 18.53 19.11 19.51 18.18 19.37 18.77 20.37 19.2 19.66 18.16 19.48 19.33 20.55 19.76 17.7 18.6 19.29 18.74 18.31 20.17 18.19 20.03 19.36 20.71 Q4V8I7 Lrrc8a 3 13.5105241 311846 + 13.5105241 13.536202 volume-regulated anion channel subunit lrrc8a None TKSRIEQGIVDRSETGVLDK None 608360 18617 18.84 16.66 18.24 18.7 17.92 17.67 18.95 17.14 18.3 17.27 18.23 18.22 18.48 17.69 17.98 18.08 17.89 18.04 18.28 18.19 17.74 18.7 18.46 17.43 19.04 18.6 17.36 18.58 18.27 18.9 18.95 Q5BJP9 Phyhd1 3 13.540411 296621 + 13.540411 13.553796 phytanoyl-coa dioxygenase domain-containing protein 1 None QPHFGGEVSPHQDATFLYTEPLGR None None 14939 15.43 15.82 15.75 16.06 15.19 15.4 15.66 15.05 14.53 17.29 15.75 16.2 14.81 16.9 14.56 15.45 15.85 15.68 16.12 16.87 16.13 15.48 14.77 15.35 15.81 15.22 17.11 15.27 15.7 16.63 16.98 A0A0G2K9P4 Sh3glb2 3 13.6169421 311848 - 13.6169421 13.631738 endophilin-b2 None KLASDAGIFFTRAVQFTEEK None None 10595 21.98 22.0 21.83 21.13 20.67 19.96 20.54 21.77 22.0 21.99 21.4 20.75 21.5 22.3 20.27 20.03 21.22 21.78 20.97 22.37 20.82 21.6 20.93 20.87 21.36 20.77 21.07 21.05 22.97 20.85 21.52 Q5PPJ9 Sh3glb2 3 13.6169421 311848 - 13.6169421 13.631738 endophilin-b2 None KFGQAEKTELDAHFENLLAR None None 10595 19.85 22.04 21.79 20.67 20.34 19.73 20.66 21.76 22.02 21.99 21.4 20.79 21.88 22.63 20.23 20.1 21.14 21.8 21.05 22.41 21.44 21.62 21.7 20.76 21.35 20.78 21.1 21.12 23.05 20.42 20.74 A0A0G2KAE6 Miga2 3 13.6362411 296623 + 13.6362411 13.658896 mitoguardin 2 None DFLAKLHCVRQAFEGLLEER None None 13125 17.83 16.8 16.23 15.77 16.94 16.47 16.24 16.15 16.11 17.8 16.95 16.27 16.15 16.74 17.44 16.84 17.09 16.26 16.9 15.05 16.69 16.82 16.38 16.87 17.71 15.43 16.58 16.19 17.24 16.91 15.99 Q704S8 Crat 3 13.6761131 311849 - 13.6761131 13.68906 carnitine o-acetyltransferase None SDDVYRSHVAGQMLHGGGSK None 600184 598 19.09 20.25 19.61 18.74 19.71 17.56 19.12 18.73 19.46 19.45 17.06 17.99 18.4 18.4 19.79 18.73 17.6 18.65 19.47 19.14 19.22 18.69 17.24 18.47 19.27 19.2 20.11 18.83 17.59 18.64 19.33 B2RYQ2 Ptpa 3 13.6898221 362102 + 13.6898221 13.720287 serine/threonine-protein phosphatase 2a activator None LLDTLDRWIDETPPVDQPSR None 600756 6149 20.79 20.2 21.05 21.11 19.83 20.12 21.26 20.53 19.97 21.45 19.97 19.42 19.65 20.27 19.37 19.39 19.33 20.62 20.67 21.64 20.16 20.69 19.71 20.0 19.89 20.62 20.12 20.11 20.07 20.4 21.33 D3ZRD9 Aif1l 3 15.2294761 362107 - 15.2294761 15.254032 allograft inflammatory factor 1-like None INREFLCDQKYSDEENLPEK None None None 15.55 15.04 15.95 15.36 16.82 15.98 17.54 17.1 15.92 14.74 17.79 15.23 16.79 15.88 15.87 16.52 15.13 16.11 15.58 17.72 15.19 15.82 17.16 15.71 16.97 16.05 14.7 16.38 16.05 16.35 15.17 E9PT20 Abl1 3 15.0440961 100909750 - 15.0440961 15.081596 tyrosine-protein kinase None KNGQGWVPSNYITPVNSLEK None None None 16.95 15.67 18.33 17.15 15.49 17.22 17.3 16.1 17.22 15.73 17.21 16.46 16.39 17.57 17.2 17.15 17.37 16.52 17.37 16.7 17.75 18.33 18.16 17.76 17.8 17.5 17.41 17.19 15.67 17.5 16.81 Q5BJX0 Ntmt1 3 14.093971 362103 + 14.093971 14.110551 n-terminal xaa-pro-lys n-methyltransferase 1 None LLPLFRVVDMVDVTEDFLAK None None 5439 15.62 15.76 15.44 16.19 15.74 16.22 15.04 14.79 15.6 15.21 15.8 15.79 15.45 15.39 14.36 16.39 15.95 15.93 16.33 14.75 14.18 14.65 14.68 15.12 14.58 14.52 16.98 15.25 14.92 14.63 16.55 Q68G38 Tor1a 3 14.2506731 266606 - 14.2506731 14.257678 torsin-1a None EEIKLRDMEHALAVSVFNNK None 605204 None 15.17 15.73 15.51 16.63 15.1 14.77 15.88 15.47 14.88 15.14 14.61 15.77 15.42 16.05 16.28 15.07 15.8 15.92 16.17 14.12 16.11 15.95 14.95 15.4 15.94 16.78 15.63 15.36 15.88 15.4 17.08 A0A096MJX5 Rgd1305178 3 14.2642631 311855 - 14.2642631 14.272538 similar to hypothetical protein mgc11690 None PPNRKRPANEKATDDYHYEK None None None 15.37 16.49 16.54 15.77 15.9 16.24 15.25 15.94 16.99 15.2 16.23 16.78 15.85 16.97 16.7 15.54 15.3 16.7 15.69 17.51 17.57 16.3 15.9 16.25 16.22 16.0 16.31 15.92 17.62 16.31 17.7 D3ZLQ8 Usp20 3 14.2729331 311856 + 14.2729331 14.306409 ubiquitin carboxyl-terminal hydrolase None LTTLRVWCYACEREVFLEQR None None 4861 16.77 14.24 16.75 17.1 16.31 14.92 16.7 16.0 16.36 17.05 15.97 14.58 16.02 15.6 16.05 15.32 16.16 14.86 16.47 15.5 15.37 16.23 16.74 15.67 15.29 15.83 14.63 16.12 16.03 16.78 15.35 Q8R511 Fnbp1 3 14.311591 192348 - 14.311591 14.386705 formin-binding protein 1 None MKDVYLKNPQMGDPASLDHK None 606191 100983 20.44 19.9 19.92 18.69 19.96 20.71 20.0 19.92 19.53 19.4 19.12 19.27 19.38 19.1 19.67 19.68 19.33 19.75 18.72 21.04 18.97 19.54 18.98 18.97 19.83 19.21 20.98 18.79 18.96 20.56 19.4 D3ZBP3 Exosc2 3 14.9629381 366017 - 14.9629381 14.973644 ribosomal rna-processing protein 4 None RYNGEVGDIVVGRITEVQQK None None 6095 15.13 14.04 15.9 15.81 15.35 14.74 16.33 14.94 14.57 14.86 16.5 14.78 14.49 15.74 16.2 14.55 15.41 14.72 14.12 16.45 16.35 14.97 15.48 14.29 16.55 15.16 14.77 14.91 16.11 16.51 16.92 G3V829 Fubp3 3 14.8555571 362106 - 14.8555571 14.903856 far upstream element-binding protein 3 None ITGDPFKVQQAREMVLEIIR None None None 18.15 19.12 18.75 18.07 18.94 17.19 17.44 19.15 18.15 17.44 18.24 17.96 17.6 17.82 18.83 18.5 17.88 17.72 19.46 17.38 17.9 17.81 17.24 18.8 19.57 17.89 19.72 17.27 17.88 18.27 19.16 P09034 Ass1 3 14.7473681 25698 - 14.7473681 14.796905 argininosuccinate synthase None RMPEFYNRFKGRNDLMEYAK None 603470 6899 19.21 20.91 20.09 19.56 18.48 19.49 19.45 19.66 18.15 20.51 19.2 18.24 19.11 19.76 19.89 19.64 19.13 19.44 18.54 20.22 17.91 19.56 18.56 20.22 18.65 20.03 20.03 18.64 18.0 19.06 19.03 P62168 Ncs1 3 14.523221 65153 - 14.523221 14.571489 neuronal calcium sensor 1 None EGSKADPSIVQALSLYDGLV None 603315 None 20.07 18.49 19.25 19.3 18.03 19.43 19.63 18.95 19.95 20.85 18.6 19.18 19.71 19.63 19.08 20.34 19.21 19.28 20.11 18.87 19.91 19.19 19.33 18.54 18.4 19.56 18.23 19.59 20.81 19.04 19.9 D3ZWZ9 Gpr107 3 14.4347281 311857 - 14.4347281 14.495937 protein gpr107 None VKVRSPPEAGKQLPEIVFSK None None 81077 16.21 14.34 16.2 17.02 16.57 16.1 16.5 17.43 16.23 15.22 17.19 17.55 16.67 15.52 16.75 16.55 17.0 16.57 15.84 15.41 15.81 15.45 16.82 15.49 16.22 16.25 15.81 16.55 16.87 16.83 16.85 D4ACK1 Nup214 3 15.2646011 296634 + 15.2646011 15.340568 nucleoporin 214 None KEPVPAQTTDSRPSSSASLVASTESTPVAPGGPDSK None 114350 38008 17.39 15.65 16.84 16.84 16.92 17.22 16.8 16.88 17.78 16.09 16.88 17.85 17.38 17.51 16.29 16.29 17.22 17.46 16.59 17.53 18.55 17.05 17.51 17.63 17.47 17.06 16.39 16.32 18.69 17.68 18.26 M0RBV9 Nup214 3 15.2646011 296634 + 15.2646011 15.340568 nucleoporin 214 None FDSPEELPKERSSVLTVSNK None 114350 38008 16.05 16.09 17.05 17.02 17.0 15.83 15.63 16.14 16.59 14.9 16.45 16.46 16.95 15.99 15.34 15.93 17.45 16.35 16.21 16.32 16.96 16.14 16.33 16.22 16.94 16.66 16.14 16.16 17.7 17.17 16.97 D3ZZ51 Prrc2b 3 15.4653551 296637 + 15.4653551 15.515261 proline-rich coiled-coil 2b None PGSQPPVLNTSRESTQMELK None None None 16.35 13.97 17.26 16.95 16.01 15.45 14.88 15.21 15.55 15.24 16.63 15.25 15.97 17.59 16.51 15.52 16.27 17.04 15.88 14.77 16.34 15.18 16.85 16.68 16.67 16.77 16.22 15.24 17.04 16.39 16.65 B5DF24 Uck1 3 15.5385921 311864 - 15.5385921 15.544465 uridine-cytidine kinase None NYKRTFPEPGDHPGVLATGK None 609328 7990 16.6 17.27 18.19 17.14 16.43 17.93 17.2 16.01 16.88 16.2 17.14 16.08 16.37 16.75 17.93 16.47 16.55 16.35 17.03 16.81 18.13 17.49 16.1 16.74 17.53 16.59 18.08 16.36 15.86 16.56 17.6 Q63ZV7 Swi5 3 15.5746921 499779 - 15.5746921 15.58376 dna repair protein swi5 homolog None YRVIELEQHISLLHEYNDIK None None None 15.85 17.49 16.63 16.67 16.82 14.72 16.64 16.52 16.64 16.42 15.34 14.96 15.71 16.62 15.89 16.29 16.01 16.08 16.09 17.38 16.59 15.51 15.89 16.99 17.61 17.13 17.16 15.76 14.99 15.62 16.93 A0A0G2K977 Golga2 3 15.5838951 64528 + 15.5838951 15.603168 golgin subfamily a member 2 None SRQRVGELERTLSTVSTQQK None None 3300 18.13 16.11 16.55 18.32 16.76 16.89 16.83 18.68 17.35 17.41 18.69 16.84 17.79 17.27 17.57 16.86 17.88 17.69 16.19 17.7 17.93 16.41 17.4 18.23 18.06 17.43 18.09 16.05 18.53 17.67 18.47 Q62839 Golga2 3 15.5838951 64528 + 15.5838951 15.603168 golgin subfamily a member 2 None ESAMWQQRVQQMAEQVHALK None None 3300 18.12 16.38 17.83 18.21 17.01 16.51 16.7 18.77 16.63 18.32 18.58 16.78 17.69 17.28 17.49 16.99 17.96 17.57 16.15 17.75 17.73 16.28 17.28 18.16 17.75 16.85 18.42 16.08 18.2 17.59 18.53 P21575 Dnm1 3 15.6047941 140694 - 15.6047941 15.648538 dynamin-1 None LQDAFSAIGQNADLDLPQIAVVGGQSAGK None 602377 6384 23.85 25.93 23.19 23.88 23.9 24.02 24.02 24.19 23.99 24.55 22.81 24.21 23.86 24.16 24.81 24.82 24.26 23.41 24.45 22.42 23.3 22.97 24.02 23.81 23.72 24.65 24.44 24.79 22.68 23.21 23.67 D4AE56 Ptges2 3 15.6904051 311865 + 15.6904051 15.697711 microsomal prostaglandin e synthase 2 None KSRHHLQDDVRVDLYEAANK None 608152 11819 18.78 18.82 19.82 19.57 18.93 16.71 18.17 18.85 18.53 18.93 17.44 18.06 18.49 19.2 19.92 18.85 18.36 18.09 18.41 19.54 18.89 17.83 18.17 17.82 19.21 19.47 19.84 18.05 19.49 18.55 20.28 Q8K3P6 Slc25a25 3 15.7087041 246771 - 15.7087041 15.718835 calcium-binding mitochondrial carrier protein scamc-2 None EIMQSLRDLGVKISEQQAEK None None 62165 18.55 19.56 17.27 18.15 19.38 17.8 18.95 19.58 19.39 17.68 18.23 17.58 18.01 17.17 19.56 18.24 18.48 17.9 18.4 17.43 17.59 18.07 17.62 17.98 18.66 18.96 18.0 18.38 18.69 18.12 18.32 P39069 Ak1 3 15.9180921 24183 + 15.9180921 15.923042 adenylate kinase isoenzyme 1 None KRLETYYKATEPVISFYDKR None 103000 20135 22.4 20.74 22.3 22.27 21.16 20.64 22.73 21.98 21.54 22.1 20.01 20.77 21.37 20.22 20.97 21.53 21.07 21.8 21.63 21.46 21.69 21.57 21.43 20.76 21.71 21.8 21.73 21.9 19.98 21.54 22.46 Q641Z4 Cdk9 3 15.9964651 362110 - 15.9964651 16.001311 cyclin-dependent kinase 9 None QYDSVECPFCDEVTKYEKLA None 603251 55566 15.44 14.15 15.05 16.24 15.61 15.93 16.4 15.67 16.04 14.57 15.5 16.78 16.18 15.59 16.93 15.45 16.04 15.62 16.23 15.14 17.6 15.45 15.87 15.39 17.35 16.69 15.85 16.63 15.3 16.74 17.11 A0A0G2JYH7 Sh2d3c 3 16.0105831 362111 + 16.0105831 16.04653 sh2 domain containing 3c None PLEVGLLRKVKELLSEVDAR None None 69145 18.63 16.28 18.98 18.6 17.49 18.79 18.94 18.25 18.38 18.98 18.3 16.85 18.52 17.82 17.23 17.46 18.9 18.13 18.3 17.59 18.29 19.19 18.64 18.87 17.95 18.05 17.36 18.6 17.96 18.71 18.42 Q4V7B0 Cfap157 3 16.0665221 499781 - 16.0665221 16.073495 cilia- and flagella-associated protein 157 None LEKANQTLRSEKDQLDEQLK None None None 18.72 18.73 18.14 17.88 18.43 18.79 19.05 18.85 17.72 18.83 18.67 18.36 18.83 17.54 19.61 18.91 18.2 17.92 18.1 18.58 17.67 18.83 17.79 17.71 17.59 19.47 18.13 19.94 17.35 18.21 18.57 P61765 Stxbp1 3 16.0767321 25558 - 16.0767321 16.138369 syntaxin-binding protein 1 None GGVSLNEMRCAYEVTQANGK None 602926 2382 23.44 24.18 22.6 23.62 23.39 23.32 24.64 23.6 24.03 23.54 22.45 24.8 24.35 24.36 22.23 23.03 23.38 23.71 24.12 24.37 23.93 23.83 23.49 22.72 23.12 24.24 22.59 24.84 23.38 24.39 24.42 B4F7E8 Niban2 3 16.1746751 362115 + 16.1746751 16.224293 protein niban 2 None NHVQPYIPSILEALMVPTSQGFTEVR None None 11269 17.41 17.79 19.0 18.74 18.23 17.4 18.41 19.21 18.96 18.27 18.78 18.1 18.03 18.59 18.87 17.4 17.56 18.5 19.22 17.0 16.46 19.07 18.62 18.47 17.68 17.75 18.99 18.64 16.49 17.75 19.31 D3ZI42 Lrsam1 3 16.225781 311866 - 16.225781 16.262261 leucine-rich repeat and sterile alpha motif-containing 1 None HAELLQQSHSHKDEILQTVK None 610933 44526 16.1 17.98 17.92 17.79 17.74 17.71 15.56 15.85 15.84 17.85 18.04 15.85 16.11 17.53 16.19 17.66 17.07 17.55 16.3 18.01 15.7 15.68 16.07 17.54 16.2 16.08 17.61 15.6 17.54 15.94 18.14 P23358 Rpl12 3 16.264271 102555453 + 16.264271 16.266357 60s ribosomal protein l12 None EVGATSALAPKIGPLGLSPK None None None 19.95 18.8 19.08 20.59 20.53 21.11 18.87 19.54 20.21 18.8 20.46 21.34 21.35 19.96 21.04 19.95 20.93 19.99 19.46 19.92 19.88 20.75 20.15 21.29 20.38 20.34 20.64 19.31 21.06 19.76 21.42 A0A0G2JX90 Garnl3 3 16.2890011 499783 - 16.2890011 16.40952 gtpase-activating rap/rangap domain-like 3 None EIASRTRRELLGLSDDGGPK None None None 17.1 15.49 17.25 17.25 17.13 17.08 17.28 17.43 17.56 16.65 16.36 18.1 18.1 17.8 17.03 16.55 18.05 17.01 17.88 15.76 17.67 16.64 16.91 17.31 16.88 16.95 17.14 16.96 17.53 17.66 18.22 D3ZLR4 Ralgps1 3 16.4332691 100361774 - 16.4332691 16.669976 ral gef with ph domain and sh3-binding motif 1 None ATFPSEKARHLLDDSVLESR None None None 15.6 17.18 16.56 16.38 15.16 15.63 15.74 14.41 15.55 17.01 16.27 15.0 15.19 17.14 16.06 15.99 16.54 16.46 15.81 14.47 15.73 15.48 15.46 15.48 15.68 15.9 16.83 15.93 14.91 14.72 15.66 D4A732 Mvb12b 3 17.0339061 362118 - 17.0339061 17.19261 multivesicular body subunit 12b None CFCVRRSRDPPPPQPPPPQR None None None 16.41 16.22 17.3 16.02 16.05 16.28 16.97 16.61 16.88 15.91 17.72 16.83 16.36 17.4 17.27 16.56 17.8 17.08 17.2 15.45 18.36 17.24 17.43 15.9 17.52 16.81 17.22 17.6 16.01 17.02 17.7 Q6AYF1 Mapkap1 3 17.7157371 296648 + 17.7157371 17.918373 target of rapamycin complex 2 subunit mapkap1 None LFVRINAAHGFSLIQVDNTK None None 11473 14.41 13.35 15.65 14.43 14.31 16.14 14.54 14.41 13.91 14.47 15.93 15.14 15.7 14.81 14.09 14.48 15.16 15.44 15.0 14.17 15.76 15.7 15.63 15.42 15.13 15.08 15.48 14.13 15.28 15.84 14.44 D4A022 Gapvd1 3 17.9699341 311880 - 17.9699341 18.041884 gtpase-activating protein and vps9 domains 1 None LRFSLCSDNLEGISEGPSNR None 611714 32637 17.8 18.58 18.1 17.97 16.8 17.53 18.09 18.64 17.44 18.27 17.23 16.7 17.54 17.33 17.98 17.77 18.08 17.85 18.99 16.67 18.3 18.0 17.9 18.03 17.93 19.57 18.42 17.88 16.86 16.94 17.05 P06761 Hspa5 3 18.0555081 25617 + 18.0555081 18.059968 endoplasmic reticulum chaperone bip None TKKSQIFSTASDNQPTVTIK None 138120 3908 24.29 22.65 22.94 22.84 24.03 21.6 22.41 23.99 22.84 23.12 24.37 22.85 23.88 23.51 22.83 23.39 23.49 23.44 21.74 24.21 21.78 22.75 22.88 23.25 23.75 22.7 23.0 22.8 24.25 23.79 23.48 G3V8G2 Psmd5 3 18.133721 296651 - 18.133721 18.151175 26s proteasome non-atpase regulatory subunit 5 None ARNLRLDLQRGLTHPDDSVK None 604452 37999 19.37 17.01 18.41 17.81 17.8 17.49 19.57 19.7 18.66 17.67 18.74 17.57 18.96 17.88 18.75 18.15 18.0 18.56 18.49 18.45 18.24 19.42 18.47 18.54 19.74 18.94 18.17 19.33 17.13 19.08 19.2 A0A096P6L9 C5 3 17.6343091 362119 - 17.6343091 17.822117 complement c5 None LTAFSVIGIRKAIGICPTEK None 120900 20412 18.13 16.47 17.29 18.08 17.12 16.95 18.01 17.33 16.48 17.18 18.86 16.02 16.42 17.09 17.63 16.76 16.56 17.39 16.71 17.94 18.43 16.25 16.48 17.69 17.42 17.96 16.83 16.27 17.22 16.56 17.92 P08650 C5 3 17.6343091 362119 - 17.6343091 17.822117 complement c5 None PKKCCYDGARENKYETCEQR None 120900 20412 16.64 17.21 15.8 16.91 16.37 14.86 17.34 16.73 15.19 15.7 17.04 14.99 15.69 14.92 16.41 15.84 15.68 16.0 15.32 16.77 16.67 15.02 15.15 16.0 16.33 17.49 15.04 15.86 15.67 15.22 15.04 P61107 Rab14 3 18.5019591 94197 - 18.5019591 18.523403 ras-related protein rab-14 None TRSYYRGAAGALMVYDITRR None 612673 48679 21.39 23.21 21.05 20.98 20.71 20.65 21.12 21.44 21.71 22.11 19.98 21.26 21.11 20.25 20.31 22.12 20.2 21.99 22.28 21.31 21.25 21.63 20.49 21.5 20.41 22.18 19.99 21.2 22.18 20.28 21.41 Q68FP1 Gsn 3 18.5964271 296654 + 18.5964271 18.638393 gelsolin None QANMDERKAALKTASDFISK None 137350 147 22.79 20.28 20.65 20.82 21.31 20.8 22.22 21.87 20.34 20.17 22.54 20.67 20.69 20.83 21.14 21.63 20.63 21.04 19.86 22.1 19.78 20.51 21.31 20.48 21.91 20.5 20.66 20.31 20.85 21.49 19.89 Q6P730 Dab2ip 3 18.9155381 192126 + 18.9155381 19.086282 disabled homolog 2-interacting protein None DLQMANGSKSLSMVDLQDAR None 609205 13058 18.88 20.35 19.38 19.3 18.54 18.72 18.63 18.55 20.01 18.39 17.99 19.41 18.47 20.2 18.93 17.56 19.16 18.93 20.27 17.67 19.67 19.41 18.17 19.77 18.77 18.52 19.19 18.72 18.64 18.14 19.31 F7EXQ7 Ndufa8 3 19.3860021 296658 - 19.3860021 19.402073 complex i-19kd None QLFRHCRKQQAKFDECVLDK None 603359 40932 19.35 20.55 19.94 20.81 21.1 20.71 20.2 20.34 21.28 21.67 20.14 21.67 21.47 20.68 20.29 21.93 21.34 20.46 20.61 21.48 21.27 20.57 21.46 21.01 19.65 21.22 20.84 21.38 21.17 20.52 20.5 M0RBK4 Igkv3-12 3 101.8059441 + 101.8059441 101.80626 ig-like domain-containing protein None DTVLTQSPALAVSLGQRVTI None None None 16.12 14.34 14.49 15.93 15.43 16.17 15.47 14.67 14.77 15.74 16.17 15.91 14.45 14.42 14.34 14.8 15.42 15.18 14.31 16.09 15.63 13.58 14.98 13.99 14.25 14.12 14.22 14.67 16.61 14.47 17.03 F1LZY6 Igkv3-44 3 100.8301291 + 100.8301291 100.830418 ig-like domain-containing protein None HTGVPSRFSGSGSGTQYSLK None None None 15.01 16.74 14.53 15.71 16.11 16.24 16.39 16.73 14.91 15.94 16.88 14.81 16.0 14.48 15.81 15.8 16.43 14.39 15.35 16.01 15.43 14.23 14.56 15.57 14.52 16.28 14.73 15.15 16.33 14.93 16.04 M0R816 Igkv12-41 3 100.7116671 + 100.7116671 100.711956 ig-like domain-containing protein None None None None 14.32 16.05 13.84 15.02 15.43 15.55 15.83 16.05 14.22 15.26 16.19 14.12 15.32 13.8 14.76 15.12 15.79 13.93 14.63 15.28 14.74 13.54 13.88 14.43 13.83 15.59 14.2 14.69 15.42 14.24 15.35 D3ZPL2 Igkv11-118 3 99.0717731 + 99.0717731 99.072086 ig-like domain-containing protein None DIQMTQSPSLLSASVGDRVT None None None 16.75 14.14 15.18 15.81 15.4 16.95 16.53 15.79 16.02 15.42 17.39 14.89 15.76 15.64 16.1 15.0 16.11 14.48 15.33 16.23 16.24 14.72 16.15 16.27 14.86 15.39 14.24 14.61 16.17 15.23 16.02 Q63737 Pdcl 3 21.1101611 64013 - 21.1101611 21.11975 phosducin-like protein None IKKLSMSCRSHLDEEEEQQK None 604421 38043 16.27 14.76 16.36 16.6 15.71 15.6 15.92 15.85 16.59 15.96 17.39 16.15 16.88 17.11 16.25 15.39 15.56 16.67 16.1 17.17 16.94 16.57 17.12 16.28 17.5 15.48 16.89 15.94 16.76 16.65 16.82 D3ZX42 Rabgap1 3 21.2080131 311911 + 21.2080131 21.326009 g protein-coupled receptor 21, isoform cra_a None LPQSGSQSSMIPSPPEDDEEEDNDEPLLSGFGDVSK None None 49301 18.85 17.64 18.26 18.55 17.25 20.16 18.86 18.49 19.48 18.65 19.4 19.45 19.9 19.41 19.49 19.8 19.7 19.09 19.56 17.24 19.64 19.57 19.88 19.66 18.18 19.64 19.25 19.31 17.98 19.1 18.66 D3ZDD7 Strbp 3 21.3389291 84476 - 21.3389291 21.414949 spermatid perinuclear rna-binding protein None LTEEKYQVEQCINEASIIIR None 611138 7548 18.0 17.4 18.71 18.28 18.13 17.6 17.01 17.41 18.96 17.44 17.89 18.65 18.49 18.93 18.55 17.7 17.57 18.07 18.65 19.14 20.04 18.38 18.64 18.87 18.81 18.86 19.33 17.76 18.8 18.82 19.69 Q9JKU6 Strbp 3 21.3389291 84476 - 21.3389291 21.414949 spermatid perinuclear rna-binding protein None ETGGSHDKRFVMEVEVDGQK None 611138 7548 18.15 17.07 18.6 18.42 18.11 17.09 17.02 17.65 19.19 17.17 18.33 18.53 18.56 18.9 18.54 17.53 17.48 18.1 18.62 18.99 19.87 18.33 18.61 18.68 18.7 18.77 19.43 17.61 18.82 18.73 19.6 A0A0G2K6J1 Dennd1a 3 21.562031 311913 - 21.562031 21.994873 denn domain-containing 1a None PTLQPSAPTQARDPFEDLLR None 613633 17141 17.36 14.85 16.22 16.47 16.71 15.8 15.86 15.54 16.11 15.83 16.45 16.86 16.6 16.55 16.23 17.44 16.56 15.91 16.06 16.03 16.33 16.45 16.98 16.3 17.05 16.63 16.82 16.63 16.24 15.92 16.46 F1M241 Dennd1a 3 21.562031 311913 - 21.562031 21.994873 denn domain-containing 1a None PTLQPSAPTQARDPFEDLLR None 613633 17141 17.11 14.9 16.32 16.57 16.43 16.13 15.82 15.8 16.23 16.0 16.55 16.79 16.74 16.65 16.9 17.55 16.59 15.59 16.36 15.62 16.63 16.06 17.01 16.73 16.96 16.72 16.54 17.17 16.12 16.16 16.69 Q9JHW0 Psmb7 3 22.338781 85492 - 22.338781 22.418093 proteasome subunit beta type-7 None GTTIAGVVYKDGIVLGADTR None 604030 2093 19.62 21.85 20.47 20.02 20.84 18.9 20.93 21.13 19.49 20.11 19.42 19.88 19.8 18.72 19.92 20.79 19.09 20.37 19.98 21.75 19.42 20.18 19.41 20.48 20.75 21.57 20.85 18.7 20.07 19.68 20.37 P17078 Rpl35 3 22.7532571 296709 - 22.7532571 22.756217 60s ribosomal protein l35 None KKEELLKQLDDLKVELSQLR None None 31432 18.26 19.96 17.21 18.74 18.71 16.7 16.68 19.0 17.82 18.28 17.47 17.7 17.53 17.04 18.91 18.98 18.64 17.67 17.18 18.03 16.91 17.59 17.25 18.97 18.46 19.84 18.68 17.02 18.74 17.46 18.03 A1L108 Arpc5l 3 22.7598991 296710 + 22.7598991 22.767515 actin-related protein 2/3 complex subunit 5-like protein None KVLTNFKSSEIEQAVQSLDR None None 36463 19.93 18.0 18.19 20.23 19.6 20.08 18.51 18.98 19.57 18.87 18.96 20.96 20.54 20.41 19.76 20.21 20.56 19.87 18.86 19.04 18.66 19.89 20.09 19.46 19.74 20.31 19.84 20.59 19.8 19.85 20.19 D4A6K4 Golga1 3 22.7677621 311919 - 22.7677621 22.812585 golgi autoantigen, golgin subfamily a, 1 None NRTQEELVTSNQLSSDLSQR None None None 18.07 15.55 18.0 17.09 17.36 16.73 17.73 17.84 16.94 17.27 18.12 16.65 17.94 17.67 17.17 17.55 18.28 18.27 17.1 16.86 17.48 18.36 18.41 17.59 18.5 18.14 17.38 17.41 17.17 18.26 17.71 F1M3P6 Scai 3 22.8218681 690538 - 22.8218681 22.925324 protein scai None DVVKDLVKELSDEIEDYTHR None None None 19.59 17.71 19.04 19.19 18.53 19.36 18.87 18.64 20.43 19.18 19.24 19.96 19.85 20.1 18.78 19.16 18.57 19.92 20.17 19.7 20.79 19.44 20.04 18.65 18.45 19.25 19.64 19.7 20.34 19.67 19.78 Q64620 Ppp6c 3 22.9314211 171121 - 22.9314211 22.962123 serine/threonine-protein phosphatase 6 catalytic subunit None AGWLFGAKVTNEFVHINNLK None 612725 68273 18.83 17.22 19.24 18.2 17.98 19.67 18.13 18.57 19.07 19.77 17.43 19.69 19.34 18.79 18.47 18.32 18.52 19.57 18.51 19.69 20.61 18.79 19.38 19.62 17.45 18.51 18.88 17.67 19.71 19.14 19.11 D3ZFA8 Rps17 3 24.0198391 100361180 - 24.0198391 24.020298 40s ribosomal protein s17 None ARVIIEKYYTRLGNDFHTNK None None None 18.2 17.13 17.68 18.2 18.02 18.2 17.05 18.96 17.71 17.17 17.31 19.59 18.86 19.32 17.66 17.44 18.63 18.51 18.84 18.72 18.89 18.08 18.75 18.87 19.05 19.16 19.19 17.29 19.27 18.65 18.87 Q6P9Z8 Orc4 3 33.2943541 295596 - 33.2943541 33.333005 origin recognition complex subunit 4 None PHSNLFGVQVQYKHLIELLK None 603056 None 13.96 16.89 15.95 15.26 14.4 14.32 15.45 15.1 15.5 15.12 15.83 14.07 15.39 15.48 15.79 14.7 14.29 14.63 15.4 15.93 15.61 16.33 14.5 14.91 15.4 14.54 14.84 15.19 15.12 14.99 15.29 G3V6L4 Kif5c 3 34.0321051 311024 + 34.0321051 34.182413 kinesin-like protein None QELSNHQKKRATEILNLLLK None 604593 56234 20.94 20.7 20.22 19.87 20.39 20.1 20.28 20.58 20.12 19.54 19.45 19.95 20.26 20.59 20.36 20.2 21.48 19.61 20.6 19.63 18.82 20.36 19.96 20.86 20.95 21.91 20.73 20.71 18.74 20.5 20.6 P56536 Kif5c 3 34.0321051 311024 + 34.0321051 34.182413 kinesin heavy chain isoform 5c None SRSHSIFLINIKQENVETEK None 604593 56234 19.1 21.1 18.6 18.29 18.98 19.01 19.04 18.86 19.24 18.49 18.12 18.68 18.46 19.08 18.72 19.8 19.51 18.92 19.91 18.24 18.02 19.07 18.15 19.49 19.79 20.66 19.42 19.13 17.98 18.46 18.99 A0A0G2KB73 Rif1 3 36.5550091 295602 + 36.5550091 36.602759 replication timing regulatory factor 1 None ERSGSEVLTLLLKSLENIVK None None 41231 14.74 14.34 15.88 16.09 16.24 15.05 14.22 16.48 15.93 14.22 15.06 15.71 15.47 14.23 15.6 16.01 14.73 15.05 16.28 15.03 14.09 14.54 14.9 14.59 15.76 14.85 16.04 16.14 15.82 15.97 16.74 A0A096MK15 Neb 3 36.614161 311029 - 36.614161 36.810318 nebulin None VGFRSLEDDPKLVHSMQVAK None 161650 136285 17.98 19.72 18.62 17.56 17.09 19.23 17.67 17.04 18.41 16.57 19.27 17.77 17.49 18.51 17.3 19.1 18.98 17.55 18.1 17.78 18.74 18.67 17.7 16.67 18.75 17.41 18.86 18.98 18.78 17.38 17.51 F1M1J2 Neb 3 36.614161 311029 - 36.614161 36.810318 nebulin None RKAYDLQSDAVYKADLEWLR None 161650 136285 17.66 18.97 18.42 17.35 16.86 19.12 17.46 17.1 18.21 16.37 19.07 17.57 17.43 18.3 17.18 18.94 18.83 17.32 18.25 17.62 18.55 18.16 17.66 16.91 18.55 17.21 17.51 18.7 19.12 17.52 17.02 D4A055 Cacnb4 3 36.9109991 58942 - 36.9109991 37.047206 voltage-dependent l-type calcium channel subunit beta-4 None PVVLVGPSLKGYEVTDMMQK None 601949 20188 17.78 18.25 17.65 18.22 18.59 18.22 17.34 17.63 18.53 17.41 17.46 18.75 18.84 18.59 19.21 17.84 18.72 17.74 18.74 17.32 18.76 18.23 17.77 18.52 18.48 19.38 18.29 19.35 18.34 18.05 20.13 Q5XHY7 Stam2 3 37.1883871 311030 - 37.1883871 37.234817 signal transducing adapter molecule 2 None VEAATVDKSNVIDDDVEEIK None 606244 68490 17.71 16.73 18.28 18.35 16.89 16.63 17.31 18.38 17.24 17.33 17.68 16.42 17.23 17.9 17.33 17.3 17.55 18.25 17.63 17.53 17.96 16.68 16.88 16.46 18.23 18.65 17.21 18.16 17.73 17.64 19.18 A0A0G2K132 Fmnl2 3 37.5070151 499797 + 37.5070151 37.622987 formin-like 2 None SKVTLLEANRAKNLAITLRK None None 70871 19.95 19.4 18.77 18.31 19.4 18.75 18.69 19.49 17.21 18.95 19.84 17.71 17.45 18.59 19.45 19.04 18.81 18.23 18.75 17.71 17.81 17.68 17.77 18.77 19.52 18.51 18.7 18.72 17.91 19.04 18.2 D3ZJ92 Prpf40a 3 37.6292571 295607 - 37.6292571 37.689428 pre-mrna processing factor 40 homolog a (yeast) None SMLKQATPPIELDAVWEDIR None 612941 6377 17.08 15.4 16.67 16.82 16.98 16.98 16.06 16.64 17.71 16.56 16.01 17.34 17.4 17.42 18.54 16.32 17.31 16.84 16.82 16.37 18.76 17.37 17.28 17.34 18.0 17.59 17.92 17.12 17.36 17.78 18.26 P63251 Kcnj3 3 39.9453061 50599 + 39.9453061 40.106646 g protein-activated inward rectifier potassium channel 1 None GDLPMKLQRISSVPGNSEEK None 601534 1687 16.59 15.35 16.25 15.97 15.85 17.26 15.78 17.18 17.04 16.63 16.32 17.54 16.96 16.23 16.21 16.19 16.72 17.22 16.6 16.74 16.97 17.09 16.86 16.33 16.24 16.87 16.38 17.19 17.44 16.47 16.14 P35571 Gpd2 3 41.8347651 25062 + 41.8347651 41.937732 glycerol-3-phosphate dehydrogenase None NGQVELHEFLQLMSAVHTGR None 138430 352 20.58 22.37 21.34 20.55 19.73 19.88 20.93 19.29 19.57 21.39 20.31 20.26 20.08 20.08 19.82 22.22 21.32 20.54 19.83 21.07 20.65 20.67 20.36 21.04 20.95 21.01 19.83 19.14 21.76 19.72 20.13 Q5RJL0 Ermn 3 42.6158661 295619 - 42.6158661 42.633832 ermin None KIRKGNTKQRIDEFESMMHL None None 12683 20.27 17.45 18.7 18.79 20.3 19.95 18.74 19.52 18.08 18.83 20.28 18.49 19.06 19.28 18.94 19.29 19.82 17.93 18.95 19.44 17.76 18.77 19.7 19.42 20.62 18.76 18.7 17.88 20.7 20.22 18.68 F1LQM3 Acvr1c 3 42.8195931 245921 - 42.8195931 42.892181 receptor protein serine/threonine kinase None YQTVMLRHENILGFIAADNK None 608981 26724 14.89 14.56 14.68 15.03 15.25 14.79 15.4 16.04 16.76 14.56 15.14 15.37 14.94 14.34 16.06 16.29 14.08 15.08 16.13 14.99 14.41 15.26 14.36 15.73 15.84 14.36 13.96 16.04 14.55 16.6 15.7 P70539 Acvr1c 3 42.8195931 245921 - 42.8195931 42.892181 activin receptor type-1c None YQTVMLRHENILGFIAADNK None 608981 26724 14.55 13.78 14.87 15.22 15.44 14.98 15.59 16.23 16.95 14.75 15.33 15.56 15.92 14.53 16.25 16.48 14.27 15.27 16.32 15.18 14.6 15.45 15.46 16.29 16.03 14.55 14.37 15.68 14.51 16.26 15.59 P80201 Acvr1 3 42.9785541 79558 - 42.9785541 43.06907 activin receptor type-1 None PFLVQRTVARQITLLECVGK None 102576 7 14.43 15.28 15.52 16.25 16.45 16.22 15.45 15.4 16.48 16.32 15.32 16.78 16.59 15.11 16.89 16.12 16.33 15.04 15.82 15.0 16.63 15.09 16.48 16.54 14.38 15.63 15.55 16.92 15.2 15.74 15.63 F1M2K6 Pkp4 3 43.6993031 295625 + 43.6993031 43.83592 plakophilin 4 None CVNTSDYDSKTVENCVCTLR None 604276 2689 19.33 16.73 18.44 18.18 19.37 16.88 17.95 19.31 18.83 18.11 17.92 18.13 18.71 18.07 19.08 19.3 18.92 18.06 19.1 17.06 17.68 17.55 17.92 19.13 19.0 19.33 18.74 18.31 18.38 18.58 19.66 G3V917 Tanc1 3 44.0994241 311055 + 44.0994241 44.33318 protein tanc1 None AALADLQEAVKLCPTNQEIK None None None 16.56 15.25 16.37 15.12 16.91 17.13 17.06 16.28 16.96 15.45 15.34 16.72 16.48 16.24 17.06 17.2 16.55 15.82 16.97 14.93 16.77 15.14 16.2 15.6 17.09 15.94 16.39 16.83 16.47 16.57 17.7 Q6F6B3 Tanc1 3 44.0994241 311055 + 44.0994241 44.33318 protein tanc1 None PPPSVPSPYIRNLQEGLQSK None None None 16.44 15.78 16.67 15.17 16.89 17.08 17.12 16.33 16.66 15.46 15.81 16.48 16.39 16.31 16.77 17.16 16.23 15.96 17.24 14.86 16.53 15.06 16.11 15.72 16.98 15.43 16.3 16.8 16.27 16.37 17.6 A0A0H2UHE3 Wdsub1 3 44.3404451 362137 - 44.3404451 44.370884 wd repeat, sam and u-box domain-containing protein 1 None None None None 17.25 15.16 16.68 16.14 15.92 16.29 16.39 16.55 15.79 17.11 15.88 14.93 16.01 14.93 14.71 16.54 16.07 16.2 15.69 17.15 15.0 16.75 16.49 14.94 16.24 15.32 15.37 16.65 16.37 15.47 16.04 Q5FVN8 Wdsub1 3 44.3404451 362137 - 44.3404451 44.370884 wd repeat, sam and u-box domain-containing protein 1 None EDVSKWLRAQGLEDLVDIFR None None 17609 17.25 15.16 16.68 16.14 15.92 16.29 16.39 16.55 15.79 17.11 15.88 14.93 16.01 14.93 14.83 16.54 16.0 15.77 15.89 17.07 15.0 16.75 16.49 14.94 16.24 15.32 15.37 16.65 16.37 15.47 16.04 Q5PQP1 Rbms1 3 45.1984591 362138 - 45.1984591 45.420376 rna-binding motif, single-stranded-interacting protein 1 None TNKCKGYGFVDFDSPAAAQK None None 9640 15.72 16.96 15.79 15.72 16.11 14.14 15.68 16.08 14.94 15.45 16.12 14.56 15.27 15.0 16.3 16.35 15.4 15.44 15.44 15.99 14.12 15.78 14.78 16.25 16.47 15.41 16.6 14.21 15.29 15.28 15.51 Q4V8E2 Psmd14 3 46.2542741 311078 + 46.2542741 46.347084 26s proteasome regulatory subunit rpn11 None LGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLK None 607173 4240 19.33 20.9 19.43 18.33 17.77 19.01 19.49 19.76 19.1 19.69 19.85 18.11 19.09 19.81 19.71 18.78 20.16 18.42 19.34 18.16 20.44 20.08 18.81 19.88 18.35 20.29 20.27 18.68 18.3 18.96 19.55 D4A6N8 Tbr1 3 46.3514691 680427 + 46.3514691 46.359378 t-box brain transcription factor 1 None RLHVVEVNEDGTEDTSQPGR None 604616 4807 15.58 14.61 15.15 16.16 15.15 14.31 14.73 14.85 15.53 15.16 16.13 15.77 15.2 16.12 15.06 15.61 16.18 15.75 15.49 15.29 16.51 14.79 16.58 15.64 15.81 15.61 15.28 15.31 16.56 15.64 14.93 A0A0G2JYF0 Slc4a10 3 46.6651651 295645 + 46.6651651 46.959101 anion exchange protein None VRLSPAVLLQGLAEVPIPSR None None None 20.18 18.9 19.69 20.67 19.45 19.63 20.25 19.15 21.33 19.56 20.61 21.12 20.48 21.1 20.25 19.72 20.12 19.92 20.71 20.24 21.71 20.2 20.87 19.55 19.74 20.05 20.25 21.11 19.88 20.43 20.98 Q80ZA5 Slc4a10 3 46.6651651 295645 + 46.6651651 46.959101 sodium-driven chloride bicarbonate exchanger None SNILVGELEFLDRTVVAFVR None None None 20.2 18.84 19.7 20.67 19.44 19.62 20.23 19.15 21.32 19.55 20.61 21.1 20.49 21.11 20.26 19.73 20.1 19.97 20.68 20.23 21.69 20.21 20.88 19.59 19.78 20.05 20.27 21.1 19.85 20.47 20.95 O54852 Kcnh7 3 47.338341 170739 - 47.338341 47.497361 potassium voltage-gated channel subfamily h member 7 None LSRGSIEILKDDIVVAILGK None 608169 13249 16.02 13.53 15.34 17.26 15.64 16.45 15.06 13.86 15.8 15.37 16.27 15.2 16.1 15.4 14.78 15.06 16.51 16.06 16.57 14.32 16.05 15.92 16.38 15.52 16.47 15.42 15.18 15.82 16.37 16.07 15.97 O88900 Grb14 3 49.5684811 58844 - 49.5684811 49.683736 growth factor receptor-bound protein 14 None TVEDHELLTEVLSHWVMEEDNK None 601524 3303 16.0 15.95 15.7 15.04 14.82 16.36 15.95 15.6 15.05 15.67 16.19 15.6 15.26 15.22 15.47 17.55 16.81 16.35 15.36 14.63 15.64 15.65 16.67 17.0 16.87 16.57 15.57 14.57 16.13 14.85 15.56 F1M124 Cobll1 3 49.7532331 311088 - 49.7532331 49.914287 cordon-bleu wh2 repeat protein-like 1 None LHRTVSSPVGTEMNPPKPPR None None 8933 17.18 15.2 16.93 16.87 17.94 17.85 16.98 17.17 16.78 15.51 16.48 15.92 16.17 16.56 16.61 16.6 16.24 16.43 17.23 17.58 15.96 15.72 16.87 17.24 17.0 17.42 15.26 16.54 16.55 17.65 17.76 F1LX08 Scn3a 3 50.148141 497770 - 50.148141 50.258119 sodium channel protein Nav1.3; SCIII; Scn2a None None None None 18.83 17.68 19.09 18.26 18.57 19.08 19.02 18.2 19.57 19.08 17.94 19.85 20.2 19.32 19.4 18.84 18.82 18.37 20.31 18.01 19.55 19.85 18.98 17.72 18.18 18.97 18.69 20.21 19.3 19.55 20.02 P08104 Scn3a 3 50.148141 497770 - 50.148141 50.258119 sodium channel protein type 3 subunit alpha None EDIYIEQRKTIKTMLEYADK None 182391 56005 18.83 17.68 19.09 18.26 18.57 19.08 19.11 18.2 19.57 19.08 17.94 19.85 20.2 19.32 19.4 18.84 18.82 18.37 20.31 18.01 19.55 19.85 18.98 17.81 18.18 18.97 18.59 20.27 19.18 19.55 20.02 F1M9G9 Scn2a 3 50.3027791 24766 + 50.3027791 50.437456 sodium channel protein NachII; Nav1.2; RII/RIIA; RNSCPIIR; SCN; Scn2a1; Scn2a2; ScpII None None None None 20.06 18.33 19.89 19.3 19.64 20.04 19.94 19.69 20.64 19.39 19.06 21.08 20.71 20.46 20.35 19.66 19.31 19.98 21.08 19.09 20.4 20.46 20.27 19.04 19.36 20.13 19.62 21.44 19.91 20.6 20.69 P04775 Scn2a 3 50.3027791 24766 + 50.3027791 50.437456 sodium channel protein type 2 subunit alpha None DIGSENDFADDEHSTFEDNDSR None 182390 75001 19.98 18.31 19.87 19.24 19.57 19.96 20.01 19.63 20.51 19.43 18.9 21.03 20.68 20.37 20.33 19.64 19.34 20.0 20.84 18.96 20.28 20.46 20.17 18.89 19.24 20.08 19.51 21.4 19.89 20.54 20.7 D4A333 Ttc21b 3 50.8618061 295654 - 50.8618061 50.935782 tetratricopeptide repeat domain 21b None YHLIKAQSQKKMGEVAEAIK None 612014 57006 16.46 13.92 15.63 16.99 17.05 15.22 16.52 17.26 15.95 16.77 17.5 16.11 16.66 15.58 16.63 16.74 17.16 15.91 15.81 16.11 15.4 15.73 16.34 15.98 16.41 16.08 16.41 16.73 16.1 17.2 16.85 P04774 Scn1a 3 50.9521911 81574 - 50.9521911 51.071699 sodium channel protein type 1 subunit alpha None RAMSIASILTNTVEELEESR None 182389 21375 19.92 17.71 18.36 19.25 20.06 19.64 19.06 18.45 19.99 19.81 19.56 20.01 20.23 20.05 19.24 19.1 19.65 18.91 20.48 19.31 19.6 19.51 19.9 18.38 19.46 19.51 18.93 20.59 20.68 20.22 20.12 O08562 Scn9a 3 51.1451471 78956 - 51.1451471 51.224135 sodium channel protein type 9 subunit alpha None FYEVWEKFDPDATQFIEFCK None 603415 2237 19.1 16.96 18.92 18.03 17.73 19.08 18.9 17.92 19.44 19.01 16.97 19.31 19.31 18.68 18.75 18.43 17.88 18.71 19.8 17.71 19.5 19.69 18.74 17.56 17.55 18.33 18.52 19.57 18.37 18.91 19.5 Q71LX6 Xirp2 3 52.1261921 311098 + 52.1261921 52.213113 xin actin-binding repeat-containing protein 2 None EWEDETASTFIKDITGGDVK None None None 15.6 15.27 16.04 16.88 16.23 16.08 16.58 15.91 16.57 14.23 16.05 16.21 16.63 15.55 15.38 16.23 16.22 16.88 16.58 16.04 16.35 16.3 15.93 15.76 17.44 16.29 15.31 16.21 16.56 16.83 16.11 O88506 Stk39 3 52.9135861 54348 - 52.9135861 53.17906 ste20/sps1-related proline-alanine-rich protein kinase None VAIKRINLEKCQTSMDELLK None 607648 22739 20.67 17.73 19.24 19.45 20.38 19.13 20.45 20.2 18.56 19.5 20.61 18.7 19.88 19.1 19.74 19.91 19.63 19.77 20.0 18.62 18.99 19.41 20.03 19.16 20.87 19.69 19.82 18.84 19.59 20.13 19.89 O70127 Abcb11 3 54.0171291 83569 - 54.0171291 54.11273 bile salt export pump None IFTQFLQGYTFAKSGELLTK None 603201 74509 16.71 13.96 15.63 15.46 16.55 17.03 17.55 15.21 16.71 15.37 17.01 16.17 16.6 16.07 15.42 16.43 17.31 16.49 17.04 15.23 17.41 17.05 16.88 15.06 17.56 15.39 15.7 16.57 16.15 16.8 16.48 B2RZ48 Bbs5 3 54.4108121 362142 + 54.4108121 54.43183 bardet-biedl syndrome 5 protein homolog None TRTANSKLRGQTEALYILTK None 603650 12471 15.43 17.6 17.15 15.95 15.84 14.68 15.49 15.88 15.95 15.52 15.9 15.66 15.98 16.94 16.22 15.39 16.88 16.44 14.72 16.49 16.66 16.27 15.54 15.81 16.73 16.21 14.97 16.54 17.59 15.69 15.54 O55035 Ppig 3 54.4840241 83624 + 54.4840241 54.512926 peptidyl-prolyl cis-trans isomerase g None DIDQSPVSKTKQSSQDNEVK None 606093 3520 17.15 15.66 16.22 17.07 17.37 17.06 16.3 17.3 18.78 16.77 17.35 17.25 17.69 17.32 18.51 16.4 17.95 16.7 17.34 16.56 19.16 17.23 17.79 18.27 17.5 17.55 18.25 17.17 16.84 17.6 18.55 P38656 Ssb 3 54.6166941 81783 + 54.6166941 54.626194 lupus la protein homolog None PKGRGQFQGRRTRFDDDDHR None 109090 2366 19.71 19.86 21.31 20.15 19.91 19.6 19.46 19.78 21.21 20.19 19.66 20.67 20.19 20.94 21.63 19.59 19.49 19.83 20.89 20.6 22.22 20.78 20.48 21.14 20.1 20.14 21.7 20.0 19.45 20.55 21.71 Q66HM7 Ssb 3 54.6166941 81783 + 54.6166941 54.626194 lupus la protein homolog None MAALEAKICHQIEYYFGDFN None 109090 2366 19.8 19.61 21.31 20.15 19.92 19.59 19.46 19.78 21.21 20.19 19.66 20.67 20.23 20.97 21.63 19.55 19.49 19.83 20.89 20.6 22.22 20.78 20.55 21.14 20.1 20.14 21.7 20.0 19.45 20.65 21.69 D4A7F0 Ubr3 3 54.6501211 311115 + 54.6501211 54.803926 e3 ubiquitin-protein ligase None DFLFMYSVARTNLELELIHR None None None 17.72 16.82 16.87 15.96 16.5 16.95 17.06 16.7 16.01 16.63 17.32 16.58 16.79 17.35 16.73 16.2 15.94 16.92 17.56 17.41 18.34 16.89 16.9 16.47 18.18 17.49 17.05 17.99 15.81 16.91 16.36 P18088 Gad1 3 55.3696611 24379 + 55.3696611 55.410353 glutamate decarboxylase 1 None SIKKAGAALGFGTDNVILIK None 605363 635 19.65 19.45 20.92 19.97 19.24 19.24 19.74 18.57 19.21 19.99 19.22 18.25 19.81 19.82 18.9 18.72 19.7 19.43 19.02 21.29 19.71 21.29 19.93 18.99 19.95 20.3 20.74 19.55 18.69 19.8 20.05 Q68G33 Gorasp2 3 55.4748521 113961 + 55.4748521 55.503569 golgi reassembly-stacking protein 2 None KDLLKANVEKPVKMLIYSSK None None 9180 18.27 16.93 17.79 18.03 17.74 18.35 17.93 17.04 18.7 17.79 17.47 19.32 18.36 17.8 18.73 18.13 19.26 17.34 17.99 17.1 19.56 17.95 18.6 18.99 17.04 17.8 18.48 17.97 17.02 18.58 18.4 Q9R064 Gorasp2 3 55.4748521 113961 + 55.4748521 55.503569 golgi reassembly-stacking protein 2 None NKDNDTLKDLLKANVEKPVK None None 9180 16.75 17.7 17.64 18.03 17.74 18.42 17.84 17.04 18.77 17.47 17.54 19.41 18.75 17.8 19.05 18.13 19.12 17.32 17.82 17.33 19.56 17.95 19.01 19.15 17.22 17.93 18.42 17.83 17.27 18.07 17.66 D3ZF52 Rgd1565767 3 55.699651 311120 - 55.699651 55.700263 ribosomal protein l15 None WIAKPVHKHREMRGLTSAGR None None None 17.71 15.56 16.98 17.13 15.96 17.5 16.03 16.11 17.53 18.66 17.32 17.87 17.31 17.78 18.25 16.27 17.3 17.06 16.85 17.2 18.69 17.59 17.34 17.81 15.56 16.07 18.18 15.99 17.61 17.21 17.87 A0A096MK96 Tlk1 3 55.5212351 103690017 - 55.5212351 55.59235 serine/threonine-protein kinase tousled-like 1 None IDDLLRANCDLRRQIDDQQK None None None 17.67 16.0 17.11 18.31 18.82 16.51 17.0 18.4 17.6 17.63 16.99 17.22 18.11 16.59 18.49 18.51 17.97 18.05 17.59 16.43 17.31 17.14 18.27 18.64 18.54 19.37 17.91 18.56 17.21 18.3 18.53 F1LU03 Ac107446 3 55.9872671 + 55.9872671 55.988346 gp_dh_n domain-containing protein None SLKIVSNASRTTNCLAPLAK None None None 17.27 15.49 17.21 17.08 16.78 17.72 17.03 16.65 17.17 16.36 17.48 16.65 17.09 17.18 16.03 17.1 16.6 17.36 17.75 16.68 16.08 16.87 17.67 16.63 18.47 16.2 17.23 17.68 15.97 18.17 16.83 Q62871 Dync1i2 3 56.0339181 116659 + 56.0339181 56.08508 cytoplasmic dynein 1 intermediate chain 2 None EDEEEEDDVAAPKPPVEPEEEK None 603331 37921 20.53 18.48 19.98 19.91 19.81 20.33 19.47 20.97 20.46 18.5 21.04 19.94 20.43 20.72 19.29 18.98 20.39 19.78 19.11 20.86 20.09 19.79 20.58 19.45 20.38 19.47 19.09 20.16 21.25 20.58 20.09 Q6AZ35 Dync1i2 3 56.0339181 116659 + 56.0339181 56.08508 cytoplasmic dynein 1 intermediate chain 2 None LDLWNLNNDTEVPTASISVEGNPALNR None 603331 37921 20.53 18.48 19.98 19.97 19.86 20.29 19.55 21.03 20.42 18.5 21.05 19.96 20.42 20.69 19.24 19.04 20.34 19.84 19.12 20.93 20.0 19.74 20.57 19.32 20.41 19.43 19.15 20.27 21.15 20.58 20.09 F1LX07 Slc25a12 3 56.0972691 362145 - 56.0972691 56.1921 solute carrier family 25 member 12 None NSFDCFKKVLRYEGFFGLYR None 603667 48235 21.53 22.82 20.59 20.83 21.1 21.03 22.24 21.62 21.11 22.69 19.95 20.86 20.23 20.8 21.99 20.8 21.22 20.3 20.87 20.88 20.62 20.84 20.7 20.29 20.8 21.78 20.97 21.19 20.48 21.08 20.97 G3V667 Itga6 3 56.6175451 114517 + 56.6175451 56.689428 integrin subunit alpha 6 None QNLRIEDDMDGGDWSFCDGR None 147556 20091 18.54 16.19 17.82 18.83 17.82 17.08 16.81 17.21 17.6 19.12 19.34 16.41 18.68 18.12 17.2 17.55 18.67 17.72 17.08 18.5 18.26 18.05 18.17 19.52 18.14 17.26 17.49 17.89 17.82 18.47 17.78 F1MA54 Pdk1 3 56.7058721 116551 + 56.7058721 56.733038 protein-serine/threonine kinase None None None None 17.18 18.48 17.34 18.41 17.35 17.72 17.74 17.35 18.49 18.26 18.31 18.66 19.62 18.83 19.3 18.05 18.64 17.54 18.41 16.76 19.43 18.44 18.74 18.9 17.9 17.53 18.86 18.64 16.96 17.0 17.81 Q63065 Pdk1 3 56.7058721 116551 + 56.7058721 56.733038 [pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1 None VETSRAVPLAGFGYGLPISR None 605213 37643 17.18 18.48 17.34 18.41 17.35 17.72 17.73 17.35 18.49 18.26 18.31 18.66 19.62 18.83 19.3 18.05 18.64 17.54 18.41 16.76 19.43 18.44 18.74 19.12 17.9 17.53 18.34 18.82 17.22 17.0 17.81 F1LQ26 Rapgef4 3 56.8094831 252857 + 56.8094831 57.101231 rap guanine nucleotide exchange factor 4 None EKVPAGNRASNQGNSQPQQK None None 4451 17.97 18.99 18.31 17.95 18.46 18.79 18.31 18.63 19.53 18.62 17.63 19.54 19.32 19.09 19.76 18.54 18.53 18.49 18.77 18.06 19.44 18.71 18.16 19.3 17.94 19.22 19.08 19.39 17.74 18.93 19.99 Q9Z1C7 Rapgef4 3 56.8094831 252857 + 56.8094831 57.101231 rap guanine nucleotide exchange factor 4 None GDERAQKRQPIRGSDEVLFK None None 4451 17.83 19.48 18.12 17.79 18.19 18.52 18.03 18.45 19.42 18.48 17.39 19.23 18.93 18.95 19.59 18.24 18.33 18.4 18.3 17.88 19.08 18.52 17.71 19.39 17.61 18.96 18.79 18.95 17.52 18.5 19.65 D4AE17 Map3k20 3 57.1426941 311743 + 57.1426941 57.244455 mitogen-activated protein kinase kinase kinase 20 None TPLLLPLSARMSEESYFESK None None None 16.29 15.22 17.31 16.4 16.23 17.06 17.61 15.95 14.93 17.06 16.28 15.5 15.92 16.29 15.11 16.14 15.4 16.55 17.1 16.4 14.93 15.66 16.54 15.57 16.13 16.85 15.02 16.26 16.02 16.43 16.44 D3ZJH5 Rpl21 3 57.3347911 - 57.3347911 57.335793 60s ribosomal protein l7a None LVHRKTCTTVAFTQVNSEDK None None None 20.49 19.6 19.76 20.52 20.26 18.96 18.28 20.22 20.3 20.73 20.24 20.1 19.69 18.86 20.77 20.25 20.18 19.53 19.21 19.14 19.46 19.53 19.99 20.82 19.04 19.39 20.41 18.87 20.26 19.28 19.4 A0A0G2K5M1 Sp3 3 57.8135121 367846 - 57.8135121 57.856211 sp3 transcription factor None THLRVQVVDEEGDQQHQEGK None 601804 7952 14.98 14.31 14.86 15.62 15.0 14.03 14.03 14.9 15.4 13.95 13.94 15.14 14.76 15.48 13.93 14.59 14.76 15.34 16.2 15.6 16.7 14.85 14.85 15.67 16.25 16.23 15.9 15.1 15.38 15.57 16.68 A0JPJ7 Ola1 3 57.9668981 296488 - 57.9668981 58.085869 obg-like atpase 1 None KPASKIPAFLNVVDIAGLVK None None 5361 21.94 18.96 19.97 20.77 21.29 21.43 21.85 21.48 19.92 20.65 20.57 20.62 21.48 20.27 21.49 21.48 21.15 20.78 21.32 19.74 18.87 21.35 21.06 20.7 21.72 21.77 21.19 21.51 19.25 21.47 21.15 Q7TPI6 Tbca 3 57.9840481 103695172 + 57.9840481 58.004806 tcp1-chaperonin cofactor a None TALQQILESEKDLEEAEEYK None None None 18.21 18.3 19.1 18.46 18.07 19.5 18.88 18.86 18.49 17.61 18.77 18.02 18.47 17.93 19.06 17.73 17.24 19.17 18.37 19.33 18.59 19.15 18.22 17.57 18.59 18.49 18.07 18.9 18.41 18.9 18.04 A0A0G2K189 Scrn3 3 58.188891 311731 + 58.188891 58.213623 secernin 3 None NVRKLEKEVFEEIESILQNR None None None 18.52 15.94 18.51 18.11 18.16 16.02 16.64 15.72 18.22 16.46 18.49 16.48 18.44 17.95 16.82 18.23 17.38 17.6 16.94 18.05 17.87 18.09 18.41 18.3 18.62 16.69 18.52 18.51 16.27 17.03 18.41 A0A140TAJ1 Chn1 3 58.510541 84030 - 58.510541 58.611738 chimaerin None VTDGLITLYIETKAAEYIAK None 118423 31056 18.48 16.47 17.65 17.78 17.49 17.3 17.59 15.86 16.73 16.75 17.79 16.92 17.56 18.46 17.21 17.79 18.17 17.91 17.64 17.28 17.16 18.59 18.64 17.41 18.3 18.83 18.51 17.58 16.13 17.39 17.09 P30337 Chn1 3 58.510541 84030 - 58.510541 58.611738 n-chimaerin None MWGLIAQGVKCADCGLNVHK None 118423 31056 18.08 16.23 17.04 17.1 16.95 16.67 16.61 15.32 16.14 16.21 17.38 16.61 16.9 17.86 17.03 17.35 17.05 17.4 17.84 15.16 16.63 18.05 18.07 17.17 17.76 18.06 18.01 17.19 15.6 16.55 16.5 Q00969 Atf2 3 58.7206091 81647 - 58.7206091 58.795266 cyclic amp-dependent transcription factor atf-2 None FGPARNDSVIVADQTPTPTR None 123811 31061 15.64 15.82 16.43 16.36 16.35 16.8 15.44 16.32 17.42 15.29 16.42 16.81 16.51 16.67 15.95 16.0 16.76 16.62 17.18 16.14 17.4 17.11 17.13 16.77 16.76 17.41 16.76 16.43 17.64 16.58 17.04 A0JN29 Lnpk 3 59.4260171 362151 - 59.4260171 59.487029 endoplasmic reticulum junction formation protein lunapark None LFSRWRAKPSTVEVLENIDK None 610236 12319 19.71 17.01 19.84 18.04 17.89 19.08 19.17 19.26 18.25 19.68 19.68 17.57 19.38 19.83 19.57 18.55 19.17 18.35 19.2 18.35 18.4 19.56 19.33 18.95 18.92 19.04 17.27 20.07 19.09 19.38 19.11 Q5U1Z9 Mtx2 3 59.7302461 288150 + 59.7302461 59.792201 metaxin 2 None NLPVKVVCRANAEYMSPSGK None None 4777 19.09 16.95 17.88 18.03 18.0 18.74 17.37 18.32 18.34 20.12 17.52 18.23 18.74 18.04 18.75 19.38 17.99 18.46 18.58 18.74 18.47 18.43 18.55 19.09 17.9 19.03 18.36 18.19 19.46 18.86 19.18 Q6URK4 Hnrnpa3 3 60.5787251 362152 + 60.5787251 60.584626 heterogeneous nuclear ribonucleoprotein a3 None GGNFGGGGGNFGRGGNFGGR None None 134628 21.03 21.99 22.62 21.61 21.63 21.13 20.54 21.27 22.19 20.99 20.84 22.25 21.61 22.18 23.0 21.03 21.9 20.69 22.37 21.05 23.36 21.9 21.35 22.56 22.35 21.2 22.94 20.72 22.05 22.22 23.13 F1M9Q8 Agps 3 60.7474191 84114 + 60.7474191 60.845734 alkylglycerone-phosphate synthase None GYNDSKFLLNKKGQVELTGK None 603051 2716 18.12 15.3 18.11 18.0 17.66 16.75 17.74 18.02 16.67 15.85 16.99 17.15 17.64 16.95 16.58 17.61 16.73 18.39 17.27 17.69 16.6 16.79 17.3 17.66 19.0 17.17 16.8 16.42 17.92 18.07 17.96 Q9EQR2 Agps 3 60.7474191 84114 + 60.7474191 60.845734 alkyldihydroxyacetonephosphate synthase, peroxisomal None GFDPNQISVATLLFEGDREK None 603051 2716 18.12 15.3 18.11 18.0 17.66 16.75 17.74 18.02 16.67 15.85 16.99 17.15 17.64 16.95 16.58 17.61 16.73 18.39 17.27 17.69 16.6 16.79 17.3 17.66 19.0 17.17 16.8 16.42 17.92 18.07 17.96 Q8VID6 Pde11a 3 60.9135631 140928 - 60.9135631 61.297156 dual 3',5'-cyclic-amp and -gmp phosphodiesterase 11a None GIIGYVGEHGETVNIPDAYQDR None None 129551 15.58 15.74 15.47 15.8 15.46 16.31 16.25 14.93 15.93 14.58 16.58 15.82 15.74 16.02 15.43 15.17 15.17 17.18 14.64 15.21 16.72 15.47 15.56 14.84 15.76 15.28 16.08 16.29 14.08 14.97 14.36 P10715 Cyct 3 61.2900911 25310 - 61.2900911 61.297158 cytochrome c, testis-specific CYCTA None None None None 17.95 19.8 20.03 19.87 20.22 19.38 19.52 21.49 19.24 19.93 20.73 18.38 20.46 18.38 19.12 20.35 18.43 20.39 20.2 20.41 19.29 18.71 20.45 19.79 20.41 19.87 19.59 19.61 20.06 19.48 19.31 Q8CFD1 Rbm45 3 61.3059611 266631 + 61.3059611 61.32096 rna-binding protein 45 None IAQSRSSGSHRDVEDEELTR None None 15560 16.26 14.3 15.2 16.55 16.54 16.55 16.04 16.34 16.73 15.76 15.92 17.05 16.43 15.93 17.34 17.52 16.9 15.06 16.45 16.38 15.39 16.31 16.51 17.03 16.81 16.75 17.42 14.97 16.27 17.25 17.24 A0A0G2JZR1 Osbpl6 3 61.4390121 311129 + 61.4390121 61.541032 oxysterol-binding protein None ELQRSRRRYMEENNLEHIPK None 606734 101447 18.52 15.87 18.07 17.24 18.87 17.62 17.71 17.66 16.94 16.81 18.3 17.53 18.11 17.56 17.75 17.21 18.22 17.71 18.88 16.72 18.38 17.2 18.36 17.82 19.18 18.12 18.22 18.0 17.52 18.57 18.19 G3V7J2 Prkra 3 61.5754411 311130 - 61.5754411 61.594311 interferon-inducible double-stranded rna-dependent protein kinase activator a None MITAKPGKTPIQVLHEYGMK None 603424 2738 18.62 16.55 17.81 17.87 18.09 17.39 17.58 17.81 16.89 17.75 17.46 17.21 17.41 17.81 19.09 17.28 18.33 16.88 17.95 16.72 17.86 17.54 17.13 18.08 19.16 18.1 18.85 17.11 17.29 18.93 18.32 Q4V8C7 Prkra 3 61.5754411 311130 - 61.5754411 61.594311 interferon-inducible double-stranded rna-dependent protein kinase activator a None HHGWRLPEYTLSQEGGPAHK None 603424 2738 18.49 16.14 17.34 17.9 17.7 17.7 17.58 18.13 17.78 18.52 17.37 17.84 17.71 17.85 19.0 16.98 18.17 16.93 18.19 16.65 18.05 17.71 17.36 18.08 17.32 17.34 18.85 17.11 17.29 18.73 18.42 D3ZEY0 Ccdc141 3 61.9485491 311134 - 61.9485491 62.109842 coiled-coil domain-containing 141 None KAPESVLPPPTAFTDGYHNK None None None 17.02 16.52 16.82 16.97 17.43 17.38 17.65 16.64 16.11 16.69 18.36 17.34 15.7 16.52 16.25 17.52 17.85 17.8 16.94 15.75 16.78 17.17 17.49 17.02 17.27 16.94 17.16 15.88 16.46 17.65 16.56 B5DFL9 Sestd1 3 62.1298891 295678 - 62.1298891 62.180876 sec14 and spectrin domain-containing 1 None YQEVCRQRSKRTQLEEIQQK None None 45505 17.34 17.72 17.19 17.61 17.25 17.29 16.93 18.16 17.46 16.22 17.43 18.1 18.53 17.76 17.62 17.61 18.52 18.26 17.74 16.17 18.06 17.63 16.87 18.22 18.42 18.93 18.14 17.79 17.49 16.51 19.34 F1LY38 Cwc22 3 62.8154671 362153 - 62.8154671 62.850577 cwc22 spliceosome-associated protein homolog None RRSPDRGVSQSSTQEEPTSK None None None 15.09 13.73 15.06 15.28 16.46 15.43 15.79 15.94 14.75 14.34 14.59 15.77 15.22 14.93 15.68 14.61 15.19 13.81 16.24 15.19 15.96 14.42 15.31 14.62 16.4 15.31 16.11 15.84 14.77 15.74 16.72 A0A0G2K964 Ube2e3 3 63.7872591 295686 + 63.7872591 63.843232 ubiquitin-conjugating enzyme e2e 3 None GVICLDILKDNWSPALTISK None 604151 4636 15.42 13.41 15.82 14.26 15.3 15.73 14.88 16.42 16.28 15.33 13.79 14.46 15.51 15.18 16.02 14.22 13.95 15.98 14.96 15.08 15.58 14.88 15.19 15.43 14.89 15.34 16.28 15.59 14.28 15.61 16.48 F7F5A1 Ube2e3 3 63.7872591 295686 + 63.7872591 63.843232 ubiquitin-conjugating enzyme e2e 3 None GVICLDILKDNWSPALTISK None 604151 4636 13.71 14.55 15.88 14.39 15.43 15.69 15.15 16.55 15.84 15.2 13.95 14.78 16.08 15.31 15.91 14.35 14.92 15.53 15.82 15.09 15.71 15.02 15.6 16.1 15.28 15.84 15.01 16.21 13.98 15.31 15.86 D3ZLC3 Itprid2 3 64.5368671 311146 + 64.5368671 64.574652 itpr-interacting domain-containing 2 None PTAEEMHRNVEQDELQQVIR None None 4912 14.41 15.12 15.68 15.63 15.78 13.58 14.65 14.61 15.94 14.06 15.15 14.62 14.54 14.68 14.24 14.58 14.78 15.04 15.53 14.13 15.68 14.23 14.69 15.19 15.24 14.22 15.53 15.91 13.5 14.67 15.45 A0A0G2K2K1 Pde1a 3 64.747271 81529 - 64.747271 64.829124 phosphodiesterase None LLDTEDELSDIQTDSVPSEVR None 171890 21043 19.03 18.62 18.21 18.57 17.36 19.0 19.43 18.93 18.8 19.4 19.49 18.54 19.04 19.6 18.13 19.62 19.18 19.46 19.0 18.22 18.97 19.27 19.86 17.94 18.34 19.54 18.45 19.64 19.11 18.35 18.28 Q498R3 Dnajc10 3 65.2326981 295690 + 65.2326981 65.272726 dnaj homolog subfamily c member 10 None ESVNSHVTTLGPQNFPASDK None 607987 10358 17.87 15.35 17.11 17.1 17.03 17.18 17.24 15.97 15.63 17.46 18.5 17.07 17.93 17.42 17.69 17.23 16.91 17.76 17.99 16.09 17.82 17.79 17.64 18.07 17.78 17.22 17.89 16.09 17.43 17.67 17.94 F1LSM5 Nckap1 3 65.4182181 58823 - 65.4182181 65.481169 nck-associated protein 1 None None None None 21.34 22.87 20.23 21.01 20.83 20.85 20.17 21.33 21.31 21.39 20.12 21.38 21.01 20.68 20.24 22.32 21.15 22.18 21.86 20.11 20.83 20.76 20.82 20.86 20.97 22.25 20.78 22.0 22.14 20.04 21.06 P55161 Nckap1 3 65.4182181 58823 - 65.4182181 65.481169 nck-associated protein 1 None KPDQMAALFKRLSSVDSVLK None 604891 8384 21.29 23.04 20.23 21.02 20.83 20.82 20.18 21.33 21.28 21.37 20.14 21.34 20.87 20.68 20.16 22.32 21.01 22.13 21.94 20.19 20.83 20.75 20.8 20.91 21.06 22.29 20.75 22.02 22.1 20.08 21.02 Q68FY1 Nup35 3 65.5585541 295692 + 65.5585541 65.584457 nucleoporin nup35 None AFTPPIRTLGTPTQPGSTPR None 608140 44517 16.23 15.69 16.62 15.98 16.26 15.97 16.0 15.99 17.41 15.73 15.84 16.68 16.23 17.03 16.29 15.62 16.65 16.79 17.63 15.54 18.12 16.53 16.73 16.62 16.86 15.62 16.73 16.37 16.96 16.74 17.88 A0A096MJX4 Fsip2 3 67.9623811 680315 + 67.9623811 68.032866 fibrous sheath-interacting protein 2 None LHSKLSQNVLVNRVHYDISK None None None 17.95 17.16 16.5 17.51 17.84 16.27 17.76 18.28 16.97 16.61 16.62 16.98 17.38 16.08 16.48 18.45 17.43 17.05 16.77 17.78 16.11 16.78 16.78 16.21 18.43 18.96 16.06 17.68 18.33 17.1 17.73 Q6U6G5 Zc3h15 3 68.7447091 362154 + 68.7447091 68.764333 zinc finger ccch domain-containing protein 15 None HQVKFGQQNPRQVAQSEAEK None None 10216 18.03 15.95 17.56 18.34 17.17 17.02 17.74 17.01 16.85 17.27 18.04 17.97 17.99 17.28 17.77 17.78 17.64 18.6 17.98 16.58 18.14 18.25 17.83 18.1 18.57 18.04 17.12 17.23 18.1 17.69 18.1 A0A0G2JVZ6 Itgav 3 68.8387971 296456 + 68.8387971 68.923106 integrin subunit alpha v None ARPVVTVNAGLEVYPSILNQDNK None 193210 20510 18.46 19.2 17.38 18.16 19.59 19.26 18.14 19.07 18.04 19.63 18.02 19.71 19.71 18.5 18.83 19.96 19.47 18.83 17.57 19.41 18.38 17.5 17.71 19.41 18.39 19.39 18.14 18.64 19.35 19.85 17.36 D3ZTG3 Fam171b 3 68.9309971 499821 + 68.9309971 68.983307 family with sequence similarity 171, member b None LDGGGGVIIEHPREESPGSK None None None 17.27 15.31 18.18 16.97 16.28 17.07 16.03 16.43 17.9 17.47 17.06 16.12 17.54 17.73 16.45 16.26 16.96 16.8 18.22 16.64 18.14 18.2 17.68 18.32 16.59 17.08 16.56 16.92 17.49 17.37 17.5 Q63118 Calcrl 3 69.4283671 25029 - 69.4283671 69.52565 calcitonin gene-related peptide type 1 receptor None EHLNGKSIQDIENVALKPEK None 114190 21179 16.85 15.58 17.19 17.01 17.85 16.23 17.72 16.29 17.63 15.54 17.09 17.2 16.93 17.03 16.81 15.42 16.09 16.89 17.57 16.16 17.54 16.63 16.49 15.33 16.4 16.09 16.91 16.81 17.37 16.84 18.65 D3ZZZ9 Ctnnd1 3 69.6835761 311163 - 69.6835761 69.734557 catenin (cadherin associated protein), delta 1, isoform cra_a None SKLVENCVCLLRNLSYQVHR None 601045 1017 19.3 18.03 18.21 18.43 18.36 18.69 18.56 18.52 19.21 19.77 18.88 19.27 19.75 19.42 18.26 18.43 19.25 19.33 20.06 17.44 19.61 19.38 18.56 19.24 18.16 18.81 19.02 18.66 18.91 18.24 18.86 Q5XIK2 Tmx2 3 69.754941 295701 - 69.754941 69.762587 thioredoxin-related transmembrane protein 2 None ICNGLPTQREDGNPCDFDWR None None 9317 20.09 17.79 19.8 18.71 19.16 18.01 19.19 19.84 18.79 19.48 18.87 17.38 19.23 17.96 19.93 18.58 18.56 18.83 19.0 18.32 18.16 19.18 18.44 18.27 19.0 18.88 18.52 18.68 19.67 18.66 19.47 Q2THW7 Zdhhc5 3 69.7728271 362156 - 69.7728271 69.795191 palmitoyltransferase zdhhc5 None TIVIRPPFLRPEVSDGQITVK None None 9147 17.6 15.55 17.4 17.81 18.56 16.77 16.58 17.25 18.46 16.88 16.38 17.56 17.73 17.6 15.62 17.34 17.38 18.0 17.76 17.72 16.16 16.69 17.91 17.33 17.82 17.7 16.69 17.81 18.37 17.9 17.74 Q6P734 Serping1 3 69.8426861 295703 - 69.8426861 69.852575 plasma protease c1 inhibitor None LSLYGSSPRVLGPDGDANLK None 606860 44 17.18 14.54 16.0 16.97 16.35 15.46 17.51 17.81 14.67 15.95 16.93 16.29 16.55 15.32 16.25 16.19 15.43 16.26 16.2 16.93 16.25 15.03 16.74 15.89 17.27 16.72 15.67 15.82 16.03 16.35 15.49 P62074 Timm10 3 69.9084671 64464 + 69.9084671 69.911937 mitochondrial import inner membrane translocase subunit tim10 None HERMGKKLTELSMQDEELMK None 602251 40845 18.04 19.59 18.29 17.97 17.82 18.87 19.18 18.3 19.16 20.32 18.6 18.44 18.48 18.59 18.81 19.37 18.36 18.44 17.83 19.88 18.69 19.14 18.52 18.21 16.92 18.7 19.44 18.35 18.46 17.93 18.01 F7FL53 Slc43a1 3 69.9208351 311168 + 69.9208351 69.946211 solute carrier family 43 member 1 None YYYRSRLEREYATNLLDPQK None 603733 2688 15.54 13.51 15.0 15.38 14.52 13.99 16.7 16.61 14.86 15.0 17.13 15.72 15.57 16.78 14.11 14.93 16.45 15.72 15.78 15.09 15.36 15.05 15.4 16.03 15.44 15.45 14.83 15.25 14.17 16.2 15.94 Q80WD1 Rtn4rl2 3 69.955171 311169 - 69.955171 69.971108 reticulon-4 receptor-like 2 None LGDNRHLRSLEPDTFQGLER None None None 16.99 16.67 16.93 17.29 16.41 16.91 16.45 17.67 16.37 16.86 17.0 17.11 17.44 16.91 16.52 17.78 17.3 17.03 17.45 16.35 16.44 16.51 17.22 16.24 17.49 17.44 15.96 18.61 17.34 16.32 16.53 Q04931 Ssrp1 3 70.1244011 81785 + 70.1244011 70.134512 fact complex subunit ssrp1 None VNFARGTTTTRSFDFEIETK None 604328 110735 17.19 16.53 17.99 16.05 16.76 16.29 16.98 17.26 16.68 15.7 17.14 17.33 16.86 16.96 18.48 16.22 16.21 16.58 17.46 16.69 18.82 17.24 16.64 17.41 17.69 16.65 17.7 17.65 15.23 16.87 18.75 D3ZF26 Tnks1bp1 3 70.1377531 295707 + 70.1377531 70.160082 tankyrase 1-binding protein 1 None CSLGQEVMGIGSSQDECEVPVHER None 607104 14117 18.06 16.48 17.44 17.86 16.96 18.3 17.21 17.63 18.16 17.4 18.23 18.31 18.47 17.98 17.33 18.43 18.13 18.45 18.21 17.08 18.23 17.09 18.5 18.15 17.62 18.05 17.78 17.9 18.41 17.76 17.5 A0A0G2JXZ9 Ptprj 3 76.4059341 29645 - 76.4059341 76.561669 protein-tyrosine-phosphatase None RDPSLTEVLLTELKPDTQYK None 600925 2130 17.73 16.35 16.95 17.3 16.48 17.26 17.15 17.01 17.97 16.74 17.27 18.16 17.89 17.72 17.52 17.16 17.5 17.54 17.4 17.93 18.74 18.19 17.77 17.32 17.34 18.2 16.56 18.91 17.61 17.5 17.98 E9PTB7 Ptprj 3 76.4059341 29645 - 76.4059341 76.561669 protein-tyrosine-phosphatase DEP-1 None None None None 17.75 16.38 16.98 17.33 16.51 17.29 16.99 17.03 18.0 16.77 17.3 18.18 17.92 17.75 17.62 17.18 17.55 17.61 17.42 17.83 18.77 18.22 17.8 17.82 17.37 18.23 16.5 19.02 17.44 17.52 18.01 D3ZBL6 Nup160 3 76.6678431 311182 + 76.6678431 76.713086 nucleoporin 160 None YRSELVTESQMQSIFTDIGK None 607614 32509 15.99 15.85 16.72 16.19 16.81 16.39 15.63 16.78 16.22 15.91 16.35 16.54 15.61 15.86 15.88 15.88 16.3 16.92 16.58 15.44 17.12 15.67 16.03 16.6 16.76 15.71 15.84 15.59 17.49 16.26 17.92 A0A0G2K4C8 Fnbp4 3 76.7330281 311183 + 76.7330281 76.763411 formin-binding protein 4 None SSEKIKVQIAPKVEEEQDLK None None 9087 14.33 13.28 15.01 15.06 14.72 14.55 14.14 13.13 14.7 13.12 14.55 15.29 15.06 15.05 14.23 14.58 14.7 14.42 14.64 16.24 16.14 14.59 15.22 15.82 15.82 14.47 13.71 15.18 14.96 14.94 15.75 A0A0G2K459 Mtch2 3 76.830611 295922 + 76.830611 76.848839 mitochondrial carrier 2 None MYVKVLIQVGYEPLPPTIGR None 613221 8645 18.16 19.96 18.43 19.83 20.39 19.1 20.15 19.92 20.03 20.08 18.61 20.43 20.21 19.58 18.82 19.69 19.7 19.09 20.99 19.09 20.1 18.91 20.08 18.74 18.94 20.02 19.16 19.34 20.67 19.11 19.55 F7EUJ8 C1qtnf4 3 76.8685281 311184 + 76.8685281 76.872985 c1q and tnf-related 4 None LHGAPQYALGAPGATFSGYLVYADADADAPAR None None 12134 16.93 16.29 17.33 17.27 16.1 16.98 16.34 16.07 16.85 17.12 16.81 16.71 17.39 16.88 16.88 15.79 17.26 15.96 17.76 16.21 17.77 18.29 16.69 16.94 17.42 16.6 17.17 18.09 16.19 16.9 17.77 D3ZG43 Ndufs3 3 76.8766551 295923 - 76.8766551 76.88384 complex i-30kd None DLNSPWEAFPAYRQPPEHLK None 603846 3346 22.46 21.08 21.19 20.88 21.73 20.98 21.0 21.48 21.16 22.57 20.17 21.03 21.45 21.44 20.86 21.99 21.44 21.5 21.46 21.88 20.19 21.77 21.54 21.74 23.04 21.39 22.06 21.57 20.63 21.46 21.98 P0C089 Ptpmt1 3 76.8899231 29390 - 76.8899231 76.899427 phosphatidylglycerophosphatase and protein-tyrosine phosphatase 1 None QLRLSTVDMTGVPTLANLHR None None 11973 17.21 17.43 16.62 17.73 17.73 15.81 16.66 17.78 16.7 16.13 15.81 16.81 17.68 16.69 18.34 17.44 16.1 16.3 16.59 17.43 16.05 15.87 16.17 18.08 18.16 18.25 17.65 15.77 17.22 16.71 18.05 Q4QQT3 Celf1 3 76.9793141 362160 + 76.9793141 76.996964 cugbp elav-like family member 1 None VTFYTRKAALEAQNALHNMK None 601074 None 18.19 18.29 17.11 18.17 17.91 18.49 17.09 18.09 19.8 18.73 17.7 18.21 18.78 19.0 18.31 18.91 19.41 18.39 18.67 17.6 19.85 18.94 18.76 19.67 19.01 19.79 19.43 18.3 18.66 18.34 19.58 Q63569 Psmc3 3 77.0318261 29677 + 77.0318261 77.037206 26s proteasome regulatory subunit 6a None KTSTRQTYFLPVIGLVDAEK None 186852 2097 20.56 20.02 20.38 20.54 18.59 18.34 19.91 19.52 19.88 19.48 20.05 19.42 20.01 20.97 19.51 19.03 20.84 20.03 19.47 18.82 19.64 19.86 19.64 19.87 20.9 19.4 20.72 19.37 19.03 19.79 19.68 A0A0G2KA27 Madd 3 77.1149771 94193 - 77.1149771 77.15771 map kinase-activating death domain protein None AVQSEDDARQDVIQDVEISR None 130410 14249 19.49 17.39 19.09 19.62 18.74 18.79 18.9 18.16 20.56 18.45 17.88 19.36 19.47 19.85 19.42 18.26 19.66 18.63 19.89 17.46 19.7 19.14 19.69 18.91 19.07 19.25 19.37 19.18 19.01 19.3 19.64 O08873 Madd 3 77.1149771 94193 - 77.1149771 77.15771 map kinase-activating death domain protein None KGSMWDQLEDAAMETFSISK None 130410 14249 19.46 17.39 18.83 19.58 18.67 18.94 18.95 18.04 20.55 18.58 17.76 19.54 19.47 19.81 19.43 18.31 19.67 18.59 19.87 17.44 19.73 19.16 19.67 18.82 18.76 19.36 19.31 19.2 19.01 19.31 19.62 P20611 Acp2 3 77.1761171 24162 + 77.1761171 77.18504 lysosomal acid phosphatase None FGQLTKEGMLQHWELGQALR None 171650 1217 15.96 18.24 17.55 17.65 16.51 16.15 17.26 18.21 16.59 17.06 17.11 16.01 16.59 16.93 17.11 16.44 16.52 17.18 16.76 17.14 16.53 17.3 17.25 17.02 17.64 16.83 18.14 16.42 16.1 17.46 16.0 G3V9N7 Pacsin3 3 77.227251 311187 + 77.227251 77.235809 protein kinase c and casein kinase substrate in neurons 3 None QRVEDGHRLCGDLISCFQER None 606513 41117 18.28 16.45 18.38 17.56 18.45 17.66 18.07 18.27 17.83 17.67 17.95 17.72 17.67 18.89 17.04 17.08 17.15 18.01 18.45 19.27 18.58 16.74 18.29 19.11 18.67 17.82 18.2 17.5 17.51 19.08 18.85 Q3MID3 Arfgap2 3 77.236411 362162 + 77.236411 77.248444 adp-ribosylation factor gtpase-activating protein 2 None KAISSDMFFGREVDSEYEAR None 606908 8735 18.44 17.08 18.9 17.63 18.19 17.35 17.71 17.67 18.94 17.64 16.9 17.65 18.43 18.65 18.05 16.84 16.94 18.71 19.11 17.18 19.71 17.65 18.09 18.89 19.04 18.16 19.36 17.15 17.52 18.06 19.37 F1M949 Ckap5 3 77.5348591 311191 + 77.5348591 77.593303 cytoskeleton-associated protein 5 None STGVLKDLMHGLITLMLDSR None 611142 8844 20.36 18.05 20.43 19.74 19.58 19.24 20.07 20.59 19.45 19.47 18.47 19.43 20.28 19.49 20.68 18.7 20.0 19.46 20.47 18.48 20.54 20.1 19.9 19.68 20.6 20.65 20.36 20.09 18.89 20.64 20.54 P18292 F2 3 77.5961571 29251 - 77.5961571 77.609524 prothrombin None RSRGSKENLSPPLGECLLER None 176930 426 17.54 18.41 17.25 18.33 17.71 17.8 18.8 18.07 17.67 17.63 18.45 18.14 17.27 17.26 18.09 17.42 17.26 17.46 16.91 18.27 18.01 16.22 17.23 17.73 16.24 17.43 17.04 17.19 17.08 16.56 17.0 D4A6C5 Arhgap1 3 77.621691 311193 + 77.621691 77.643375 rho gtpase-activating protein 1 None YNMGLPVDFDQYNELHLPAVILK None 602732 20909 19.71 21.07 20.43 19.42 18.01 19.98 20.13 19.25 20.19 20.08 19.73 18.6 19.17 20.3 20.09 19.07 20.07 19.31 20.18 18.27 20.3 20.81 19.58 20.06 19.12 19.98 20.15 19.6 18.23 18.68 19.33 D3ZA45 Atg13 3 77.6477681 362164 - 77.6477681 77.667863 autophagy-related protein 13 None FKPAFSKDDILPMDLGTFYR None None None 15.97 15.75 15.31 16.6 16.21 14.94 15.38 15.5 17.04 15.13 15.58 14.94 15.23 14.82 15.4 15.7 16.4 14.76 15.62 15.57 14.65 15.57 15.17 14.78 14.79 16.26 15.13 15.15 16.92 15.92 15.0 P08485 Chrm4 3 77.8934261 25111 + 77.8934261 77.901159 muscarinic acetylcholine receptor m4 None VPDKDTSNESSSGSATQNTK None 118495 20192 16.89 14.73 15.5 16.15 16.07 16.53 15.97 15.61 17.14 16.68 16.44 15.99 16.2 16.89 15.3 15.98 17.19 15.7 16.45 15.81 16.6 16.95 17.28 16.66 15.85 16.1 15.6 16.49 16.76 16.26 16.39 O08560 Dgkz 3 77.9041591 81821 - 77.9041591 77.935971 diacylglycerol kinase zeta None MHRDHQSRTLLHHAVSTGSK None None 37831 17.47 17.53 17.21 16.99 17.75 18.34 17.55 17.3 18.53 17.96 16.87 19.24 18.25 18.01 18.63 17.82 17.36 17.58 19.08 16.62 19.12 17.84 17.58 18.27 16.76 17.72 18.39 17.78 17.32 17.9 19.34 A0A0G2JWT6 Pex16 3 78.3431651 311203 + 78.3431651 78.352601 peroxisomal membrane protein pex16 None YQEYVTRHPAATAQLETAVR None 603360 3537 15.98 13.87 16.07 15.65 15.29 16.01 15.47 14.72 16.21 14.82 16.2 15.38 16.02 16.74 16.07 15.32 15.22 16.33 16.33 14.22 16.92 15.67 16.13 16.36 16.8 14.34 15.82 15.72 15.0 16.67 16.06 Q9R237 Mapk8ip1 3 78.3550531 116457 - 78.3550531 78.364208 c-jun-amino-terminal kinase-interacting protein 1 None RSQGQGQGPGTGSGDTYRPK None 604641 31314 15.73 13.95 16.27 15.97 15.49 15.1 15.0 15.42 15.24 15.22 15.43 14.31 15.94 15.33 16.3 15.13 14.59 14.35 16.44 15.57 14.33 16.01 15.86 14.74 16.0 15.71 15.42 15.63 16.39 15.55 15.22 Q923I8 Cry2 3 78.3749941 170917 - 78.3749941 78.404954 cryptochrome-2 None GINRWRFLLQSLEDLDTSLR None 603732 56466 15.96 14.93 15.72 14.62 13.91 15.65 16.05 14.4 15.01 14.29 14.89 14.78 13.63 15.77 15.96 14.52 14.75 14.25 14.85 15.28 16.18 15.71 14.46 14.35 16.09 15.39 14.14 15.44 15.2 15.63 15.5 B3DMA0 Tp53i11 3 79.1448961 311209 + 79.1448961 79.160048 tumor protein p53-inducible protein 11 None LKTRKILGVGGEDDDGEVHR None None 4404 16.54 17.55 18.42 16.89 15.77 16.37 17.94 18.32 17.65 17.02 17.58 16.18 17.85 18.05 17.7 17.07 16.85 17.27 17.82 15.9 17.68 16.8 17.19 17.55 17.32 16.88 16.9 16.86 16.69 16.36 16.86 O70352 Cd82 3 79.3873711 83628 - 79.3873711 79.431358 cd82 antigen None TTYPCSCEKTKEEDNQLIVK None 600623 20512 19.35 16.64 18.62 17.04 17.86 18.97 17.89 17.22 17.8 18.81 19.06 16.86 17.28 18.51 18.04 17.55 17.28 17.94 17.3 19.33 17.78 18.32 18.13 17.43 17.96 16.42 18.18 16.86 19.06 19.16 17.09 A0A0G2KAH7 Ext2 3 79.6654161 311215 - 79.6654161 79.798059 exostosin glycosyltransferase 2 None SSQMAIHPEYREELEALQAK None 608210 345 14.52 16.14 14.53 14.64 14.76 15.09 14.42 14.5 14.16 15.44 14.64 14.22 15.19 15.26 15.18 14.6 15.97 15.16 13.51 15.11 15.98 15.26 14.17 14.55 16.19 15.55 15.82 16.01 13.73 15.57 15.41 Q5XIC8 Alkbh3 3 79.9396011 362169 - 79.9396011 79.971934 alpha-ketoglutarate-dependent dioxygenase alkb homolog 3 None RVIDREGVYEISLSPTGVSR None 610603 16393 16.92 13.63 15.9 14.71 16.69 15.62 16.62 15.5 15.87 14.12 16.82 15.0 15.25 16.27 14.21 15.33 16.24 16.51 15.26 15.81 15.31 15.23 15.59 14.79 16.15 15.01 14.5 15.75 15.84 16.04 15.77 Q6P7R8 Hsd17b12 3 79.9900431 84013 - 79.9900431 80.113678 very-long-chain 3-oxoacyl-coa reductase None VGPRLGEWAVVTGGTDGIGK None None 95094 20.31 19.91 20.38 19.36 19.8 20.17 19.32 20.98 19.4 21.15 20.02 20.08 20.77 19.42 20.92 20.29 19.99 20.32 20.38 19.02 19.46 21.35 19.18 20.09 19.34 20.16 21.03 20.78 19.42 20.78 21.22 B1WC49 Api5 3 80.3781031 362170 - 80.3781031 80.403174 api5 protein None QQLVELVAEQADLEQTFSPSDPDCVDR None 609774 4809 18.59 19.11 19.79 19.18 19.22 18.36 19.72 19.0 19.62 18.0 18.69 19.11 18.91 19.38 19.09 18.38 17.65 19.55 20.11 19.58 20.43 18.97 18.83 17.95 20.21 18.9 19.87 19.38 18.71 19.25 20.73 D3ZXT1 Lrrc4c 3 82.3055021 311236 + 82.3055021 83.681631 leucine rich repeat containing 4c, isoform cra_a None YLNLAMCNLREIPNLTPLIK None 608817 18696 18.3 16.56 17.1 18.85 17.53 17.01 17.02 17.6 17.48 17.38 17.8 17.37 17.82 17.69 16.27 17.11 17.71 18.14 17.37 17.62 17.05 17.04 17.73 18.16 17.91 17.72 16.18 17.76 18.51 16.91 17.75 D3ZE97 Rpl21 3 82.4288041 + 82.4288041 82.429285 60s ribosomal protein l21 None VIPLATYMRIYKKGDIVDIK None None None 19.87 17.18 19.51 20.0 19.71 18.35 17.79 20.09 19.45 19.37 20.31 19.72 19.53 19.3 19.63 19.75 18.19 20.18 19.48 18.57 18.66 18.7 19.54 20.17 18.69 19.38 20.01 18.34 19.9 19.59 19.37 B5DF45 Traf6 3 87.9635181 311245 + 87.9635181 87.98335 tnf receptor-associated factor 6 None DDTLLVRCEVSTRFDMGGLR None 602355 3395 16.61 16.94 16.87 16.47 16.56 15.66 14.72 17.24 15.98 15.34 16.95 15.81 15.17 15.7 16.11 15.74 14.87 15.73 17.35 16.57 15.18 15.43 15.45 16.88 16.26 14.9 17.22 15.45 15.89 15.82 15.78 Q3MIE7 Commd9 3 88.1759911 295956 + 88.1759911 88.190427 comm domain containing 9, isoform cra_a None DLSSAEAILALFPENFHQNLK None None 8584 17.46 15.49 17.21 17.13 16.63 18.27 17.53 16.27 16.87 16.06 18.07 17.21 17.63 17.05 16.84 16.43 16.55 18.62 16.84 17.2 17.55 17.7 17.14 15.53 18.0 16.23 17.15 17.23 18.07 17.69 17.94 M0RD98 Igkv1-133 3 88.5124361 + 88.5124361 88.512917 ig-like domain-containing protein None None None None 16.79 16.54 16.2 16.86 16.25 17.04 17.49 16.59 16.66 16.88 17.73 15.79 16.33 16.01 16.57 15.88 17.0 14.99 15.76 16.72 16.28 14.59 16.29 16.33 15.11 15.25 14.76 15.71 16.36 14.77 16.49 G3V6R0 Slc1a2 3 89.1015191 + 89.1015191 89.126411 amino acid transporter None SELDTIDSQHRMHEDIEMTK None None None 23.29 25.41 22.64 23.51 23.1 24.17 23.86 22.46 23.44 24.19 23.73 24.07 23.07 23.98 23.31 23.7 24.64 22.8 24.37 22.64 24.44 23.4 23.85 22.6 22.55 24.69 22.96 23.61 24.86 22.77 22.76 P31596 Slc1a2 3 89.1015191 29482 + 89.1015191 89.126411 excitatory amino acid transporter 2 None NLFPENLVQACFQQIQTVTK None 600300 3075 22.14 22.97 22.67 23.42 22.91 24.12 23.7 22.17 22.8 24.11 23.91 23.73 24.0 23.92 22.8 23.46 24.35 22.86 24.37 22.43 24.24 23.26 24.87 22.4 22.7 23.99 22.69 23.49 24.63 22.85 22.54 P26051 Cd44 3 89.1570811 25406 - 89.1570811 89.244456 cd44 antigen None PSELNGEASKSQEMVHLVNK None 107269 508 17.27 15.22 16.57 16.59 17.46 17.7 16.04 18.11 16.55 16.35 18.55 17.09 16.92 18.16 15.86 16.53 17.58 16.95 17.96 17.34 16.99 16.43 17.38 18.14 17.55 17.36 16.51 18.19 17.32 18.72 17.69 A0A0G2JZH8 Pdhx 3 89.3718981 311254 - 89.3718981 89.431845 dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex None SVDISVAVATDKGLITPIIK None None 55757 20.16 22.85 19.56 19.84 20.22 21.58 19.34 21.43 21.13 21.71 19.38 20.72 20.76 20.13 21.57 21.99 21.27 19.0 20.67 21.17 19.52 21.41 20.0 20.03 20.5 21.91 21.27 21.15 22.05 20.52 20.98 Q7TQ85 Pdhx 3 89.3718981 311254 - 89.3718981 89.431845 ac1164 Ac1164 AVTLKQMPGVNVTWDGEGPK None None 55757 19.95 22.27 19.29 19.65 19.83 21.74 19.23 21.07 20.99 21.51 19.15 20.58 20.7 20.2 21.26 21.52 20.98 18.78 20.55 21.02 19.38 21.32 20.22 19.76 20.36 21.38 21.0 20.8 21.95 20.51 20.78 D3ZUI1 Apip 3 89.4319371 295961 + 89.4319371 89.458253 methylthioribulose-1-phosphate dehydratase None SCAVLVRRHGVYVWGETWEK None 612491 6277 16.65 17.93 15.49 17.46 17.05 16.41 17.58 17.34 15.6 17.26 16.75 17.03 16.25 17.18 15.87 17.0 16.0 17.7 16.96 17.27 16.55 15.72 16.47 16.94 17.74 16.83 16.16 16.37 16.24 16.08 16.1 P04762 Cat 3 89.8423961 24248 - 89.8423961 89.874577 catalase None QVMTFKEAETFPFNPFDLTK None 115500 55514 21.31 18.14 20.48 20.4 20.85 18.8 21.11 20.04 19.04 19.37 21.78 19.69 19.33 20.69 18.56 19.46 19.85 21.44 19.62 20.13 20.2 18.55 20.44 20.93 20.43 19.4 19.36 19.55 18.74 19.9 19.91 A0A0G2JV51 Nat10 3 90.1116441 311257 - 90.1116441 90.149913 rna cytidine acetyltransferase None KAIEEQMVAVKDVVMEPTIK None None None 15.48 17.95 15.33 16.3 15.45 16.57 15.6 16.59 16.73 16.53 15.21 17.65 16.02 16.54 17.33 15.03 16.78 15.26 16.71 15.53 17.11 17.19 15.73 15.72 15.4 17.11 16.06 17.01 16.81 16.0 16.37 Q5M9G3 Caprin1 3 90.1542651 362173 - 90.1542651 90.230484 caprin-1 None SSGPPPPSGSSGSEAAAGAAAPASQHPATGTGAVQTEAMK None None 4310 20.08 19.27 19.25 19.47 20.31 17.88 18.06 19.68 19.72 19.16 18.68 19.98 19.74 20.13 19.84 19.36 19.59 19.57 18.96 19.58 19.44 18.85 19.45 20.21 19.97 19.55 20.22 18.7 20.02 18.92 20.32 D4ABP9 Fbxo3 3 90.4172981 690634 + 90.4172981 90.449557 f-box only protein 3 None HDPLWRRHCKKYWLITEEEK None 609089 8133 17.92 16.2 17.33 16.83 15.62 18.28 16.24 16.62 15.8 17.36 17.84 17.14 17.26 17.29 16.83 17.8 17.87 17.15 16.98 16.12 16.22 18.0 16.94 16.77 16.17 16.6 16.92 18.24 16.95 17.31 16.67 P27274 Cd59 3 90.459171 25407 + 90.459171 90.477322 cd59 glycoprotein None SRLEIANVQYRCCQADLCNK None 107271 56386 17.81 18.08 18.57 19.53 19.47 18.93 19.31 19.47 19.67 19.67 18.68 19.81 19.98 18.65 18.53 19.48 18.82 18.87 19.81 18.6 18.79 18.65 19.87 18.08 17.61 18.85 18.34 19.49 20.32 18.93 18.94 F1LXC7 Hp 3 90.5122491 100362814 - 90.5122491 90.629002 hypothetical protein loc100362814 None LDCQMSHKFLVKTVFFLTQR None None None 17.63 15.62 16.06 17.04 16.76 17.33 16.45 16.5 17.99 17.23 16.86 17.83 17.5 18.42 16.71 17.34 17.35 17.65 18.29 16.2 18.14 17.1 18.1 18.07 17.17 17.85 16.64 17.28 18.18 17.49 17.37 A0A096MJD1 Cstf3 3 90.9664161 362178 + 90.9664161 91.041879 cleavage stimulation factor subunit 3 None None None None 15.68 16.21 16.47 16.66 15.46 16.72 16.58 16.18 17.0 17.65 16.5 16.24 16.21 17.04 16.18 15.79 15.77 15.77 16.39 17.64 18.0 16.45 16.03 16.06 16.17 15.41 16.82 15.62 16.81 16.05 18.19 F1M4W7 Cstf3 3 90.9664161 362178 + 90.9664161 91.041879 cleavage stimulation factor subunit 3 None RGDMNNAKLFSDEAANIYER None None None 16.05 14.81 16.46 16.51 15.5 16.92 15.84 15.52 15.22 14.87 15.82 16.55 16.31 17.19 16.44 14.93 15.79 16.04 16.09 17.39 17.68 16.79 16.22 16.68 17.18 16.85 16.25 15.64 16.71 16.54 17.77 A0A0G2K6F1 Tcp11l1 3 91.0580581 499846 - 91.0580581 91.091497 t-complex 11-like 1 None KLVGEIKETLLSFLLPGHTR None None 41260 20.29 17.47 19.04 19.11 19.04 19.08 18.71 18.46 17.53 18.02 19.99 18.48 17.87 18.95 18.36 18.01 19.59 19.03 17.9 17.13 18.55 17.0 19.45 18.65 19.13 17.78 18.33 17.07 19.84 18.37 17.46 F1M9Y7 Tcp11l1 3 91.0580581 499846 - 91.0580581 91.091497 t-complex 11-like 1 None PTVPGGLGPIQKELEEVAVK None None 41260 20.8 18.08 19.58 19.6 19.57 19.54 19.19 18.98 17.99 18.53 20.46 18.87 18.29 19.42 19.11 18.49 19.89 19.4 18.76 17.39 18.99 17.45 19.86 19.28 19.63 18.32 18.73 17.59 20.27 18.72 17.93 D3ZAZ0 Eif3m 3 91.4247371 295975 - 91.4247371 91.44238 eukaryotic translation initiation factor 3 subunit m None NAWKQNLNKVKNSLLSLSDT None None None 16.74 15.61 17.92 16.22 16.15 17.2 16.87 16.41 16.46 17.31 18.13 17.12 17.66 17.53 17.98 16.39 16.46 17.15 17.71 15.94 18.55 17.29 17.81 17.09 16.63 15.74 16.95 17.22 16.91 17.22 17.05 D3ZUB0 Rcn1 3 91.8424741 362182 - 91.8424741 91.854864 reticulocalbin 1 None EEILDNWNMFVGSQATNYGEDLTK None 602735 20637 19.84 18.1 19.43 19.23 18.63 18.91 19.97 18.14 18.69 19.14 20.08 17.56 19.17 19.91 18.25 18.47 18.43 20.59 17.91 19.08 18.71 19.81 19.47 19.92 18.96 18.08 18.41 17.97 17.82 18.61 17.95 F1M086 Elp4 3 92.2675351 - 92.2675351 92.385217 elongator complex protein 4 None TVVGLESFIGSERETNPLYK None None None 16.28 14.17 16.65 16.53 15.5 16.68 16.28 15.79 16.06 15.83 16.24 16.42 16.38 16.32 14.93 14.86 16.44 16.52 15.13 16.7 17.52 15.48 16.53 16.62 15.14 14.93 16.27 15.51 15.29 16.52 15.94 B1WBP0 Mpped2 3 93.1812321 362185 + 93.1812321 93.355579 metallophosphoesterase mpped2 None TPWFNGWGFNLPRGQSLLDK None 600911 68190 15.8 13.64 15.5 16.07 15.83 16.71 15.7 15.78 15.29 16.08 15.35 16.01 16.28 14.91 14.17 16.95 15.71 15.78 16.79 16.53 15.48 15.84 16.58 14.98 17.21 15.24 15.75 15.59 17.08 16.28 15.72 P15385 Kcna4 3 93.7606451 25469 + 93.7606451 93.76377 potassium voltage-gated channel subfamily a member 4 None FYQLGEEALLKFREDEGFVR None 176266 20514 19.34 20.71 18.29 19.48 20.08 18.99 19.14 20.0 19.31 20.04 19.21 18.5 18.47 18.35 18.86 19.64 19.2 19.36 18.01 19.8 17.7 17.94 18.91 17.82 18.96 19.38 19.36 18.9 19.29 18.25 18.06 Q792I0 Lin7c 3 96.4068021 60442 + 96.4068021 96.414335 protein lin-7 homolog c None GKVKLVVRYTPKVLEEMESR None 612332 22649 19.61 20.41 21.14 20.46 20.07 19.85 20.44 19.64 21.15 19.68 19.36 20.96 20.38 20.64 20.35 19.73 19.77 19.7 20.57 21.6 21.9 20.77 19.39 20.97 20.47 20.21 19.79 20.75 20.08 21.35 21.66 F1M0A0 Ano3 3 97.2356611 311287 - 97.2356611 97.550095 anoctamin None DESEHANYDRSRLLNDFVTK None 610110 None 16.29 15.0 15.33 15.0 15.77 16.51 16.32 15.03 15.68 15.9 16.76 15.47 15.23 14.78 15.49 16.2 16.41 15.41 14.93 16.71 15.58 16.97 15.66 15.42 16.62 14.95 14.65 16.79 16.46 15.63 15.95 M0R7Q5 Rps8 3 98.5861251 100363452 + 98.5861251 98.586774 40s ribosomal protein s8 None QCGRADGYVLEGKELEFYLR None None None 20.25 19.2 20.16 19.7 19.04 18.69 18.38 18.28 19.66 20.86 20.47 20.05 19.76 20.47 20.78 19.35 20.22 19.27 19.78 19.25 20.86 20.55 20.1 20.59 19.29 19.44 20.06 18.72 20.76 19.09 18.89 D3ZR52 Lpcat4 3 99.0452061 296048 + 99.0452061 99.052429 lysophosphatidylcholine acyltransferase 4 None ELTRLAFELFAEEQAEEPDR None 611949 27544 18.21 17.6 16.94 18.38 18.31 15.62 17.29 17.51 17.54 17.33 15.53 17.87 17.26 17.22 17.94 16.94 17.33 17.4 17.64 15.76 16.39 16.88 16.7 17.46 18.4 17.44 17.52 17.42 16.83 16.84 18.11 G3V6N7 Slc12a6 3 99.0722181 691209 + 99.0722181 99.170258 rcg27287, isoform cra_a None DEYFDKNLALFEEEMDTRPK None 604878 21069 21.53 20.94 20.32 21.58 21.11 20.65 21.12 20.46 22.38 21.55 21.25 21.94 21.42 21.98 21.17 20.89 20.83 21.65 22.41 20.49 22.18 20.91 21.4 21.2 20.19 21.61 21.1 21.94 21.2 21.1 21.27 D4A0W1 Emc4 3 99.1697121 296049 - 99.1697121 99.174729 er membrane protein complex subunit 4 None NRGRRFKWAIELSGPGGGSR None None None 16.26 18.29 15.37 15.67 16.59 14.48 16.13 15.89 16.65 16.26 16.43 16.33 15.74 17.04 16.4 16.12 15.94 15.99 16.98 15.09 15.82 14.85 15.37 15.22 16.78 15.18 15.88 16.58 16.64 15.41 16.09 D3ZQL1 Emc7 3 99.2639941 296050 + 99.2639941 99.274402 er membrane protein complex subunit 7 None TDGSFVVHDIPSGSYVVEVISPAYK None None 10597 17.11 19.43 18.11 18.83 18.35 16.11 18.02 17.24 17.01 17.43 19.1 17.6 17.87 17.15 18.92 18.58 17.98 17.42 18.1 16.52 17.14 17.44 16.97 17.1 17.81 17.49 17.09 18.01 18.67 17.51 17.54 D3Z853 Aven 3 99.3625761 311299 + 99.3625761 99.431634 apoptosis and caspase activation inhibitor None VKEEDSLSPDQTSQDQEPER None 605265 10683 16.67 13.94 14.81 16.79 15.51 15.04 14.53 15.46 15.47 14.71 16.62 15.32 15.7 14.6 15.88 15.3 16.55 15.48 15.98 13.75 14.24 16.06 16.24 14.77 16.3 16.18 16.21 16.01 15.64 16.34 14.54 F1M7A1 Ryr3 3 99.4325061 170546 - 99.4325061 99.817114 ryanodine receptor 3 None ASVVVKLLIRRPECFGPALR None 180903 68151 17.98 16.63 17.08 17.23 17.72 18.27 17.89 17.17 18.15 16.89 18.12 18.38 18.1 17.82 18.3 18.15 18.11 17.5 18.23 16.22 18.27 17.47 18.42 17.84 17.97 17.43 17.79 18.13 17.04 17.73 17.57 D3ZBI5 Fmn1 3 100.1348221 + 100.1348221 100.405175 formin 1 None DLETLAALYENRAQEDELTK None None None 17.4 14.95 16.97 17.32 17.19 17.16 15.93 16.33 16.57 15.48 17.61 17.09 17.21 17.81 17.36 15.86 16.83 18.61 16.37 16.46 18.18 17.19 17.75 16.49 18.3 17.68 17.23 17.22 18.05 17.99 17.31 D4A4Y9 Fmn1 3 100.1348221 + 100.1348221 100.405175 formin 1 None EGPDITSLSQQPNEHPGDIFFK None None None 15.85 15.05 15.03 14.96 16.32 16.79 15.26 15.36 15.88 14.59 16.65 15.67 14.65 15.51 14.02 15.35 16.36 15.41 16.67 15.31 16.25 15.24 16.27 14.25 16.18 15.15 15.68 15.94 16.79 16.02 16.04 D4A7C2 Fmn1 3 100.1348221 + 100.1348221 100.405175 formin 1 None NKVLRKVIESEKLDEATEGK None None None 15.85 15.05 15.03 14.96 16.32 16.79 15.26 15.36 15.88 14.59 16.65 15.67 14.65 15.51 14.02 15.35 16.36 15.41 16.67 15.31 16.25 15.24 16.27 14.25 16.18 15.15 15.68 15.94 16.79 16.02 16.04 P27682 Scg5 3 100.5440871 25719 - 100.5440871 100.5885 neuroendocrine protein 7b2 None TDIQRLLHGVMEQLGIARPR None None 37722 17.06 18.53 18.24 18.66 17.94 18.84 19.54 18.76 18.74 19.24 18.41 19.01 19.61 18.22 19.05 18.45 19.47 16.82 17.82 18.83 17.52 19.25 18.93 16.8 16.83 18.12 18.51 18.03 19.09 17.98 17.52 A3KNA0 Aqr 3 100.8748811 366163 - 100.8748811 100.945058 rna helicase aquarius None LFTRFVRVGVPTVDLDAQGR None None 7629 15.38 16.32 16.52 16.78 15.95 15.8 14.85 16.08 16.37 15.29 15.61 16.19 15.8 16.1 16.84 15.87 15.09 15.44 17.36 15.51 17.13 14.95 15.6 16.75 17.52 15.86 16.53 15.22 17.17 16.34 16.95 Q5M9F5 Dph6 3 101.3088761 362191 - 101.3088761 101.437347 diphthine--ammonia ligase None RLNLQPLAYLWQRNQEDLLR None None 80244 16.16 17.91 15.36 17.42 17.1 15.61 17.33 16.42 16.35 15.87 15.52 16.36 15.81 15.83 15.74 17.27 15.93 16.78 16.74 16.5 14.78 15.81 15.84 15.0 17.27 17.75 16.1 16.4 16.04 16.07 15.82 Q3C2P9 Spred1 3 103.9839281 296072 + 103.9839281 104.046227 sprouty protein with evh-1 domain 1, related sequence None DMWKNDLERDDTDSSVPFSK None 609291 24919 17.05 15.85 16.22 15.79 16.94 16.31 17.52 15.14 17.63 16.38 16.43 16.08 16.05 15.85 16.13 16.68 16.17 16.13 16.19 16.14 16.11 17.32 16.51 15.08 15.23 16.33 16.64 15.34 16.43 16.97 15.93 D4AE02 Fam98b 3 104.1348331 + 104.1348331 104.163704 family with sequence similarity 98, member B None LGSQIKSLCNLEESITSAGR None None None 17.93 17.16 17.63 18.05 18.46 19.03 18.61 17.41 19.05 17.89 18.13 19.56 18.97 18.66 19.41 17.38 17.21 18.63 18.56 18.75 19.94 18.9 18.51 17.98 17.51 17.96 18.68 17.73 18.57 18.42 19.92 Q9R1K8 Rasgrp1 3 104.1700141 29434 - 104.1700141 104.230056 ras guanyl-releasing protein 1 None SDYQNYLVNSCVKENPTMER None 603962 4195 16.4 15.2 16.03 16.27 16.62 17.63 16.08 15.9 16.76 17.61 16.58 16.47 16.64 17.1 17.21 17.22 17.28 16.4 16.82 14.96 17.21 16.18 18.13 16.91 16.74 16.81 16.3 16.39 17.39 16.09 16.49 A0A0G2JV24 Thbs1 3 105.0573461 445442 + 105.0573461 105.069652 thrombospondin 1 None DVDECKEVPDACFNHNGEHR None None None 18.16 15.68 16.56 17.53 17.08 16.85 18.42 17.78 17.53 16.87 17.43 17.51 17.16 16.91 17.13 16.44 16.86 17.72 16.45 16.82 17.02 16.0 17.0 16.31 15.77 16.8 17.16 16.78 16.12 16.71 16.52 M0R979 Thbs1 3 105.0573461 445442 + 105.0573461 105.069652 thrombospondin 1 None IFLASLRQMKKTRALLAVER None None None 18.3 15.45 16.72 17.73 17.23 16.96 18.59 18.01 17.66 17.03 17.67 17.66 17.44 17.1 17.27 16.54 17.02 17.89 16.62 16.98 17.2 16.16 17.27 16.4 15.94 16.94 17.08 17.09 16.39 17.1 16.89 D4A7V9 Eif2ak4 3 105.3563461 114859 + 105.3563461 105.445465 eif-2-alpha kinase gcn2 None VKIGDFGLATDHLAFNAEGK None None 40891 16.65 14.08 15.65 17.19 16.34 14.97 16.85 17.36 15.89 16.29 16.17 15.16 16.42 16.24 15.89 15.33 17.19 15.85 15.55 16.23 16.22 15.95 16.55 15.62 17.25 17.68 15.77 17.21 16.11 17.19 16.6 B2RYW7 Srp14 3 105.4421851 296076 - 105.4421851 105.445875 signal recognition particle 14 kda protein None KCLLRATDGKRKISTVVSSK None 600708 37738 17.57 18.37 17.97 17.21 16.2 16.54 16.18 18.23 16.32 17.08 18.16 17.53 16.89 18.04 19.06 17.38 17.22 17.19 17.23 16.68 17.7 16.83 16.31 17.97 17.17 18.57 18.35 16.71 16.93 17.4 18.16 O89040 Plcb2 3 105.685171 85240 - 105.685171 105.704204 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 None None None None 15.68 18.01 16.74 16.83 15.92 18.3 16.52 17.04 17.67 17.77 16.81 17.92 17.45 17.92 16.47 17.32 16.88 17.1 18.05 17.82 18.36 16.45 17.74 18.09 15.87 16.62 16.71 17.45 17.39 16.42 16.86 D3ZBZ6 Disp2 3 105.762321 311324 + 105.762321 105.777825 dispatched rnd transporter family member 2 None TLLSTLSPAAWGRAEESVVR None None 24916 16.11 16.88 16.65 17.16 16.1 14.32 15.3 16.65 16.07 16.24 16.32 14.99 15.76 15.23 15.99 15.98 15.53 16.37 14.95 16.46 14.64 15.44 15.22 16.68 16.34 15.49 15.38 14.95 17.29 15.23 15.4 P12007 Ivd 3 105.8516681 24513 + 105.8516681 105.872528 isovaleryl-coa dehydrogenase None EQKQLRHTISKFVQENLAPK None 607036 1676 19.36 21.84 20.82 19.41 18.97 19.13 20.1 18.76 18.96 19.96 18.98 19.42 19.12 20.31 19.21 20.41 18.79 19.71 20.41 21.35 21.01 19.71 19.2 19.49 19.88 20.98 20.85 18.57 19.87 19.25 20.17 Q561K4 Ccdc32 3 105.998441 296081 - 105.998441 106.010985 coiled-coil domain-containing protein 32 None ASLEKKLRRIKGLNEEVTSK None None 14157 17.27 15.55 16.49 16.39 16.68 18.14 15.54 16.61 15.93 15.93 18.05 15.38 16.91 16.34 15.51 16.96 17.72 16.3 15.87 17.46 15.37 16.43 17.16 17.14 17.55 16.59 16.89 16.08 16.56 16.84 15.4 Q66H15 Rmdn3 3 106.1259451 311328 - 106.1259451 106.146571 regulator of microtubule dynamics protein 3 None LDFVLTSLMALRREVEELQR None 611873 34926 19.23 18.36 19.92 19.35 20.11 18.94 19.21 19.59 20.02 18.75 18.62 19.88 20.0 19.73 19.11 19.07 18.45 20.0 19.62 20.63 20.16 19.03 19.22 18.9 20.0 19.31 19.96 20.07 19.78 19.93 21.1 D3ZSC8 Dnajc17 3 106.1621981 311329 - 106.1621981 106.195711 dnaj homolog subfamily c member 17 None LEARERQAQAQGTEEEEESR None None 49527 15.46 14.25 15.97 16.29 16.12 15.5 15.74 15.81 16.96 14.85 16.39 15.24 16.32 16.09 17.18 16.86 15.45 16.26 16.14 15.07 15.12 15.15 16.08 15.05 16.51 15.65 17.0 16.13 14.81 16.41 17.21 Q499R6 Zfyve19 3 106.1959791 499871 + 106.1959791 106.203964 similar to zinc finger, fyve domain containing 19 None GGTRNQHTDSQGQASLEEEK None None 12435 18.22 16.16 17.85 17.76 17.56 17.62 17.41 18.45 17.73 15.8 18.45 16.6 17.71 17.05 17.76 17.34 17.57 17.72 16.24 17.62 16.86 17.61 18.11 17.48 18.45 17.91 16.65 16.92 19.05 17.93 17.67 B5DFJ4 Vps18 3 106.2794191 296083 + 106.2794191 106.290387 vacuolar protein sorting-associated protein 18 homolog None QLIPALVNYSQGGDAQQVSQAIR None None 13302 18.22 19.3 18.97 17.57 16.49 18.14 17.79 17.31 17.74 18.78 16.96 16.62 17.18 18.3 18.97 16.8 18.17 17.47 18.29 16.2 18.75 19.02 17.01 18.42 17.73 18.38 18.0 17.42 17.59 17.27 17.53 P61023 Chp1 3 106.536011 64152 + 106.536011 106.571246 calcineurin b homologous protein 1 None TRLYSRFTSLDKGENGTLSR None 606988 80488 19.72 17.33 18.96 19.63 18.88 18.36 18.89 19.09 18.16 19.91 19.5 17.35 19.16 18.71 19.19 19.09 19.52 17.99 18.11 18.93 17.51 18.44 19.29 18.94 19.52 19.25 18.42 18.8 19.27 19.5 18.8 F1LWG4 Ndufaf1 3 106.6395981 296086 - 106.6395981 106.650543 complex i intermediate-associated protein 30 None RTPEVSFDKAIRDEAMEHFR None 606934 32289 18.33 15.97 16.37 17.79 16.93 17.77 16.11 18.14 17.0 19.14 18.57 17.86 18.22 18.39 18.11 17.6 19.31 18.24 17.02 16.9 18.9 17.29 18.21 18.36 18.65 17.89 18.61 18.59 18.25 18.96 18.44 D3ZLH8 Rtf1 3 106.6594081 366169 + 106.6594081 106.71897 rtf1, paf1/rna polymerase ii complex component, homolog (s. cerevisiae) None SKSASDLSEDLFKVHDFDVK None 611633 133868 15.19 16.62 16.81 16.15 16.39 16.3 15.13 15.82 17.54 15.19 15.39 16.57 16.09 16.72 16.43 15.93 15.87 16.9 16.75 16.41 17.99 16.05 15.92 16.99 17.22 16.33 16.85 16.07 17.22 16.06 17.69 P17105 Itpka 3 106.7260371 81677 + 106.7260371 106.7346 inositol-trisphosphate 3-kinase a None PCVLDCKMGVRTYLEEELTK None 147521 1671 18.81 17.01 18.11 17.94 18.63 19.18 18.43 18.04 18.95 17.6 18.51 19.78 19.38 19.06 18.67 19.05 18.84 18.46 19.43 17.17 19.04 18.1 19.02 18.49 18.12 18.36 18.79 19.05 18.28 18.04 19.29 P55146 Tyro3 3 106.7781031 25232 + 106.7781031 106.797142 tyrosine-protein kinase receptor tyro3 None EEFLREAACMKEFDHPHVAK None 600341 4585 17.01 17.77 16.08 16.9 16.32 17.13 16.4 16.87 16.8 16.34 17.44 17.53 16.3 17.47 16.39 16.43 17.24 16.71 17.57 15.96 16.94 16.28 17.27 17.04 16.68 16.76 16.39 16.54 17.3 16.97 15.52 Q8R3Z7 Ehd4 3 107.0581921 192204 - 107.0581921 107.121985 eh-domain-containing 4 None NQVLKSISIIDSPGILSGEK None 605892 26430 19.2 16.61 19.15 17.59 18.07 15.71 18.7 18.45 17.77 18.05 18.73 17.58 18.23 18.23 18.6 16.46 17.8 17.99 18.85 16.63 18.72 18.79 17.37 18.14 17.52 18.04 18.04 18.3 16.6 18.69 18.82 F1LPY6 Pla2g4e 3 107.1324931 296091 - 107.1324931 107.174475 phospholipase a2 None PLPIYLTINVKDDVSNQDFR None None None 16.15 14.97 15.19 14.96 15.55 13.69 15.96 14.83 15.36 16.56 16.02 14.24 16.2 14.68 15.01 15.97 15.15 15.48 16.57 14.56 15.96 16.64 15.45 15.91 15.6 15.81 13.88 16.72 15.16 15.08 15.77 A0A0G2KA50 Vps39 3 107.2673111 362199 - 107.2673111 107.304906 vps39 subunit of hops complex None WKDREFHELQGDFSVPDVPK None 612188 41025 16.97 16.3 19.2 17.7 15.73 17.86 17.87 17.08 17.33 17.87 17.62 16.47 17.95 17.65 18.47 16.97 17.43 17.12 18.3 16.2 18.55 18.9 18.03 17.66 17.78 16.92 17.69 17.16 17.39 17.56 16.67 D4A017 Tmem87a 3 107.3118711 366170 - 107.3118711 107.353731 transmembrane protein 87a None LNITWFLKSADCYNEVYNFK None None 9165 16.59 14.02 14.83 15.82 15.33 15.28 16.18 15.32 15.58 16.04 16.55 16.44 16.72 15.63 16.58 16.49 15.72 15.75 17.65 15.18 16.77 17.33 16.43 15.56 16.21 17.13 16.67 16.13 15.76 16.46 16.36 D4A7G5 Ganc 3 107.353371 24382 + 107.353371 107.405241 glucosidase, alpha; neutral c None QELLRSKGRKLVVISDPHIK None None None 16.85 14.4 17.66 16.36 16.4 16.3 17.72 14.91 15.54 14.95 16.54 17.33 16.48 16.59 16.13 15.17 14.61 17.17 17.14 16.09 17.66 16.64 16.05 16.34 16.15 15.26 15.0 16.39 15.58 16.25 17.52 O70377 Snap23 3 107.5141461 64630 + 107.5141461 107.544321 synaptosomal-associated protein 23 None QDAGIKTITMLDEQGEQLNR None 602534 37857 20.31 18.24 20.42 19.75 20.42 20.33 20.36 18.94 20.38 19.47 20.57 20.88 20.39 20.43 19.19 19.56 20.78 19.22 19.3 21.04 20.55 19.63 20.49 19.05 18.87 19.06 19.97 19.44 21.06 20.67 20.26 Q5FVI3 Lrrc57 3 107.5500881 311346 - 107.5500881 107.553256 leucine-rich repeat-containing protein 57 None DELCNLKKLETLSLNNNHLR None None 11995 20.5 18.7 17.82 20.07 19.93 19.8 18.59 19.88 19.18 18.65 19.18 20.18 20.1 19.23 18.74 19.8 19.53 19.96 18.95 19.59 18.55 19.09 18.98 18.92 19.97 20.66 19.22 19.73 20.77 19.19 20.21 A0A0G2KBC0 Lrrc57 3 107.5515271 311346 - 107.5515271 107.553133 leucine-rich repeat-containing protein 57 None GALPPQLCSLRHLDVVDLSK None None 11995 20.59 19.79 17.92 20.14 20.02 19.92 18.59 20.0 19.24 18.71 19.27 20.27 19.9 19.29 19.0 19.89 19.53 20.08 18.96 19.66 18.56 19.16 18.69 19.26 20.06 20.73 19.27 19.77 20.81 19.01 20.27 M0R718 Rmdn3 3 106.126641 100911313 - 106.126641 106.135361 regulator of microtubule dynamics protein 3-like None TATALFESPLSATVQDALQSFLK None None None 18.33 16.98 18.75 18.32 19.23 17.6 17.94 18.85 18.91 17.74 17.36 18.75 18.9 18.39 18.17 18.22 17.49 18.54 18.47 19.54 18.51 17.69 18.25 18.31 18.87 18.27 18.98 18.65 18.55 18.85 19.87 A0A0G2JYZ1 Ttbk2 3 107.6973411 311349 - 107.6973411 107.802456 tau tubulin kinase 2 None TEPLDVSKTQNFSVVPNQDK None 611695 62795 17.2 17.05 15.89 16.35 17.09 17.9 15.16 16.73 15.77 17.39 17.71 16.31 15.95 17.16 17.01 16.69 18.21 16.42 15.83 16.1 15.61 17.4 16.94 17.0 17.35 16.87 17.88 16.95 16.75 16.95 15.92 D3ZQC6 Ubr1 3 107.8137221 499877 - 107.8137221 107.88844 e3 ubiquitin-protein ligase None PNKFLLLVLQRYELADAFNK None None None 16.66 16.61 18.39 17.22 17.58 17.51 18.21 17.64 18.49 17.31 16.73 18.68 18.77 18.13 18.45 17.26 16.38 18.41 18.03 18.6 19.22 18.45 18.35 18.04 17.51 17.84 17.82 18.83 16.6 18.22 18.08 B5DF57 Epb42 3 107.9782681 362202 - 107.9782681 107.997932 erythrocyte membrane protein band 4.2 None SQPLRGNGRLSVALINPTDK None None 93 16.54 14.99 15.52 16.46 16.04 15.52 18.11 17.56 16.26 16.81 18.42 15.94 16.32 17.62 14.94 15.99 16.93 17.27 16.61 16.59 16.5 15.56 16.47 16.42 16.51 16.73 15.97 16.43 15.3 17.01 16.98 D3ZVR0 Tubgcp4 3 108.1416431 362203 + 108.1416431 108.168668 gamma-tubulin complex component None PSLKQFSLRVEILPSYIPVR None None None 16.05 14.16 15.42 16.45 15.85 14.38 16.24 15.47 15.68 15.39 15.97 14.75 15.93 16.78 16.34 15.8 14.88 16.04 16.43 14.79 15.51 14.99 15.78 15.7 16.32 16.96 16.01 15.04 15.53 16.77 16.15 F1M842 Tp53bp1 3 108.1699491 296099 - 108.1699491 108.243058 tumor protein p53-binding protein 1 None DAFRSTPFIVPSSPTEQGQR None 605230 4137 17.44 15.77 18.56 18.16 16.88 16.84 17.26 17.01 16.92 16.93 17.03 17.29 17.78 17.68 17.64 16.48 18.27 17.53 16.86 17.94 18.93 18.21 17.98 17.87 18.6 18.16 18.4 17.7 16.2 18.33 18.29 A0A0G2K5C6 Map1a 3 108.2630491 25152 + 108.2630491 108.283456 microtubule-associated protein 1a None TEATQGLDYVPSAGTISPTSSLEEDK None 600178 1778 23.89 21.79 22.19 23.23 23.58 23.47 22.32 22.94 23.01 23.38 23.27 22.65 23.31 22.51 22.15 22.93 23.74 22.87 22.46 23.38 22.51 22.94 23.61 22.25 23.04 23.36 22.61 22.83 24.6 23.15 22.77 P34926 Map1a 3 108.2630491 25152 + 108.2630491 108.283456 microtubule-associated protein 1a None KAREQEKKYWKEQDVVQGWR None 600178 1778 23.89 21.78 22.18 23.23 23.57 23.46 22.32 22.94 23.02 23.39 23.26 22.64 23.31 22.5 22.22 22.93 23.76 22.88 22.45 23.3 22.49 22.95 23.6 22.3 23.04 23.37 22.59 22.81 24.63 23.15 22.78 D4ACM9 Ppip5k1 3 108.2841211 499878 - 108.2841211 108.456744 microfibrillar-associated protein 1a None ALEKEKAEIERMRNLTEEER None None None 16.54 16.81 17.75 17.17 17.32 17.28 16.26 16.97 17.99 16.05 16.92 18.01 17.33 17.86 18.0 16.64 17.57 17.55 16.82 17.84 19.07 17.43 17.28 17.91 17.99 17.26 18.28 16.24 18.27 17.86 18.86 P0C644 Ppip5k1 3 108.2841211 499878 - 108.2841211 108.456744 inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 None DGTDVKVYTVGPDYAHAEAR None None None 17.12 18.4 17.36 17.34 16.84 16.75 17.24 15.67 16.71 17.51 16.18 16.87 16.14 17.27 17.66 17.48 16.97 17.18 18.01 15.66 17.01 17.41 16.65 16.89 18.21 17.56 17.64 17.91 16.04 16.4 17.06 P25809 Ckmt1 3 108.3298651 29593 + 108.3298651 108.335762 creatine kinase u-type None AAGMARDWPDARGIWHNNEK None 123290 69058 21.26 23.96 22.04 22.69 22.92 20.79 21.84 23.07 22.15 23.03 22.49 21.03 22.14 21.84 21.97 22.73 22.2 21.84 22.48 22.46 21.54 21.68 22.19 21.95 23.37 22.66 21.37 22.14 24.13 21.42 21.8 Q5BJT9 Ckmt1 3 108.3298651 29593 + 108.3298651 108.335762 creatine kinase None ATGERRRLYPPSAEYPDLRK None 123290 69058 21.46 24.38 22.01 22.81 23.09 20.94 22.01 23.06 22.29 23.07 22.64 21.12 22.08 22.04 22.01 22.81 22.34 21.88 22.52 22.51 21.6 21.65 22.24 22.0 23.48 22.6 21.36 22.23 24.19 21.59 21.75 P11598 Pdia3 3 108.3882831 29468 + 108.3882831 108.41201 protein disulfide-isomerase a3 None EYDDNGEGITIFRPLHLANK None None 68454 23.07 20.78 22.5 22.01 22.26 20.66 22.3 22.99 21.01 22.59 22.82 21.34 22.59 21.28 22.79 21.8 21.44 21.88 21.85 21.51 20.86 21.67 21.49 22.93 21.75 21.06 21.84 21.83 20.11 22.27 22.07 F1M8A5 Hypk 3 108.4349991 311359 + 108.4349991 108.436151 huntingtin-interacting protein k None KVTIKKEDLELIMTEMEISR None 612784 9498 17.86 15.81 18.56 17.26 17.66 17.18 17.53 17.31 17.73 16.39 17.88 17.43 17.89 17.37 16.62 18.04 18.15 16.86 16.99 18.56 17.55 17.89 18.35 16.89 17.74 17.02 17.78 16.82 18.56 18.09 18.02 F1LT14 Frmd5 3 108.4945891 311362 - 108.4945891 108.537188 ferm domain-containing 5 None GSRFRYSGRVAKEVMESSAK None None 18206 15.99 13.98 15.03 15.77 17.23 16.05 16.6 16.28 16.99 15.87 15.93 16.55 16.43 16.35 16.91 15.89 15.88 14.88 16.89 15.3 15.21 15.48 16.19 15.56 15.65 15.52 15.56 16.25 16.9 16.98 16.73 D3ZW58 Casc4 3 108.8272711 362204 + 108.8272711 108.896152 golgi membrane protein 2 None SFQCGQQIKELRAQHEENIK None None 16310 17.96 15.3 16.94 18.41 16.48 15.71 18.06 16.86 16.69 17.44 18.34 17.22 18.07 17.73 16.4 17.38 18.23 17.8 17.31 17.43 17.43 18.23 17.73 16.73 17.31 17.91 16.89 17.53 17.9 18.02 17.75 Q5XIK8 Ctdspl2 3 108.9273291 311368 + 108.9273291 108.968785 ctd small phosphatase-like protein 2 None REHCVCVQGNYIKDLNILGR None None None 13.65 14.33 15.06 14.55 14.9 15.35 14.66 13.79 15.32 13.55 13.87 15.41 14.52 14.26 15.65 14.25 14.02 14.35 15.02 13.9 15.94 15.21 14.28 15.34 14.51 14.4 15.28 15.08 14.02 15.03 15.98 A0JPM9 Eif3j 3 108.9851041 691947 + 108.9851041 109.007338 eukaryotic translation initiation factor 3 subunit j None GGGTAGGDRWEGEDEDEDVK None 603910 37845 20.28 17.74 19.37 19.38 20.6 19.6 19.2 20.3 20.1 18.75 20.95 19.61 20.51 19.4 18.95 19.9 19.66 20.73 19.12 20.78 19.88 19.57 20.31 20.89 20.96 20.29 19.91 19.43 19.79 20.39 20.28 A0A0G2JZP7 Spg11 3 109.0081361 311372 - 109.0081361 109.07362 spg11 vesicle-trafficking-associated, spatacsin None CLQELQKNKETSDFFEILHR None None None 15.72 13.66 16.03 15.38 15.03 15.51 15.09 15.2 15.6 14.51 16.39 16.29 16.09 16.96 16.84 14.83 16.47 15.77 15.27 15.14 17.16 16.07 16.63 16.08 17.18 15.87 15.58 16.01 16.5 16.03 15.62 P07151 B2m 3 109.0957411 24223 + 109.0957411 109.101762 beta-2-microglobulin None LLKNGKKIPNIEMSDLSFSK None 109700 2987 17.55 15.13 16.23 16.37 17.47 18.36 16.62 15.74 15.49 17.76 16.09 17.31 16.75 16.64 17.14 17.5 16.36 16.97 17.39 16.42 17.26 16.05 17.1 17.47 17.57 16.64 17.32 16.43 16.4 17.53 17.28 P27867 Sord 3 109.1850751 24788 + 109.1850751 109.216131 sorbitol dehydrogenase None DFVVKKPMVLGHEAAGTVTK None 182500 56080 19.02 20.98 19.28 18.77 20.48 20.39 20.0 20.71 18.86 18.76 21.22 19.02 18.92 19.3 18.92 19.4 20.45 19.04 18.82 21.11 19.14 19.59 19.37 19.14 20.45 20.01 20.32 19.07 19.64 20.58 18.98 F1M4K0 Shf 3 109.296481 362205 - 109.296481 109.316012 src homology 2 domain-containing f None DQPWEWKKERISKAFAVDIK None None 31430 14.45 15.29 14.81 14.98 15.86 15.46 15.05 15.42 16.43 15.48 14.73 16.7 16.22 15.97 15.88 15.1 14.54 15.86 16.93 14.68 16.77 15.15 15.55 14.27 14.43 15.57 16.05 16.17 16.37 15.38 16.21 P50442 Gatm 3 109.6589121 81660 - 109.6589121 109.675763 glycine amidinotransferase None ILSMEGVTVKRPDPIDWSLK None 602360 1136 15.94 18.4 16.73 17.04 17.33 17.62 17.66 17.07 17.67 17.71 16.98 17.88 16.81 16.07 15.69 17.78 16.42 18.26 17.85 17.6 18.3 16.91 17.73 16.97 15.72 16.78 17.92 15.92 17.27 16.88 16.38 B0BMT9 Sqor 3 109.8466511 691966 + 109.8466511 109.885686 sqrdl protein None ALGTIFGVKKYADALQEIIR None None 10921 16.85 15.99 16.18 16.54 17.33 17.03 17.03 17.86 16.53 15.45 17.68 16.16 17.06 15.84 17.0 17.52 18.18 15.74 16.47 17.08 15.51 17.22 16.94 15.77 17.77 17.48 18.07 15.68 17.34 17.58 17.3 A0A0G2JZC4 Sema6d 3 111.8838451 311384 + 111.8838451 111.94109 semaphorin 6d None SRNTLNDLLKHLNDPNSNAK None None 16195 16.14 16.55 16.03 16.08 16.28 13.93 15.76 16.65 15.15 16.39 16.35 14.78 15.7 14.2 14.87 16.27 15.44 15.96 14.84 15.97 14.23 14.98 14.39 14.75 15.83 14.89 16.51 14.95 15.54 16.18 14.29 A0A0G2K402 Myef2 3 112.3391341 679712 - 112.3391341 112.374099 myelin expression factor 2 None PRSSANGVKMENDESVKEEK None None 69079 18.84 20.65 19.59 19.45 19.54 18.31 18.28 19.49 20.42 19.44 18.21 19.59 19.18 19.62 20.55 19.02 19.57 19.57 20.39 18.26 20.89 19.51 18.9 20.44 19.98 19.86 20.53 18.71 19.94 19.18 20.93 D4AEI5 Myef2 3 112.3391341 679712 - 112.3391341 112.374099 myelin expression factor 2 None PMGSGMRDRLGSKGNQIFVR None None 69079 19.03 21.19 19.73 19.59 19.6 18.65 18.4 19.55 20.68 19.63 18.23 19.58 19.22 19.78 20.71 19.07 19.66 19.74 20.53 18.39 21.14 19.67 18.95 20.58 20.09 20.03 20.66 18.85 20.07 19.27 20.78 P70583 Dut 3 112.498991 497778 + 112.498991 112.509991 deoxyuridine 5'-triphosphate nucleotidohydrolase None CERILYPDLEEVQTLDNTER None 601266 31475 16.71 15.58 17.57 16.85 15.14 15.57 16.76 14.83 15.44 15.34 15.38 17.29 16.55 16.88 16.58 15.07 14.73 16.8 16.94 14.81 17.38 15.57 14.74 16.55 15.56 15.01 14.69 16.86 14.91 15.16 17.0 D4A7V0 Secisbp2l 3 112.9901091 296115 - 112.9901091 113.03577 secis-binding protein 2-like None DGFQELSESGNSKDETIQQK None None None 15.53 13.14 15.19 16.03 15.56 15.31 13.89 13.68 16.1 14.52 16.09 15.04 15.72 15.7 14.84 15.46 17.01 14.96 14.21 14.9 14.89 14.49 15.69 15.56 15.13 15.4 15.79 14.97 16.15 15.81 15.53 P61203 Cops2 3 113.0841871 261736 - 113.0841871 113.110156 cop9 signalosome complex subunit 2 None ELNIDVADVESLLVQCILDNTIHGR None 604508 3124 20.11 18.26 20.62 18.98 18.94 20.08 19.32 19.69 20.29 20.75 20.3 19.37 20.52 20.39 19.42 18.72 20.65 19.48 19.58 20.92 20.76 20.82 19.98 20.22 18.19 19.15 21.2 19.49 18.92 20.29 20.76 Q5XIG6 Galk2 3 113.1098041 296117 + 113.1098041 113.233302 n-acetylgalactosamine kinase None QVCEAAPDNAVQLLGELMNQSHR None 137028 13654 15.76 14.0 15.53 15.19 15.08 16.76 16.17 16.84 16.41 16.49 15.76 16.56 15.8 15.0 15.45 16.29 16.46 15.48 16.47 15.79 16.84 16.49 16.14 15.32 14.63 15.51 16.78 15.25 15.69 16.65 16.41 P97524 Slc27a2 3 113.8047291 65192 + 113.8047291 113.842208 very long-chain acyl-coa synthetase None FNSGDLLMIDRENFIYFHDR None 603247 37830 16.11 13.68 16.97 16.67 15.3 14.52 14.91 14.49 15.3 15.43 15.13 14.97 15.81 15.4 16.46 14.63 14.23 16.07 15.72 14.93 16.25 15.77 15.3 15.87 15.52 15.09 15.61 16.4 14.32 15.31 16.26 D3ZN39 Usp8 3 113.962161 296121 + 113.962161 114.009661 ubiquitin specific protease 8 None RRPAVTPTVNRENKPPCYPK None None 3782 18.75 16.25 18.19 18.76 19.06 17.8 19.61 18.96 17.54 17.14 18.51 17.6 18.91 17.93 17.46 18.32 18.19 18.6 18.8 18.97 17.28 17.51 18.63 17.78 19.72 19.35 18.35 18.39 16.97 18.89 18.37 D3ZX21 Ap4e1 3 114.2729611 311404 + 114.2729611 114.336895 ap-4 complex subunit epsilon None GAAPYKPRHQRQEEQLSQEK None None None 15.11 12.7 16.43 14.66 15.44 14.84 15.88 14.2 14.79 14.79 15.29 14.5 14.79 13.64 14.77 14.66 13.76 15.34 15.79 13.99 14.83 14.68 15.21 14.33 14.16 13.58 14.17 14.8 14.69 14.72 14.91 P46844 Blvra 3 114.3495661 116599 + 114.3495661 114.366046 biliverdin reductase a None RDLKDPRSAAFLNLIGFVSR None 109750 572 19.56 21.47 18.8 19.31 20.44 20.2 21.15 21.16 19.64 19.39 20.57 18.62 19.35 18.84 19.26 20.89 20.87 19.48 19.55 20.34 18.44 20.09 19.77 18.8 20.7 21.49 20.99 19.29 19.27 19.78 19.87 Q6AZ33 Blvra 3 114.3495661 116599 + 114.3495661 114.366046 biliverdin reductase a None GRVLHEEHVELLMEEFEFLR None 109750 572 19.56 21.47 18.8 19.31 20.44 20.19 21.14 21.16 19.64 19.39 20.57 18.62 19.35 18.85 19.26 20.9 20.87 19.48 19.55 20.34 18.43 20.09 19.77 18.75 20.7 21.49 21.0 19.27 19.36 19.78 19.87 F1LNJ2 Snrnp200 3 114.4288291 296126 + 114.4288291 114.458182 u5 small nuclear ribonucleoprotein 200 kda helicase None IIYIAPMRSLVQEMVGSFGK None 601664 None 18.8 18.42 19.51 18.92 19.04 18.54 17.74 19.03 19.76 18.12 18.45 19.62 19.06 19.33 19.84 18.45 18.83 19.11 18.95 19.58 20.8 19.28 18.81 19.8 20.09 18.69 20.12 18.25 19.9 19.31 20.91 Q5M7T1 Ciao1 3 114.4603231 29231 - 114.4603231 114.466615 probable cytosolic iron-sulfur protein assembly protein ciao1 None DALVLQSRVPAHPDSRCWFL None 604333 55850 14.64 15.36 15.29 16.08 15.8 16.15 15.97 15.35 16.43 16.57 15.4 16.58 16.3 16.52 17.01 15.3 15.29 16.5 15.22 15.74 17.71 15.55 16.61 17.15 14.54 15.98 14.98 16.35 14.94 16.05 15.84 A0A0G2JWY8 Stard7 3 114.487171 296128 + 114.487171 114.515869 star-related lipid transfer domain-containing 7 None FFNVQLDTEYRKKWDALVIK None None 32463 17.59 17.21 17.02 15.88 16.83 16.59 16.17 15.91 15.37 15.48 17.22 16.74 15.84 17.0 15.69 16.49 16.72 17.29 15.38 16.62 16.83 15.59 15.64 16.72 17.49 16.27 15.49 16.79 17.07 15.78 15.98 B2RYW9 Fahd2a 3 114.6563261 296131 - 114.6563261 114.665325 fumarylacetoacetate hydrolase domain-containing protein 2 None ADHCQEQNVRVPKNPIIFSK None None 9357 21.33 22.38 20.93 20.81 20.03 19.66 20.62 20.6 20.78 21.55 19.81 20.47 20.39 21.99 19.77 19.73 19.45 21.67 20.77 21.87 21.63 19.98 20.01 21.33 21.34 20.53 19.84 21.46 20.01 20.29 20.74 Q9JM47 Kcnip3 3 114.6778831 65199 - 114.6778831 114.742232 calsenilin None LYDINKDGYITKEEMLAIMK None 604662 8382 17.62 14.98 16.67 17.84 16.19 15.55 16.14 15.81 17.07 14.99 16.54 17.6 17.35 17.05 17.11 15.97 15.41 17.41 17.81 15.65 17.95 16.07 16.16 16.63 16.77 17.37 15.77 17.9 16.87 16.36 17.43 D3ZYT2 Mrps5 3 114.8210071 296134 + 114.8210071 114.837291 mitochondrial ribosomal protein s5 None WPGLNVPLIKSGVVQNIGQR None 611972 32726 16.75 18.75 17.35 18.32 17.09 16.71 16.64 15.61 18.46 17.64 17.21 17.55 16.89 17.44 18.92 16.24 16.4 16.48 16.79 16.34 18.12 16.19 15.83 17.72 15.67 15.9 17.39 15.55 17.87 16.53 17.62 D4A5D3 Bub1 3 115.0203451 296137 - 115.0203451 115.05165 bub1 mitotic checkpoint serine/threonine kinase None DLGQSIDMKLFPKGTVFTGK None 602452 37910 20.76 18.92 20.4 18.14 18.94 19.89 19.52 19.4 19.99 20.6 19.7 18.51 18.87 20.32 19.57 18.31 18.84 20.68 19.88 18.52 20.44 20.43 19.5 17.99 19.67 17.81 18.97 20.27 20.47 19.44 19.63 F1M801 Anapc1 3 115.8501861 311412 - 115.8501861 115.930239 anaphase-promoting complex subunit 1 None LETLPFGIALPIRDAIYHCR None None 7414 16.13 15.7 17.55 17.12 16.21 16.02 16.79 16.67 16.46 17.17 16.84 16.44 16.11 17.34 18.25 16.24 17.21 16.41 16.81 15.87 17.99 17.42 17.35 16.54 17.77 16.29 17.7 16.5 17.17 18.08 18.27 P57097 Mertk 3 115.9392411 65037 + 115.9392411 116.046653 tyrosine-protein kinase mer None RNCMLRDDMTVCVADFGLSK None 604705 4626 16.95 15.35 17.29 16.73 17.03 16.69 16.94 16.63 17.41 16.27 17.06 18.57 17.54 17.94 17.25 16.26 17.47 16.97 18.43 15.66 18.67 16.65 17.7 16.7 16.53 17.08 17.16 18.27 16.69 17.59 18.02 D3ZZM8 Mthfd1 3 116.1958381 680432 + 116.1958381 116.198727 c-1-tetrahydrofolate synthase, cytoplasmic None GLAILQVGDRDDSNLYINVK None None None 20.06 18.75 18.9 19.37 20.17 19.44 20.04 19.74 18.93 18.64 19.16 19.44 19.75 18.74 19.74 20.15 19.51 19.46 20.58 18.59 18.39 19.89 19.1 19.01 20.75 19.99 20.49 20.09 18.08 20.25 20.52 G3V8C8 Ttl 3 116.2988281 171572 + 116.2988281 116.326005 tubulin tyrosine ligase None REGVLRTASEPYHVDNFQDK None 608291 32678 16.62 14.65 14.26 16.53 15.57 15.27 16.04 15.44 15.3 15.43 15.92 16.51 16.35 15.9 14.33 15.09 15.81 16.62 16.47 15.0 15.93 15.32 15.38 15.68 15.53 16.01 15.25 16.59 14.87 15.17 15.93 Q9QXJ0 Ttl 3 116.2988281 171572 + 116.2988281 116.326005 tubulin--tyrosine ligase None QVHVIQKYLEHPLLLEPGHR None 608291 32678 16.53 14.31 14.25 16.38 15.78 15.55 15.95 15.36 15.27 15.41 15.92 16.34 16.27 15.97 14.92 14.7 15.12 16.44 16.55 14.52 15.6 14.86 15.43 15.59 15.4 15.68 15.16 16.5 14.79 15.24 15.72 Q9JJP0 Slc20a1 3 116.4277431 81826 + 116.4277431 116.441062 sodium-dependent phosphate transporter 1 None VGICMGLWVWGRRVIQTMGK None 137570 38049 17.9 15.56 17.36 18.49 18.03 16.59 16.49 18.28 18.33 16.83 18.15 19.09 18.03 17.81 18.91 16.57 16.97 16.85 18.55 16.61 18.09 17.22 18.24 17.53 17.58 17.18 17.78 18.35 17.98 18.04 18.23 P97710 Sirpa 3 116.8197271 25528 + 116.8197271 116.858098 tyrosine-protein phosphatase non-receptor type substrate 1 None APRVPEPNNHTEYASIETGK None None 7246 20.84 20.37 20.83 20.73 20.47 20.9 20.34 20.33 21.24 20.51 19.76 21.82 21.21 21.86 20.51 20.62 21.1 20.47 20.99 21.1 21.42 20.7 21.18 20.54 20.55 21.46 19.92 21.07 22.45 21.22 21.28 Q499T3 Sirpa 3 116.8197271 25528 + 116.8197271 116.858098 sirpa protein None RGSPGQTVNFTCKSYGFSPR None None 7246 20.8 20.59 20.82 20.71 20.48 20.88 20.55 20.33 21.24 20.53 19.73 21.78 21.18 21.84 20.86 20.62 20.97 20.45 20.72 20.96 21.44 20.7 21.13 20.73 20.59 21.49 19.46 21.09 22.35 21.18 21.25 F1M7S3 Pdyn 3 116.9009931 29190 - 116.9009931 116.913334 alpha-neoendorphin None EPLLKELEKGQLLTSVSEEK None 131340 10321 16.94 16.71 17.28 16.26 16.36 16.52 16.61 16.33 17.12 16.28 16.45 15.07 16.05 15.62 15.6 16.62 17.12 15.22 15.74 17.72 14.97 17.31 15.76 15.28 15.49 16.79 17.35 15.91 16.39 16.55 15.77 P06300 Pdyn 3 116.9009931 29190 - 116.9009931 116.913334 proenkephalin-b None EPLLKELEKGQLLTSVSEEK None 131340 10321 17.09 17.13 17.46 16.44 16.54 16.71 16.8 16.51 17.31 16.46 16.63 15.26 16.18 15.81 16.08 16.8 17.1 15.77 16.01 17.72 15.16 17.5 15.92 15.47 15.68 16.98 17.54 16.1 16.58 16.72 15.91 P17136 Snrpb 3 117.3715461 171365 - 117.3715461 117.379344 small nuclear ribonucleoprotein-associated protein b None FKAFDKHMNLILCDCDEFRK None None 68297 16.77 18.72 18.71 18.48 18.32 17.56 16.83 17.7 17.91 16.65 18.4 18.69 17.9 18.86 18.43 17.52 17.93 17.82 18.64 18.93 19.59 18.19 18.1 18.81 19.21 18.28 18.7 17.45 19.36 18.86 19.33 Q4KLK7 Nop56 3 117.4770541 362214 + 117.4770541 117.481839 nop56 ribonucleoprotein None SEGVVHEDLRLLLETYLPSK None None None 15.33 17.53 18.2 16.91 15.74 16.48 15.67 17.27 17.69 17.81 17.29 16.78 16.37 17.57 17.78 16.25 17.13 15.95 17.92 17.1 19.0 17.61 17.27 18.03 16.24 17.38 17.93 16.53 17.16 17.26 18.13 Q68FX0 Idh3b 3 117.4818461 94173 - 117.4818461 117.486865 isocitrate dehydrogenase [nad] subunit beta None SYDMQLRRKLDLFANVVHVK None 604526 5035 20.65 21.2 19.67 21.42 21.26 19.69 21.63 21.27 20.03 19.79 19.69 20.24 20.91 19.53 21.28 21.35 20.24 20.02 20.31 20.73 19.29 19.73 19.45 19.72 21.56 22.01 21.14 20.58 19.49 19.94 21.98 Q642A9 Vps16 3 117.6225961 296159 + 117.6225961 117.644037 vacuolar protein sorting-associated protein 16 homolog None VLNAIRDYHIGIPLTYTQYK None None 7116 17.37 18.91 17.45 18.08 16.19 16.85 17.31 16.98 16.9 17.93 16.74 17.32 16.86 18.25 18.28 16.26 17.69 17.43 18.32 15.89 18.56 18.11 17.08 18.15 18.07 18.68 17.71 17.06 17.51 16.96 17.45 A0A0G2JVR0 Ptpra 3 117.6501841 25167 + 117.6501841 117.760022 receptor-type tyrosine-protein phosphatase alpha None KKEEECESYTVRDLLVTNTR None 176884 20621 19.22 16.72 18.59 17.91 17.84 19.14 18.84 17.49 18.59 17.45 19.26 20.0 19.03 19.83 17.29 19.12 19.33 18.99 18.14 19.51 19.87 18.32 18.72 17.7 18.87 18.05 19.56 19.13 17.47 19.16 19.26 Q03348 Ptpra 3 117.6501841 25167 + 117.6501841 117.760022 receptor-type tyrosine-protein phosphatase alpha None ASFINGYQEKNKFIAAQGPK None 176884 20621 19.52 16.96 18.96 17.8 17.86 18.69 18.27 17.36 17.58 19.01 17.75 18.96 18.84 19.65 17.12 19.04 19.07 18.75 18.38 19.48 19.7 18.13 18.27 17.86 18.91 18.65 19.57 19.36 17.57 18.74 19.42 Q66HJ7 Ptpra 3 117.6501841 25167 + 117.6501841 117.760022 receptor-type tyrosine-protein phosphatase alpha None QIRQFHFHGWPEVGIPSDGK None 176884 20621 19.18 16.71 18.45 18.0 17.91 19.2 18.83 17.43 18.63 17.58 19.19 20.08 19.06 19.82 17.88 19.1 19.59 18.95 17.54 19.68 19.82 18.21 18.8 17.58 18.85 18.07 19.64 18.99 17.63 19.16 19.24 Q9EPJ3 Mrps26 3 117.7692211 362216 + 117.7692211 117.770883 28s ribosomal protein s26 None NFITRENLEARIEEALDSPK None 611988 12778 16.96 18.8 16.43 16.78 17.43 15.96 17.4 15.45 17.76 17.92 17.67 16.65 17.32 17.66 18.13 16.65 16.55 16.65 16.27 18.15 18.38 16.71 15.47 16.21 16.74 17.37 17.01 15.99 18.54 17.12 16.79 P01186 Avp 3 117.7934581 24221 - 117.7934581 117.795425 vasopressin-neurophysin 2-copeptin None CYFQNCPRGGKRATSDMELR None 192340 417 14.41 14.49 14.94 15.24 14.42 14.37 15.56 15.12 14.44 15.3 15.27 14.66 15.89 15.2 14.54 14.39 14.81 14.76 14.69 16.4 14.74 16.04 14.6 14.38 14.27 15.93 15.31 14.93 14.2 15.79 14.65 G3V8V8 Lzts3 3 117.8517031 280670 - 117.8517031 117.855486 leucine zipper putative tumor suppressor 3 None IGTPGYSSGGGGGGSGYQDLGTSDSGR None None None 17.97 16.76 16.75 17.21 17.14 18.05 16.83 16.87 18.39 17.28 17.76 17.46 17.44 18.33 17.26 17.68 18.76 16.99 17.56 16.18 17.71 17.45 18.23 18.01 16.92 17.29 17.39 16.76 18.28 17.28 17.07 Q8K1Q4 Lzts3 3 117.8517031 280670 - 117.8517031 117.855486 leucine zipper putative tumor suppressor 3 None RMEETKWEVCQKAGEISLLK None None None 17.55 18.17 16.69 17.12 17.04 18.03 16.65 16.56 18.31 17.14 17.63 17.29 17.06 18.24 17.08 17.65 18.48 17.34 17.41 16.08 17.62 17.32 17.66 17.96 16.79 17.26 17.33 16.62 18.18 16.72 16.88 D3ZAS9 Ddrgk1 3 117.8714251 296162 - 117.8714251 117.88268 ddrgk domain-containing protein 1 None INRIQDLLTEGTLTGVIDDR None None 11400 17.12 16.17 18.07 16.61 16.72 18.3 17.0 16.28 16.19 16.68 18.27 16.21 17.37 17.21 15.71 17.03 18.21 17.55 16.96 17.23 18.43 17.09 17.42 16.83 17.1 17.38 16.35 17.43 18.18 17.57 16.5 D3ZW55 Itpa 3 117.8854621 311422 + 117.8854621 117.89725 inosine triphosphate pyrophosphatase None FLQKLKPEGLYQLLAGFEDK None 147520 6289 19.47 19.43 18.9 18.63 18.66 20.61 20.11 18.23 17.79 18.49 20.08 19.25 18.67 19.11 18.65 19.7 18.11 19.58 19.73 18.15 18.07 19.4 19.07 18.7 19.42 18.01 18.97 19.38 17.28 18.52 17.84 D3ZVN5 Rgd1565616 3 117.9216211 499891 - 117.9216211 118.05263 rcg26366 None CSRTYFFGATHVPYLGDDEK None None 12623 16.8 14.12 15.08 16.02 16.03 15.14 14.69 16.17 14.84 14.71 15.58 16.24 15.35 16.48 15.47 14.76 15.96 14.74 16.0 14.83 15.65 14.77 15.93 16.39 17.39 15.65 15.53 16.26 14.56 16.02 16.25 Q99J86 Atrn 3 118.1103211 83526 + 118.1103211 118.244322 attractin None CNPGTGQCVCPTGWVGEQCQHCGGR None 603130 22542 16.55 15.92 17.01 16.81 17.47 17.84 17.19 17.23 18.21 18.06 17.22 18.3 18.36 18.29 17.42 16.84 17.86 17.12 16.56 19.18 18.39 17.78 18.37 17.62 15.9 17.29 17.03 16.91 18.81 17.72 17.33 D3ZVM5 Hspa12b 3 118.3463711 311427 + 118.3463711 118.363788 heat shock protein family a (hsp70) member 12b None TQESCGIAPLTPSQSPKPEVR None 610702 41749 18.03 19.44 17.43 18.34 18.46 16.56 18.0 19.23 17.81 18.18 17.72 15.89 16.93 16.74 16.99 18.04 18.56 17.96 18.12 16.84 16.73 16.88 16.94 18.2 18.05 18.84 17.81 17.09 17.22 16.96 17.75 Q4KM45 Rgd1311739 3 118.3647321 311428 - 118.3647321 118.378829 upf0687 protein c20orf27 homolog None AVRRLSKDIREAPVHSLHLK None None 41660 18.19 16.42 17.53 17.53 17.82 16.4 17.64 17.97 16.52 18.51 15.64 16.52 17.39 17.11 15.64 17.14 16.64 18.2 16.75 17.98 15.92 16.35 16.84 17.26 17.27 17.3 17.74 16.59 16.08 17.45 16.47 Q66HG9 Mavs 3 118.4517151 311430 + 118.4517151 118.466089 mitochondrial antiviral-signaling protein None SALSAKTTLSSSSTGSAFAK None 609676 None 17.04 14.88 17.65 17.9 16.16 15.63 15.98 15.81 15.71 17.38 15.58 17.4 17.37 17.8 17.48 15.67 15.67 17.86 17.25 15.41 17.67 16.01 17.46 17.87 17.8 15.72 15.75 17.9 16.06 16.91 17.66 F1LT70 Pank2 3 118.4834751 296167 + 118.4834751 118.51832 pantothenate kinase 2 None GTLVKLVYFEPKDITAEEEK None 606157 41235 17.35 14.98 16.98 18.44 16.37 17.44 18.52 17.68 17.28 15.52 17.14 17.3 17.39 17.15 18.3 16.13 16.41 17.25 17.33 16.15 17.81 16.23 17.42 16.37 16.72 18.01 16.24 17.53 16.69 17.39 17.69 P13852 Prnp 3 119.1861691 24686 + 119.1861691 119.201509 major prion protein None TDVKMMERVVEQMCVTQYQK None 176640 7904 20.09 18.34 20.38 20.04 18.85 19.29 19.91 18.92 19.28 20.73 18.4 18.69 19.77 19.78 18.85 19.44 18.82 20.58 19.9 19.86 20.67 19.38 20.07 19.71 18.81 20.3 18.24 19.85 20.06 20.01 19.6 Q3B7D5 Rassf2 3 119.2458221 311437 - 119.2458221 119.280431 ras association domain-containing protein 2 None KFEMPVLKSFIQKLQEEEDR None None None 14.3 14.11 14.49 15.09 14.65 14.35 15.34 14.46 14.54 13.94 15.31 14.55 14.82 15.02 15.66 14.97 15.06 15.39 14.98 13.86 14.9 16.28 14.9 14.79 16.43 15.9 16.07 14.65 13.64 15.15 15.47 Q9WTW8 Slc23a2 3 119.3026531 50622 - 119.3026531 119.39091 solute carrier family 23 member 2 None YYACARLSCAPPPPIHAINR None 603791 68440 15.64 18.09 17.26 15.78 16.86 16.73 17.19 17.45 16.49 16.05 17.05 17.1 16.07 17.54 16.07 15.37 17.28 16.46 17.59 15.92 17.58 16.3 16.57 15.68 17.37 17.43 16.56 16.64 17.49 16.46 16.72 Q5BJP5 Tmem230 3 119.4892021 681315 - 119.4892021 119.497557 transmembrane protein 230 None KVKYSRLSSTDDGYIDLQFK None None None 17.25 14.94 17.72 16.92 15.68 16.2 15.35 15.36 15.77 16.73 15.63 15.05 16.99 16.95 15.86 14.81 14.8 17.28 17.12 16.05 17.28 16.12 16.61 17.57 16.56 16.24 15.12 16.94 16.35 16.3 15.95 P04961 Pcna 3 119.499041 25737 - 119.499041 119.502911 proliferating cell nuclear antigen None CAKDGVKFSASGELGNGNIK None 176740 1945 15.66 17.93 15.9 15.32 16.23 16.48 15.82 16.14 15.48 14.64 17.01 16.34 16.05 16.1 16.34 15.02 15.84 17.2 15.37 15.96 17.04 16.29 15.7 15.11 16.37 14.96 16.31 16.27 16.0 15.27 16.35 Q91XU8 Cds2 3 119.5149621 114101 + 119.5149621 119.553546 phosphatidate cytidylyltransferase 2 None AVREDAPPEDKESESEAKLD None 603549 37854 20.08 17.89 20.55 19.56 18.86 19.8 20.38 18.97 20.02 19.42 19.92 19.44 20.32 20.31 20.52 19.58 20.7 19.47 19.76 18.48 20.98 20.43 20.28 18.97 19.7 19.79 19.85 19.81 20.13 20.46 20.31 Q80VJ4 Gpcpd1 3 119.7880031 362219 - 119.7880031 119.832462 glycerophosphocholine phosphodiesterase gpcpd1 None VELFEIPVKELTFDQLQLLK None None None 19.36 18.33 17.36 17.4 19.51 18.66 18.66 18.58 18.06 18.43 18.44 18.54 17.36 17.97 17.88 18.27 17.68 19.09 18.95 16.99 18.67 17.09 17.6 17.37 18.83 17.01 18.41 19.15 16.99 17.72 18.39 O35314 Chgb 3 120.0438251 24259 + 120.0438251 120.057162 secretogranin-1 None GRQHRGRGREPGAYPALDSR None 118920 1375 18.85 18.55 19.69 18.71 18.24 18.78 19.26 18.72 17.77 19.17 18.78 19.23 20.36 18.94 18.7 19.21 19.79 18.62 17.82 20.32 18.93 20.66 18.52 18.28 18.51 20.5 20.01 19.4 18.61 19.18 19.27 D3ZVK3 Trmt6 3 120.0749031 311441 - 120.0749031 120.086625 trna (adenine(58)-n(1))-methyltransferase non-catalytic subunit trm6 None SSGGSLQLRKKLEEPTSETK None None 6816 15.81 14.79 15.06 15.36 17.15 17.17 16.5 15.28 15.94 15.35 14.83 16.43 16.58 15.81 14.75 16.8 15.74 16.17 15.93 17.5 15.9 15.86 15.54 14.9 17.13 17.27 15.32 16.8 16.5 16.26 17.67 G3V912 Tmx4 3 121.8562621 296182 - 121.8562621 121.899641 thioredoxin domain containing 13 None EPGLSGRFFVTTLPAFFHAK None None None 18.89 17.07 18.35 19.23 18.51 17.31 18.28 17.63 19.55 19.58 18.85 18.72 18.94 18.39 19.42 17.82 18.0 18.17 19.29 19.31 19.99 20.03 19.1 17.64 18.83 18.36 19.67 19.43 18.62 19.38 19.21 P10687 Plcb1 3 122.4915331 24654 + 122.4915331 122.771268 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 None WEEEPIVFKKVVLPSLACLR None 607120 22876 21.41 20.87 20.17 20.89 20.46 21.45 20.84 20.46 20.88 20.83 20.79 21.14 20.85 21.26 19.46 20.95 21.08 21.4 21.09 20.99 21.08 20.98 21.34 20.27 20.55 21.39 20.58 21.28 21.29 20.65 20.27 D4A8C5 Plcb4 3 123.1070681 25031 + 123.1070681 123.322419 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase None EDQEPIITHGKAMCTDILFK None 600810 8471 18.63 18.12 19.14 18.45 19.05 18.23 19.55 18.73 19.57 18.94 18.61 19.3 19.24 19.65 19.76 17.95 17.7 18.89 18.89 19.92 20.06 18.91 18.09 17.84 18.25 18.24 20.23 18.03 18.84 19.32 20.68 Q9QW07 Plcb4 3 123.1070681 25031 + 123.1070681 123.322419 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 None PKILAALESVGKSENDLEGR None 600810 8471 18.6 18.23 19.12 18.44 19.05 18.25 19.58 18.71 19.55 18.99 18.62 19.27 19.22 19.64 19.8 17.93 17.73 18.83 18.88 19.92 20.09 18.91 18.06 17.84 18.26 18.24 20.22 18.03 18.85 19.31 20.7 Q5PPI4 Lamp5 3 123.3722531 362220 + 123.3722531 123.384974 lysosome-associated membrane glycoprotein 5 None QFVYDSSEKTHFKDAVSAGK None None None 20.41 18.89 19.17 19.18 19.48 18.55 18.76 19.43 18.61 18.18 20.04 17.44 18.29 18.0 18.33 18.85 18.82 17.81 17.88 20.34 16.94 19.2 18.17 18.75 18.85 18.87 18.33 18.47 19.02 18.76 18.58 D4A280 Pak7 3 123.3961971 311450 - 123.3961971 123.70393 serine/threonine-protein kinase pak 5 None MFGKKKKKIEISGPSNFEHR None None None 16.95 17.68 15.45 15.79 15.94 16.36 16.54 15.51 16.93 16.2 16.05 17.46 16.3 17.09 15.79 16.27 16.89 16.42 17.29 16.08 17.65 16.61 16.14 16.79 15.88 16.99 15.48 16.95 16.53 15.33 16.34 F8WG75 Snap25 3 123.9459741 + 123.9459741 124.123744 synaptosomal-associated protein None IEEGMDQINKDMKEAEKNLT None None None 21.97 21.79 22.34 21.83 22.28 21.87 21.2 21.29 22.95 21.9 21.29 21.51 21.85 22.41 20.58 21.04 22.7 21.24 21.59 22.74 21.88 21.68 22.42 21.49 21.4 21.87 21.36 21.3 23.71 22.46 21.79 P60881 Snap25 3 123.9459741 25012 + 123.9459741 124.123744 synaptosomal-associated protein 25 None EEMQRRADQLADESLESTRR None 600322 13311 22.37 21.76 22.48 21.99 22.62 22.85 21.59 21.13 23.26 22.34 21.55 22.37 22.33 22.69 21.09 22.1 23.21 21.52 21.91 23.14 22.62 22.06 22.88 21.93 21.61 22.25 21.87 21.62 24.1 22.91 22.28 D3ZWV2 Gapdh 3 126.3101871 + 126.3101871 126.311187 glyceraldehyde-3-phosphate dehydrogenase None VNGFGRIGRLVTRAAFSCDK None None None 26.02 23.57 24.92 24.32 25.41 26.2 25.82 25.97 24.36 24.12 25.54 26.4 25.42 26.26 24.69 23.85 25.58 25.57 25.1 25.23 25.13 26.03 25.97 24.91 26.0 25.24 24.94 26.32 24.46 26.45 25.2 Q76MT4 Esf1 3 127.4547151 366203 - 127.4547151 127.507835 esf1 homolog None SIEDGKTKKSQKDDEEQIAK None None 5717 15.28 14.15 15.19 15.67 14.7 16.0 15.91 14.28 15.71 14.88 16.38 16.7 16.36 16.63 15.54 15.53 15.27 15.8 16.1 14.96 16.35 16.28 16.03 17.24 15.57 14.98 15.28 15.13 14.68 15.42 15.5 B1H234 Flrt3 3 127.9942531 366205 - 127.9942531 128.007841 leucine-rich repeat transmembrane protein flrt3 None KELHLQENNIRTITYDSLSK None 604808 8322 16.16 13.63 17.04 16.53 14.78 16.23 16.02 14.98 16.31 15.02 15.21 15.34 16.26 16.45 15.37 15.74 16.02 16.05 15.18 16.52 15.81 16.39 16.04 16.52 15.53 15.72 15.87 15.13 14.9 16.07 16.16 D3ZFN9 Kif16b 3 129.9744671 311478 - 129.9744671 130.254043 kinesin family member 16b None ENKLKDLLAEKERFEEERLR None None 135708 16.45 15.03 15.59 17.12 17.14 15.75 16.63 16.72 16.81 15.06 16.65 15.86 16.43 15.91 16.27 16.39 16.21 16.51 15.23 15.97 15.31 14.5 15.72 15.95 16.99 16.04 16.87 15.84 14.97 16.3 17.0 B5DEQ4 Snrpb2 3 130.3991791 362223 + 130.3991791 130.408819 rcg27500, isoform cra_c None KKKEKKKAKTMEQAAAAANK None None 37728 18.48 17.92 18.95 19.08 18.9 17.23 17.32 19.14 18.97 17.84 18.52 18.62 18.87 18.64 18.9 17.89 17.95 18.36 18.65 19.1 19.26 18.26 18.4 19.51 19.24 18.97 19.37 17.5 19.33 19.03 19.85 P28841 Pcsk2 3 130.880431 25121 + 130.880431 131.185347 neuroendocrine convertase 2 None HLTVLTSKRNQLHDEVHQWR None 162151 37640 17.2 17.68 18.29 17.91 16.15 16.83 18.07 16.8 16.27 17.56 17.71 16.37 16.86 17.25 16.68 16.83 17.58 16.24 16.19 18.3 16.28 18.37 16.86 15.95 16.71 17.0 16.95 17.38 16.42 17.04 15.84 Q7M0E3 Dstn 3 131.2846481 502674 + 131.2846481 131.311355 destrin None KAVIFCLSADKKCIVVEEGK None 609114 21362 19.13 21.07 20.45 19.91 21.52 20.05 21.91 20.06 20.14 20.41 19.57 20.01 20.93 21.03 20.0 20.6 19.98 21.15 21.01 20.32 20.94 20.63 20.97 20.25 21.82 21.91 20.82 20.23 19.35 20.14 20.22 F1M853 Rrbp1 3 131.3152991 311483 - 131.3152991 131.376743 ribosome-binding protein 1 None KVDAAAGQGKKSEMTPAQGK None 601418 68138 19.65 17.57 18.81 19.02 19.13 18.48 17.63 19.44 18.4 18.54 19.82 17.76 19.09 18.74 19.31 19.09 19.6 19.5 17.81 18.44 18.34 18.85 18.93 19.74 19.95 19.35 19.53 18.23 19.66 19.23 19.79 B1H267 Snx5 3 131.621881 296199 - 131.621881 131.641131 sorting nexin-5 None RKRVAAFRKNLIEMSELEIK None 605937 40944 19.43 17.83 19.81 19.74 18.41 18.13 19.88 20.34 19.29 19.49 18.49 18.35 19.96 18.3 17.96 19.42 19.31 19.67 19.37 19.86 19.38 18.34 19.34 18.89 18.66 19.83 19.12 18.75 18.92 19.28 20.68 D4A039 Dzank1 3 131.8559781 311486 - 131.8559781 131.907099 double zinc ribbon and ankyrin repeat domains 1 None YLKERVICRTCGTGNPAHLR None None None 17.03 14.52 15.92 17.16 16.43 15.44 15.26 16.78 16.17 15.59 16.56 15.42 16.06 16.25 15.99 15.24 17.59 15.94 15.59 15.16 14.85 15.19 16.29 16.38 16.94 16.07 16.56 15.12 16.69 16.95 15.57 O88350 Rbbp9 3 131.9253691 29459 - 131.9253691 131.932114 serine hydrolase rbbp9 None LYKFTDRGHFQNTEFHELIR None 602908 4816 17.66 19.53 19.73 18.58 17.45 18.77 19.42 19.53 18.92 18.2 17.58 16.55 17.42 17.58 16.76 17.74 18.21 18.64 17.69 18.95 17.58 17.4 17.12 16.68 17.16 17.77 17.65 17.97 18.38 17.32 17.79 D3ZCT7 Sec23b 3 131.9393561 362226 + 131.9393561 131.981489 protein transport protein sec23 None LIRLCQKFGQYNKEDPTSFR None 610512 74571 17.46 14.7 17.77 16.55 15.33 17.48 17.22 16.66 15.44 17.07 17.7 16.38 17.1 17.91 16.65 15.83 15.68 17.05 17.44 17.11 18.19 17.12 17.4 15.89 17.2 16.34 16.82 17.06 17.08 17.53 17.35 B0K014 Dtd1 3 131.9958441 362227 + 131.9958441 132.158651 d-aminoacyl-trna deacylase None SAIGRGICVLLGISMEDTQK None 610996 5518 20.27 19.78 19.14 19.97 19.85 19.11 20.37 18.17 18.59 21.01 19.97 20.0 20.49 19.87 19.83 20.33 18.47 19.86 21.03 20.85 19.93 21.0 20.22 20.94 19.75 21.11 19.32 19.27 19.4 20.31 20.29 Q9EPQ0 Slc24a3 3 132.9065581 85267 + 132.9065581 133.049431 sodium/potassium/calcium exchanger 3 None RQRLINSRAYTNGESEVAIK None 609839 41390 16.01 13.92 16.3 16.08 15.15 15.18 16.57 17.0 16.16 15.95 16.12 15.5 16.67 15.67 15.96 17.0 16.2 16.21 15.64 15.85 16.33 15.92 16.48 16.01 16.33 17.27 16.21 16.52 15.29 16.81 16.7 B2RZ44 Naa20 3 133.3221051 362228 + 133.3221051 133.339789 n(alpha)-acetyltransferase 20, natb catalytic subunit None VAREEWHGHVTALSVAPEFR None 610833 52421 15.56 16.34 15.42 15.6 16.36 15.5 15.3 14.31 14.8 14.5 15.91 14.44 14.35 15.01 16.05 14.9 15.0 15.08 14.51 15.14 15.15 14.77 14.45 14.97 16.68 14.74 15.22 15.27 14.57 15.14 14.98 P63155 Crnkl1 3 133.3385941 100910202 - 133.3385941 133.354329 crooked neck-like protein 1 None RGIEDIIVSKRRFQYEEEVK None None None 16.14 15.83 17.13 16.35 16.08 16.79 15.79 16.15 16.89 15.66 16.02 17.07 16.61 17.04 17.61 16.05 17.23 16.22 17.24 15.72 18.56 17.0 16.73 16.98 17.85 16.51 18.14 15.86 16.6 17.15 18.26 D4A914 Xrn2 3 134.4370951 362229 + 134.4370951 134.509299 5'-3' exoribonuclease None RRLRAALEEVYPDLTPEENR None 608851 6927 17.02 16.11 18.0 17.09 17.04 17.04 16.62 16.86 17.76 16.34 16.94 17.33 17.29 17.37 17.17 16.46 16.53 17.45 17.47 17.94 18.94 17.15 17.03 17.41 18.04 16.26 18.2 16.04 17.7 17.64 18.66 P85969 Napb 3 136.1357721 499903 - 136.1357721 136.179304 beta-soluble nsf attachment protein None KAIEIYEQVGANTMDNPLLK None None None 22.02 21.31 20.62 20.97 20.69 22.1 21.65 20.75 20.87 22.74 21.42 22.1 22.53 22.02 22.62 22.44 21.88 21.3 21.3 21.47 22.92 21.89 22.07 21.39 21.86 22.71 20.83 23.38 21.34 21.33 21.17 P14841 Cst3 3 136.3369391 25307 - 136.3369391 136.340867 cystatin-c None DASEEGVQRALDFAVSEYNK None 604312 78 17.64 20.13 19.03 17.84 20.26 19.54 18.68 20.28 20.22 20.28 18.35 18.91 19.7 18.65 17.98 19.04 19.95 19.28 17.83 20.13 18.69 19.01 19.22 18.8 18.14 18.52 19.65 18.08 20.39 18.61 18.77 A0A0G2K6G2 Apmap 3 139.4090211 366227 - 139.4090211 139.437289 adipocyte plasma membrane-associated protein None SKWQRRDYLLLVMEGTDDGR None None None 18.5 18.61 18.2 18.65 18.6 16.92 17.35 17.04 18.37 19.2 17.48 18.51 18.36 18.32 19.62 17.87 17.52 17.52 19.22 18.62 19.61 18.88 17.32 20.01 18.62 18.79 17.79 18.76 18.39 18.24 19.78 Q7TP48 Apmap 3 139.4090211 366227 - 139.4090211 139.437289 adipocyte plasma membrane-associated protein None NGTLFVVDAYKGLFEVNPQK None None None 18.87 18.96 18.22 18.36 18.44 16.77 17.35 16.9 18.21 19.08 17.64 18.55 18.29 18.62 19.59 17.97 17.52 17.5 19.24 18.62 19.6 19.23 17.26 20.0 18.8 18.77 17.79 18.76 18.39 18.31 19.66 D3ZZN3 Acss1 3 139.4503841 296259 - 139.4503841 139.500325 acetyl-coenzyme a synthetase None FYGAPTAVRLLLKFGDAWVK None None 56037 18.68 17.41 20.58 20.29 18.12 18.99 19.6 18.69 19.42 19.19 18.05 19.17 18.42 18.96 19.33 18.36 18.47 19.77 19.91 18.3 20.63 19.35 19.56 18.31 18.97 18.73 20.41 18.71 18.22 19.96 19.9 Q9ER31 Entpd6 3 139.5756421 85260 + 139.5756421 139.59816 ectonucleoside triphosphate diphosphohydrolase 6 None LIDAEKGGSLVVGDFEIAAK None 603160 68170 15.83 15.88 16.96 14.97 15.26 16.28 16.03 15.83 14.91 15.61 15.7 14.98 16.41 15.37 14.7 15.54 16.6 15.3 15.69 16.34 15.73 15.75 15.16 14.99 17.02 15.63 16.78 15.51 15.36 16.44 15.05 G3V6Y6 Pygb 3 139.6117691 25739 + 139.6117691 139.663552 alpha-1,4 glucan phosphorylase None VIPAADLSQQISTAGTEASGTGNMK None 138550 100930 21.93 24.19 23.54 22.99 23.82 21.96 23.84 23.53 22.29 22.67 22.56 22.06 23.15 22.18 21.68 22.92 22.85 22.79 23.68 23.31 22.57 22.07 22.61 22.67 23.39 23.38 22.8 23.88 21.34 22.46 23.04 P53534 Pygb 3 139.6117691 25739 + 139.6117691 139.663552 glycogen phosphorylase, brain form None LQDIIRRFKSSKFGCRDPVR None 138550 100930 21.65 23.61 23.54 23.06 23.86 21.97 23.85 23.55 22.3 22.71 22.58 22.05 23.45 22.32 21.73 22.94 23.0 22.83 23.7 23.35 22.68 22.12 23.06 22.68 23.56 23.55 22.9 23.98 21.39 22.61 22.96 Q6AYT7 Abhd12 3 139.6593171 499913 - 139.6593171 139.719522 lysophosphatidylserine lipase abhd12 None RSFRDFKVQFIPFHSDLGYR None 613599 22910 18.18 19.78 18.66 18.38 19.21 17.25 17.06 18.35 17.91 18.65 17.86 16.55 17.42 17.62 18.23 17.71 17.69 18.13 16.7 18.74 17.4 16.65 17.31 18.68 18.23 17.89 18.31 16.67 18.71 17.67 17.15 Q5M969 Nanp 3 139.8288671 311530 - 139.8288671 139.841601 n-acylneuraminate-9-phosphatase None CYFLWKSTRLQHMTLEEDVK None 610763 12112 14.96 16.27 15.96 16.2 15.58 17.84 17.35 16.09 16.93 17.25 16.39 17.23 17.31 16.62 15.41 16.25 15.86 17.2 16.36 17.54 17.54 16.77 17.34 16.56 14.96 16.32 15.99 17.25 15.31 16.19 15.84 O35987 Nsfl1c 3 139.9783171 83809 + 139.9783171 140.002837 nsfl1 cofactor p47 None SFRDLIHDQDEEEEEEEGQR None None 41114 20.41 18.11 20.93 19.44 18.95 20.13 19.99 20.26 19.41 19.8 19.84 18.76 20.37 20.05 18.83 19.22 19.62 20.1 20.14 21.39 20.36 21.83 20.41 19.61 19.69 20.72 19.92 20.0 20.17 20.53 20.34 Q62658 Fkbp1a 3 140.040361 25639 + 140.040361 140.060102 peptidyl-prolyl cis-trans isomerase fkbp1a None FPKRGQTCVVHYTGMLEDGK None 186945 105139 19.29 17.85 19.81 19.2 19.08 20.17 20.56 18.82 19.96 19.2 19.06 19.25 19.91 19.62 18.42 19.82 19.77 19.36 19.16 19.63 18.78 19.79 20.1 18.04 18.66 18.93 18.62 19.95 19.39 19.41 19.19 B5DF41 Snph 3 140.0985411 296267 - 140.0985411 140.139342 syntaphilin None QNGVAKEEGTGESAGGSPAR None 604942 8817 20.49 18.1 19.35 18.83 19.71 20.03 18.68 18.73 19.77 21.02 20.71 19.03 19.62 19.62 19.7 18.86 20.49 19.79 18.9 18.51 19.71 19.97 19.84 20.24 18.42 18.82 19.57 18.61 20.33 19.72 19.81 Q5XIU5 Psmf1 3 140.2353741 689852 - 140.2353741 140.260546 proteasome inhibitor pi31 subunit None DPSSGLPNRLPPGAVPPGAR None None None 18.82 19.98 18.44 18.75 18.47 18.01 18.35 19.29 17.25 17.71 19.86 18.44 17.85 18.85 17.2 17.07 17.63 19.14 18.57 18.81 17.55 18.33 17.23 17.83 18.24 17.88 17.45 18.48 19.67 17.82 18.3 P19139 Csnk2a1 3 140.7100141 116549 + 140.7100141 140.754244 casein kinase ii subunit alpha None RLIDWGLAEFYHPGQEYNVR None 115440 90874 20.51 19.06 19.83 19.55 19.36 20.32 18.62 18.37 19.69 20.29 19.66 20.01 19.78 20.19 19.02 19.58 19.84 19.78 19.56 20.42 20.24 20.26 19.97 19.7 19.74 19.31 19.91 19.43 20.45 19.78 20.06 A0A0G2K9L6 Rbck1 3 140.7890821 60383 - 140.7890821 140.805987 ranbp-type and c3hc4-type zinc finger-containing protein 1 None NPQELQRQRQLRMLEDLGFK None 610924 32448 16.26 17.67 16.93 17.77 16.21 16.74 17.17 16.66 16.76 17.74 16.29 16.43 16.4 16.59 17.15 16.0 17.4 16.32 17.25 15.28 16.78 16.16 15.57 16.41 14.99 16.93 16.56 15.72 17.09 16.28 16.6 D4A367 Rbck1 3 140.7890821 60383 - 140.7890821 140.805987 ranbp-type and c3hc4-type zinc finger-containing protein 1 None QKVPLRVQVKPEVSPTQDIR None 610924 32448 16.85 17.16 16.76 17.37 15.23 16.11 15.61 16.23 17.07 16.38 15.71 16.18 16.52 16.35 17.16 16.19 17.35 16.24 17.27 15.19 17.14 17.42 16.13 18.31 16.67 17.59 16.87 16.04 16.61 15.89 16.0 Q62921 Rbck1 3 140.7890821 60383 - 140.7890821 140.805987 ranbp-type and c3hc4-type zinc finger-containing protein 1 None AYLYLLSARNTSLNPQELQR None 610924 32448 16.23 14.67 16.4 17.58 16.03 15.82 16.75 16.47 16.72 17.47 16.08 15.83 16.64 16.4 15.83 15.81 17.09 16.25 17.01 16.1 16.59 15.97 16.25 16.47 15.69 17.34 15.97 15.97 16.72 16.84 16.88 A0A0G2K1Z9 Hm13 3 141.1457751 311545 + 141.1457751 141.184703 histocompatibility 13, isoform cra_d None VAKSFEAPIKLVFPQDLLEK None None 7749 17.35 15.46 17.57 17.37 17.0 16.34 17.83 16.88 16.99 16.93 17.93 17.83 17.71 18.24 18.26 16.28 16.59 17.16 18.3 16.5 18.31 17.51 17.27 16.55 17.48 16.78 17.47 18.21 16.7 17.92 18.41 P53563 Bcl2l1 3 141.2535111 24888 - 141.2535111 141.304509 bcl-2-like protein 1 None GYSWSQFSDVEENRTEAPEETEPER None 600039 7639 18.02 15.61 18.02 17.42 17.49 17.14 17.77 18.13 17.46 18.64 16.64 16.53 17.65 18.64 17.19 16.5 16.85 18.21 17.63 18.68 18.31 18.36 18.13 18.34 18.35 18.73 16.85 17.78 17.98 18.05 18.42 B4F7B7 Dusp15 3 141.4084991 362238 - 141.4084991 141.418999 dual specificity protein phosphatase 15 None LPGLYLGNFIDAKDPDQLGR None None 33586 18.47 15.91 17.8 16.46 16.92 17.01 17.34 17.81 15.64 17.4 16.96 15.95 16.53 16.14 16.86 17.29 17.36 16.08 17.19 16.47 15.86 16.61 16.87 17.26 17.47 16.93 16.6 15.6 17.22 17.67 15.38 Q642A0 Pdrg1 3 141.4775651 296278 - 141.4775651 141.48373 p53 and dna damage-regulated protein 1 None KMPHLKTKEMIQKDQEHLDK None 610789 12779 16.18 17.94 16.2 17.43 16.42 15.8 16.37 16.34 16.37 16.72 15.92 15.76 15.52 16.02 16.1 16.44 15.67 16.43 16.23 16.34 16.72 15.03 15.46 15.99 15.9 16.77 15.82 15.78 17.31 15.78 15.81 Q5GH56 Xkr7 3 141.5012851 311549 + 141.5012851 141.525062 xk-related protein 7 None DRRLRKTILALEYSSPATPR None None None 15.94 15.76 16.23 16.05 16.53 16.05 16.72 16.04 17.34 15.93 15.52 17.26 17.19 17.06 16.88 15.87 15.21 16.5 17.73 16.13 17.53 16.52 15.89 15.86 16.45 16.28 16.12 17.64 16.36 16.96 17.73 P50545 Hck 3 141.5715911 25734 + 141.5715911 141.614703 tyrosine-protein kinase hck None IVVALYDYEAIHREDLSFQK None 142370 20489 17.45 17.21 18.91 17.84 17.51 18.52 18.26 17.52 18.44 17.82 18.91 18.07 18.83 18.58 19.12 17.29 17.48 17.93 18.1 17.63 20.13 18.53 18.16 18.58 17.32 16.86 18.34 19.23 16.3 18.67 18.82 Q4KLL4 Tm9sf4 3 141.6271081 296279 + 141.6271081 141.673978 transmembrane 9 superfamily member 4 None GILSMIIIRTLRKDIANYNK None None 21620 16.71 18.54 17.34 17.94 17.03 15.45 17.48 17.33 17.71 17.03 17.86 16.46 16.64 16.79 17.24 16.46 17.29 17.23 17.35 17.1 18.01 16.73 16.42 16.68 17.24 17.49 16.88 17.44 17.61 16.58 17.48 D3ZI07 Kif3b 3 141.7584671 296284 + 141.7584671 141.797963 kinesin-like protein None FVTKSVKEIEHVMNVGNQNR None 603754 55849 19.54 16.9 18.51 19.4 18.07 19.58 18.76 18.15 18.57 18.61 19.5 18.75 19.5 19.3 20.05 18.93 19.46 18.53 19.5 17.39 19.52 19.24 19.66 19.66 19.48 19.87 19.49 18.96 18.11 19.06 19.07 Q499V0 Commd7 3 142.0995681 296285 - 142.0995681 142.11433 comm domain containing 7, isoform cra_d None LGPLKSIMKSLLLVPNGALK None None 24933 16.86 16.25 17.97 15.75 16.44 18.65 16.83 16.76 17.59 17.32 17.94 17.42 17.27 17.48 17.59 16.51 16.13 17.28 16.5 18.51 18.5 17.85 17.27 16.72 15.88 15.85 16.85 17.67 18.19 17.74 18.3 Q66HR2 Mapre1 3 142.218891 114764 + 142.218891 142.246794 microtubule-associated protein rp/eb family member 1 None ALKKVKFQAKLEHEYIQNFK None 603108 56129 20.37 21.68 20.65 19.52 18.99 20.3 20.14 20.43 20.27 21.59 19.41 19.34 19.45 19.61 18.69 20.81 19.88 20.85 19.94 20.75 20.11 20.86 19.57 20.41 19.24 20.44 20.74 20.13 19.19 18.94 20.13 B5DFL0 Snta1 3 142.8762971 362242 - 142.8762971 142.906709 snta1 protein None QRRRVTVRKADAGGLGISIK None None 2331 19.28 20.27 18.71 18.4 19.66 18.94 18.99 19.02 18.21 18.97 19.78 18.59 18.62 19.56 20.08 19.03 19.24 18.5 19.69 17.94 18.59 19.13 18.11 19.52 20.33 19.16 20.15 19.55 17.47 19.44 19.4 A0A0G2JWW3 Necab3 3 143.0494791 311562 - 143.0494791 143.075361 n-terminal ef-hand calcium-binding protein 3 None MDTTKLEYEQASKVDQFVTR None 612478 10992 15.89 17.32 15.62 16.09 16.05 15.56 15.2 15.08 14.77 15.13 17.66 15.96 15.4 15.8 16.6 15.88 15.24 15.04 17.21 14.75 15.77 16.46 15.65 16.13 16.42 15.52 14.92 17.24 15.55 15.27 14.98 M0RCH6 Chmp4b 3 143.1710031 + 143.1710031 143.210582 chromatin modifying protein 4B-like 1 None TIEFQREALENANTNTEVLK None None None 20.98 18.16 19.08 20.24 20.37 19.18 19.21 21.12 19.51 20.33 19.42 19.38 20.33 19.1 19.12 20.17 21.04 20.15 18.98 20.3 18.3 19.63 19.72 20.26 20.35 21.47 19.98 18.72 21.27 20.17 20.44 E9PTI6 Raly 3 143.3063221 296301 + 143.3063221 143.370529 raly heterogeneous nuclear ribonucleoprotein None IQTSNVTNKNDPKSINSRVF None None 7216 18.45 18.71 17.82 18.57 19.31 17.72 17.2 19.68 18.71 17.38 17.4 19.31 18.35 17.91 19.69 18.58 18.86 18.2 19.07 17.42 18.17 17.81 17.63 19.37 19.24 19.5 19.49 17.44 18.97 18.16 20.22 Q5PQR0 Raly 3 143.3063221 296301 + 143.3063221 143.370529 raly heterogeneous nuclear ribonucleoprotein None None None None 18.52 18.78 17.89 18.63 19.38 17.79 17.28 19.75 18.78 17.44 17.46 19.38 18.42 17.98 19.71 18.65 18.96 18.35 19.16 17.37 18.24 17.87 17.7 19.43 19.31 19.57 19.59 17.5 19.02 18.23 20.29 Q6P685 Eif2s2 3 143.3746581 296302 - 143.3746581 143.395381 eukaryotic translation initiation factor 2 subunit beta None QVVRVGTKKTSFVNFTDICK None None 2904 18.83 17.21 19.92 18.79 17.97 18.42 19.38 18.48 19.79 18.93 19.29 18.86 19.72 19.31 20.2 18.57 19.39 18.52 19.63 17.5 19.96 19.17 19.39 19.16 17.28 18.82 20.18 19.3 17.22 19.48 19.81 P10760 Ahcy 3 143.5691351 29443 - 143.5691351 143.584384 adenosylhomocysteinase None VIITEIDPINALQAAMEGYEVTTMDEACK None 180960 554 22.71 20.58 23.22 21.76 22.22 21.89 23.02 22.04 20.59 21.86 21.82 21.84 21.76 21.03 20.52 21.41 22.14 21.66 22.09 23.3 22.81 22.27 22.41 20.59 21.75 22.32 21.67 21.98 22.23 22.26 22.77 A0A0G2K9T1 Itch 3 143.6683611 311567 + 143.6683611 143.731555 e3 ubiquitin-protein ligase None GLKDLESIDPEFYNSLIWVK None None None 18.08 15.33 18.25 17.72 16.5 17.12 18.03 16.52 17.95 18.53 16.84 16.12 17.56 17.57 18.37 16.78 16.54 17.61 17.74 17.07 18.94 18.08 17.9 16.23 17.79 17.39 17.44 18.24 17.73 18.62 17.58 P62628 Dynlrb1 3 143.7430591 170714 + 143.7430591 143.764226 dynein light chain roadblock-type 1 None STMDNPTTTQYANLMHNFILK None 607167 69161 19.59 17.45 19.15 19.98 19.49 18.68 18.17 18.52 18.48 18.26 19.96 18.69 19.4 19.71 19.03 18.62 18.93 19.04 18.24 20.01 18.65 18.73 19.54 18.72 20.36 18.35 19.07 18.32 20.38 19.63 19.12 Q6XVN8 Map1lc3a 3 143.7830251 362245 + 143.7830251 143.78467 microtubule-associated proteins 1a/1b light chain 3a None VLDKTKFLVPDHVNMSELVK None None 12021 21.66 21.72 20.32 21.99 20.89 20.7 20.11 22.02 20.9 21.58 20.12 20.25 20.86 19.51 21.45 21.04 20.39 20.97 21.12 20.05 20.1 20.92 21.02 21.82 21.64 21.95 21.33 19.76 21.54 20.29 21.25 Q8CHJ1 Pigu 3 143.6749011 353304 - 143.6749011 143.838368 phosphatidylinositol glycan anchor biosynthesis class u protein None KQKLLLELDQYAPDVAELIR None 608528 None 16.44 14.64 15.41 16.27 15.99 13.91 16.25 16.85 15.56 15.09 16.6 15.59 16.37 15.79 16.05 16.26 16.03 15.22 16.4 15.13 15.24 14.91 15.52 14.93 17.33 15.73 15.76 16.35 15.37 16.0 16.69 G3V8C9 Ncoa6 3 143.8908971 116464 - 143.8908971 143.931612 nuclear receptor coactivator 6 None AIGQAPSNLTVSNPPNFAAPQAHK None 605299 40920 15.18 13.77 15.67 15.18 14.51 16.52 15.57 15.04 16.39 14.33 14.95 16.11 15.98 15.86 15.88 15.02 15.45 15.05 16.25 15.17 15.85 16.84 15.67 14.88 16.85 15.66 15.07 16.97 15.55 15.94 16.77 Q99MZ4 Ggt7 3 143.9781211 156275 - 143.9781211 144.003893 glutathione hydrolase 7 None HLIDFRESAPGALREEALQR None 612342 70866 19.05 18.69 17.94 19.56 19.49 17.87 17.92 18.17 19.37 18.71 17.91 18.49 19.62 18.96 19.67 18.96 18.34 18.52 19.18 18.72 19.42 17.57 18.89 18.64 19.47 19.84 18.45 19.26 19.92 19.45 19.04 G3V9U0 Acss2 3 144.0045441 311569 + 144.0045441 144.047452 propionate--coa ligase None IAQNDHDLGDTSTVADPSVINHLFSHR None 605832 6469 19.2 16.27 19.39 18.53 19.06 18.23 18.95 17.94 18.09 17.98 19.65 17.12 18.5 18.47 19.32 18.19 18.29 17.66 18.64 17.98 18.17 18.15 18.87 18.09 18.83 17.43 19.13 18.53 16.76 18.64 18.27 P46413 Gss 3 144.0478511 25458 - 144.0478511 144.078154 glutathione synthetase None VFLGLNRSDYMFQCSADGSK None 601002 148 19.67 17.05 18.49 19.23 20.06 17.51 18.95 18.51 19.17 18.45 19.9 18.95 19.58 18.86 19.87 19.76 17.87 18.4 19.99 19.85 18.83 19.4 19.53 20.08 20.28 19.43 18.92 19.9 17.86 19.91 19.84 Q3KRD8 Eif6 3 144.325041 305506 - 144.325041 144.331286 eukaryotic translation initiation factor 6 None LSALGNVTTCNDYVALVHPDLDR None 602912 7135 18.22 15.62 18.11 17.43 17.24 17.39 18.31 18.17 16.8 16.62 18.96 17.46 18.03 16.48 17.59 17.13 17.39 18.43 16.78 18.8 18.06 18.94 17.82 16.71 18.77 17.42 16.85 17.37 18.83 18.24 18.36 Q32Q54 Uqcc1 3 144.3532661 683512 - 144.3532661 144.445715 rcg37273, isoform cra_a None YHNTSKLSTARDSPQPVEEK None None None 18.17 15.89 17.63 17.68 18.55 16.38 17.67 18.17 18.05 18.46 18.67 16.93 18.35 16.96 16.7 17.37 17.96 17.91 18.33 18.04 17.34 17.33 17.1 19.28 17.78 16.44 17.52 16.83 16.96 17.25 18.18 D3ZU83 Ergic3 3 144.5250741 296306 + 144.5250741 144.534859 ergic and golgi 3 None SCYGAESEDIKCCNSCEDVR None None 5289 17.82 15.27 16.69 17.94 16.37 16.53 16.79 17.07 17.12 17.26 19.44 17.6 18.01 17.05 18.72 18.0 17.9 17.14 17.27 15.79 17.42 18.46 17.72 17.45 17.17 16.9 17.82 17.84 16.49 17.81 17.73 D4A1R8 Cpne1 3 144.5875311 362249 - 144.5875311 144.597138 copine-1 None KWHLAYRTEVVKNNLNPTWK None None None 18.96 18.72 16.58 18.98 18.92 16.03 17.47 17.02 18.27 18.77 18.2 18.23 18.15 18.24 19.33 18.88 17.41 17.51 19.47 17.24 17.64 18.5 17.87 19.42 18.8 19.14 17.1 19.34 17.7 17.95 18.74 Q3MHT2 Nfs1 3 144.6373111 84594 - 144.6373111 144.659645 cysteine desulfurase Nifs None None None None 19.86 19.51 18.92 18.46 19.34 18.79 18.88 18.5 18.22 19.28 18.52 18.01 18.28 18.94 19.89 18.84 18.0 18.37 19.21 18.57 18.22 19.0 17.95 18.47 20.23 18.33 20.24 19.04 17.55 18.36 19.08 Q99P39 Nfs1 3 144.6373111 100911034 - 144.6373111 144.659645 cysteine desulfurase None PSYVLRAIGTDEDLAHSSIR None None None 19.86 19.51 18.92 18.46 19.34 18.79 18.88 18.5 18.22 19.28 18.52 18.01 18.28 18.94 19.89 18.84 18.0 18.37 19.21 18.57 18.22 19.0 17.95 18.47 20.23 18.33 20.24 19.04 17.55 18.36 19.08 Q5BJP4 Rbm39 3 144.6630121 100910882 - 144.6630121 144.696151 rna binding motif protein 39 None DDVIEECNKHGGVIHIYVDK None None None 18.48 17.11 19.01 18.46 18.48 17.9 17.24 18.3 19.05 17.41 17.56 18.82 18.68 18.61 19.03 17.69 17.46 18.32 18.58 19.02 19.78 18.3 18.58 19.21 19.13 18.04 19.55 18.09 18.1 18.88 19.7 Q6XLI7 Rbm12 3 144.6130811 362249 - 144.6130811 144.616178 copine-1-like None PHEAGFCVYLKGLPFEAENK None None None 16.74 16.91 17.15 17.44 17.48 15.66 16.79 17.81 16.56 16.79 15.73 17.04 16.48 16.53 18.05 16.44 16.31 17.22 17.12 16.68 17.29 16.45 15.98 16.2 17.92 17.89 18.37 16.34 16.99 16.97 18.66 B1WC03 Aar2 3 145.0574271 296312 + 145.0574271 145.080149 aar2 splicing factor homolog None AEITRHSMDLSYALETVLSK None None None 16.02 16.46 16.03 16.8 16.1 16.18 16.43 14.8 15.06 14.37 16.53 15.63 14.85 15.89 15.49 14.33 15.52 16.02 16.2 14.92 15.49 15.52 15.67 14.03 16.34 15.61 15.79 15.66 15.89 14.4 16.05 G3V927 Dlgap4 3 145.175481 286930 + 145.175481 145.27049 discs, large homolog-associated protein 4 (drosophila) DAP-4; Dap4; SAPAP4 None None None None 19.13 17.46 18.43 18.52 18.25 18.77 18.11 18.55 19.69 19.46 18.08 19.79 19.36 19.72 18.35 19.02 19.21 19.94 18.71 18.33 19.89 18.65 19.41 19.95 17.79 19.34 18.93 19.1 18.31 18.66 19.66 P97839 Dlgap4 3 145.175481 286930 + 145.175481 145.27049 disks large-associated protein 4 None GIQVDCIQPVPKEEPSPATK None None 8935 19.13 17.46 18.43 18.52 18.25 18.77 18.11 18.55 19.69 19.46 18.08 19.79 19.36 19.72 18.35 19.02 19.21 19.94 18.71 18.33 19.89 18.65 19.41 19.95 17.79 19.34 18.93 19.1 18.31 18.66 19.66 Q64122 Myl9 3 145.2819651 296313 + 145.2819651 145.288332 myosin regulatory light polypeptide 9 None FDQSQIQEFKEAFNMIDQNR None 609905 21230 19.84 17.53 20.59 18.06 18.59 18.87 19.75 20.56 19.23 19.05 20.9 18.67 19.84 20.61 20.26 19.1 17.83 19.21 20.45 19.36 19.46 19.54 19.83 18.57 19.23 18.54 18.43 19.44 20.74 19.88 19.79 D4ACZ5 Nprg2 3 1.0 - 1.0 1.0 n-myc downstream-regulated gene 3 protein None TTLLKMADCGGLPQVVQPGK None None None 18.85 17.56 18.39 18.01 18.45 19.74 19.29 19.1 19.48 19.51 18.63 19.61 19.43 19.07 18.39 18.26 18.49 19.66 18.31 19.7 20.54 18.72 19.39 18.25 17.41 18.45 18.03 19.35 19.48 19.33 19.23 Q6AYR2 Ndrg3 3 145.5480411 296318 - 145.5480411 145.650873 protein ndrg3 None TTLLKMADCGGLPQVVQPGK None 605273 23228 19.44 18.92 18.44 18.16 18.12 19.71 19.26 19.15 19.53 19.59 18.61 19.69 19.14 19.32 18.46 18.21 18.72 19.64 18.35 19.77 20.42 18.8 18.74 18.5 17.48 18.51 18.21 19.13 19.45 18.91 19.46 A0A0G2KA88 Soga1 3 145.6769741 311578 - 145.6769741 145.739635 suppressor of glucose, autophagy-associated 1 None RSLGKTDKKPTAQEDSADLK None None None 16.71 17.9 16.41 16.08 15.95 18.71 16.24 16.67 16.16 16.49 17.01 17.08 16.26 16.71 17.58 17.48 17.92 16.26 17.57 15.94 17.4 17.42 16.71 17.27 17.98 17.57 16.68 16.74 18.49 18.25 17.23 D3Z898 Samhd1 3 145.7615591 311580 - 145.7615591 145.794386 deoxynucleoside triphosphate triphosphohydrolase samhd1 None ITKDQVSQLLPQKFAEQLIR None None None 16.21 15.56 16.93 16.01 16.42 16.44 17.19 16.16 17.58 15.33 17.0 16.83 16.24 16.63 18.03 15.89 16.73 15.86 17.07 15.7 17.97 17.03 16.24 15.38 16.18 16.21 17.18 17.25 15.73 16.8 18.0 P25235 Rpn2 3 145.9417611 64701 + 145.9417611 145.98927 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 None FELNFKNVKLPSGYYDFSVR None 180490 2100 19.45 17.56 19.42 19.4 17.22 18.38 18.71 19.04 18.12 18.58 20.78 18.57 19.61 20.26 19.93 18.21 18.89 18.72 19.75 17.59 19.64 19.24 19.38 19.65 20.16 18.43 19.7 19.08 18.17 19.7 19.35 Q9WUD9 Src 3 146.1247081 83805 + 146.1247081 146.139491 proto-oncogene tyrosine-protein kinase src None MPCPPECPESLHDLMCQCWR None 190090 21120 18.47 18.13 19.05 19.39 17.51 19.02 19.59 18.27 19.15 18.71 20.35 18.57 19.53 19.18 19.81 18.45 18.36 19.23 19.65 18.29 20.6 19.02 19.21 19.0 17.65 19.44 18.99 19.73 17.3 19.28 19.51 A0A0G2K0F3 Epb41l1 3 144.9847131 59317 - 144.9847131 145.035726 band 4.1-like protein 1 None DFMTTPPCITTETISTTMENSLK None None 8126 20.67 20.78 21.69 21.46 20.12 20.89 22.17 21.04 21.73 21.96 21.1 20.62 23.11 21.54 22.05 21.93 22.17 20.66 22.25 20.54 21.48 22.59 22.2 21.46 21.34 23.17 21.77 22.48 19.88 21.33 20.97 D3ZMI4 Epb41l1 3 144.9847131 59317 - 144.9847131 145.035726 band 4.1-like protein 1 4.1N; Epb4.1l1 None None None None 20.67 20.78 21.69 21.46 20.12 20.89 22.17 21.04 21.73 21.96 21.1 20.62 23.11 21.54 22.05 21.93 22.17 20.66 22.25 20.54 21.48 22.59 22.2 21.46 21.34 23.17 21.77 22.48 19.88 21.33 20.97 Q9WTP0 Epb41l1 3 144.9847131 59317 - 144.9847131 145.035726 band 4.1-like protein 1 None PPRPRAPESDTGDEDQDQER None None 8126 20.33 21.2 21.9 21.33 19.98 21.39 22.33 21.05 21.91 22.09 20.46 20.95 22.99 21.69 22.04 21.76 22.12 21.01 22.24 20.26 21.77 22.6 22.01 21.54 20.78 23.08 21.69 22.3 19.96 21.29 20.88 Q4V8K2 Ctnnbl1 3 146.3878981 296320 + 146.3878981 146.548986 beta-catenin-like protein 1 None SYQPNRGTKRPRDDEEEELK None 611537 12003 18.13 17.76 18.82 18.03 18.08 19.04 18.27 17.78 19.25 18.29 18.46 19.5 18.72 18.92 19.39 17.99 17.93 18.27 18.93 18.82 20.33 19.13 18.58 19.19 18.18 18.02 19.53 18.44 17.88 18.83 19.35 B5DEK0 Rprd1b 3 146.6829761 311591 + 146.6829761 146.729251 regulation of nuclear pre-mrna domain-containing 1b None VRQKIASLPQEVQDVSLLEK None None 41426 16.23 15.78 17.12 16.1 16.57 16.56 17.39 16.64 17.04 15.9 16.25 17.04 16.79 16.52 16.69 16.25 16.08 16.48 16.82 16.89 18.04 16.74 16.67 16.6 17.39 15.92 17.93 15.94 15.57 17.1 17.96 Q9WVJ6 Tgm2 3 146.7726881 56083 - 146.7726881 146.801924 tissue-type transglutaminase None AERREYVLTQQGFIYQGSVK None 190196 3391 18.11 16.0 18.5 17.49 17.22 17.51 18.96 19.18 18.15 17.24 19.64 17.27 17.92 18.84 17.56 17.21 17.97 16.4 19.48 17.84 17.81 17.8 18.38 17.43 17.51 17.21 16.6 18.58 17.41 18.89 18.14 A0A0G2K0K8 Ralgapb 3 147.0738591 362257 + 147.0738591 147.15209 ral gtpase-activating protein subunit beta None TLEKEVPVIFIHPLNTGLFR None None None 18.03 15.64 17.66 18.47 16.75 17.42 17.41 16.77 18.31 17.2 16.92 17.27 18.12 18.49 18.41 17.23 17.87 17.48 18.56 16.31 19.09 18.0 18.58 17.62 18.09 19.35 18.02 18.03 17.71 18.27 18.37 P86410 Ralgapb 3 147.0738591 362257 + 147.0738591 147.15209 ral gtpase-activating protein subunit beta None FLHMLSNPVDLSNPAVISSTPK None None None 18.02 15.71 17.58 18.74 16.69 17.23 17.27 16.87 18.32 17.17 16.92 17.36 18.1 18.44 18.37 17.27 17.89 17.42 18.62 16.33 18.86 18.0 18.6 17.77 18.16 19.35 18.06 17.98 17.76 18.28 18.45 O35458 Slc32a1 3 147.2673741 83612 + 147.2673741 147.271844 vesicular inhibitory amino acid transporter None SLFQEGSRAFFPACYGGDGR None None 56451 19.0 18.34 19.24 20.29 19.56 17.75 19.39 19.48 18.97 18.86 18.21 18.37 19.02 18.1 18.7 19.25 19.01 18.52 19.41 19.63 17.65 19.24 18.9 18.74 19.7 20.63 18.55 19.07 19.35 19.67 20.4 D4AA72 Ppp1r16b 3 147.3236411 680616 + 147.3236411 147.415597 protein phosphatase 1, regulatory subunit 16b None EFSTKISRGELDGPVENGLR None None None 16.81 17.04 15.42 16.11 16.29 16.66 16.55 15.65 17.0 16.25 15.89 17.2 16.14 16.5 15.15 16.83 16.17 16.49 17.15 16.91 18.09 15.76 15.85 15.69 16.44 16.42 15.66 16.73 17.65 16.3 17.39 Q9WUL0 Top1 3 149.2998641 64550 + 149.2998641 149.375405 dna topoisomerase 1 None RLEEQLMKLEVQATDREENK None 126420 2467 17.46 18.14 18.89 17.8 17.46 17.42 18.68 17.55 19.02 18.07 17.61 18.34 16.84 18.4 19.01 17.17 17.17 17.58 18.87 17.3 20.06 18.13 17.85 17.38 17.77 18.0 17.7 19.43 16.71 17.56 18.95 G3V845 Plcg1 3 149.3856641 25738 + 149.3856641 149.41633 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma None VRAREGSFEARYQQPFEDFR None 172420 1997 19.34 18.46 18.98 18.8 17.92 18.22 18.18 18.21 17.26 19.29 18.74 16.68 17.64 18.42 16.85 17.56 18.06 19.1 17.87 19.32 16.99 19.02 17.4 17.22 18.26 18.72 18.73 18.11 18.62 18.05 18.58 P10686 Plcg1 3 149.3856641 25738 + 149.3856641 149.41633 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 None EALEKIGTAEPDYGALYEGR None 172420 1997 19.33 17.07 18.96 18.8 17.83 18.14 18.16 17.94 17.19 19.19 18.78 16.64 18.02 18.55 16.8 17.39 18.04 19.07 17.86 19.26 17.11 19.17 17.8 17.15 18.32 18.64 18.73 18.09 18.58 18.46 18.71 Q80Z36 Zhx3 3 149.4227751 311604 - 149.4227751 149.436589 zinc fingers and homeoboxes protein 3 None REIDGWFSERRKRVNAEETK None 609598 9000 15.54 13.91 15.17 14.76 15.96 15.53 15.79 15.18 16.14 14.24 14.78 16.0 16.0 16.0 15.05 15.01 15.83 15.41 16.7 14.96 16.58 15.45 15.75 14.94 15.9 16.12 15.9 16.59 14.41 16.07 16.27 D3ZA12 Chd6 3 149.5964971 311607 - 149.5964971 149.757755 chromodomain-helicase-dna-binding protein 6 None FVASGNRTDISLDDPNFWQK None None 32772 17.12 14.82 17.32 15.48 16.88 16.67 17.37 16.24 16.32 15.22 16.84 15.61 15.34 16.78 16.49 15.16 16.31 16.6 16.5 16.38 17.06 16.96 15.98 16.69 17.54 15.7 16.5 15.21 15.57 16.65 17.24 F1LXJ9 Ptprt 3 150.1967381 362263 - 150.1967381 150.98856 protein-tyrosine-phosphatase None DGSRGELSQPTLTIQTHPYR None None None 16.51 15.68 17.24 16.18 15.41 16.95 17.21 15.87 15.8 16.04 17.21 15.76 16.96 16.33 15.43 16.01 16.82 17.06 15.8 16.76 16.53 17.97 16.14 16.58 15.76 17.01 16.46 16.65 14.57 15.84 16.83 A0A0H2UH90 Vwa5a 3 38.8151971 108348048 + 38.8151971 38.838953 von willebrand factor a domain-containing protein 5a None QFFPESVKYTQETIEEAVER None None None 18.57 16.55 17.95 18.33 18.1 17.33 17.92 18.06 17.25 16.51 19.17 17.31 16.93 16.51 17.56 18.02 16.86 17.7 18.04 18.5 17.4 17.55 17.2 18.21 18.16 17.41 18.09 17.27 16.47 18.22 18.44 Q75WE7 Vwa5a 3 38.8151971 108348048 + 38.8151971 38.838953 von willebrand factor a domain-containing protein 5a None QLIFLQNANGSWKLDENLTK None None None 18.57 16.55 17.94 18.33 18.1 17.33 17.81 18.06 17.3 16.52 19.19 17.4 16.93 16.51 17.86 18.02 16.78 17.74 17.77 18.49 17.4 17.55 17.2 18.31 18.02 17.41 18.11 17.26 16.45 18.22 18.44 G3V6S8 Srsf6 3 151.5895471 362264 + 151.5895471 151.594869 serine/arginine-rich splicing factor 6 None QDLKDFMRQAGEVTYADAHK None None None 18.69 16.59 19.43 18.12 18.32 18.39 17.93 18.21 19.07 18.05 19.03 18.81 18.59 19.05 19.55 17.89 17.74 19.14 18.97 18.43 20.51 19.03 18.76 19.08 18.39 18.07 20.14 18.07 18.04 19.12 19.97 Q76IQ7 Tox2 3 151.8532951 311615 + 151.8532951 151.97999 tox high mobility group box family member 2 None PQKPVSAYALFFRDTQAAIK None None None 15.04 16.9 16.12 16.03 15.97 14.39 14.74 15.54 15.18 15.85 15.6 14.75 15.03 15.76 14.94 16.33 17.08 14.7 15.34 15.54 15.0 15.07 15.3 16.21 16.3 15.38 15.21 15.41 15.75 15.54 15.85 B4F774 Gdap1l1 3 152.1103111 311616 + 152.1103111 152.128711 ganglioside-induced differentiation-associated protein 1-like 1 None KYATAEIRRHLANATTDLMK None None 11426 19.4 20.19 19.75 18.26 18.44 19.16 19.83 19.32 19.51 19.27 19.25 19.31 18.71 20.15 20.16 19.63 20.16 18.96 19.95 18.02 19.73 19.31 18.35 18.36 18.59 20.58 20.03 20.16 18.23 19.35 19.86 D3ZGM8 Ttpal 3 152.2783041 296349 + 152.2783041 152.296513 alpha tocopherol transfer protein-like None FGPFIARKVIGILQDGFPIR None None 41562 16.34 14.21 16.54 15.68 15.64 15.88 16.8 16.51 16.7 16.87 17.1 15.66 15.92 16.19 15.87 16.51 16.75 16.24 16.65 14.56 15.97 16.25 16.97 15.43 14.98 15.42 15.52 17.0 15.69 16.16 16.02 Q5U2V2 Serinc3 3 152.3018861 296350 - 152.3018861 152.321327 serine incorporator 3 None GIQTQLKKIPGFCEGEFQIK None 607165 38230 16.48 13.46 15.08 15.42 16.14 17.15 16.43 14.67 16.05 16.1 16.16 16.41 16.14 15.36 14.69 16.85 16.48 15.28 16.72 15.34 15.9 15.61 16.41 14.91 14.05 15.66 14.46 16.08 16.67 16.17 15.74 Q6YH22 Pkig 3 152.330541 266709 + 152.330541 152.398082 camp-dependent protein kinase inhibitor None TGRRNAVPDIQGDSEAVSVR None 604932 5133 15.08 13.26 14.8 14.92 14.87 14.97 15.57 14.46 15.26 13.98 14.92 14.9 15.27 14.76 14.13 14.98 16.16 15.12 14.18 14.31 15.76 14.75 15.32 15.52 15.35 15.62 14.42 14.3 15.13 15.17 15.45 Q920P6 Ada 3 152.3987481 24165 - 152.3987481 152.422854 adenosine deaminase None VHAGEVGSAEVVREAVDILK None 608958 13827 17.43 15.77 17.38 17.68 17.25 15.72 17.74 18.29 17.0 17.87 18.6 16.54 16.39 16.9 16.28 16.73 16.03 18.06 17.56 17.21 16.07 16.76 17.22 17.29 16.15 16.26 17.19 16.8 15.78 17.4 17.79 Q8CIX1 Rims4 3 152.5249451 266976 - 152.5249451 152.584754 regulating synaptic membrane exocytosis protein 4 None LKGAIQRSTETGLAVEMPSR None None None 14.67 13.29 14.34 15.62 14.87 14.2 14.94 14.16 15.86 14.4 14.31 16.2 15.41 15.67 14.14 14.25 15.43 15.13 15.55 13.86 15.91 14.18 15.14 14.25 14.4 14.28 14.45 16.02 14.73 15.64 15.79 P35213 Ywhab 3 152.6596511 56011 + 152.6596511 152.682105 14-3-3 protein beta/alpha None DVLELLDKYLILNATHAESK None 601289 20724 24.76 26.25 24.26 24.65 24.32 24.39 25.38 24.91 24.4 25.25 23.5 23.74 24.46 23.6 23.07 25.55 24.04 25.22 24.47 25.13 23.74 24.5 23.96 24.19 24.01 26.05 23.6 25.23 23.43 23.98 24.71 Q3KRD5 Tomm34 3 152.7293471 311621 - 152.7293471 152.746191 mitochondrial import receptor subunit tom34 None APKVSDSVEQLRAAGNQNFR None None 4956 20.13 17.84 17.9 19.31 19.47 19.01 19.91 19.59 17.84 18.1 18.94 18.91 19.71 18.43 18.03 19.97 19.4 19.4 19.42 18.34 17.04 18.45 18.87 19.1 20.29 19.94 18.72 19.05 17.82 18.97 19.28 D4A648 Stk4 3 152.7486011 311622 + 152.7486011 152.827744 non-specific serine/threonine protein kinase None QLRNPPRRQLKKLDEDSLTK None 604965 55965 17.28 16.56 17.63 16.97 16.11 17.36 16.78 16.34 16.46 16.01 18.0 16.32 16.8 17.11 18.17 15.47 17.23 16.29 16.84 15.53 18.11 17.15 17.21 17.01 17.72 15.51 17.98 16.56 15.63 16.84 17.34 D3ZMS3 Matn4 3 153.1206061 296358 - 153.1206061 153.135628 matrilin 4 None SEERVPRVLVIVTDGRPQDR None None None 16.83 18.88 17.13 16.92 16.54 17.71 15.46 16.29 16.16 16.68 17.44 16.56 15.86 17.91 16.5 17.81 17.95 17.19 15.57 17.74 16.67 17.02 16.59 18.13 18.17 16.99 17.1 16.31 17.66 16.39 17.08 P34901 Sdc4 3 153.1548891 24771 - 153.1548891 153.173576 syndecan-4 None TFPEVISPLVPLDNHIPENAQPGIR None 600017 31121 18.49 16.56 17.82 18.14 17.97 19.69 17.55 16.92 18.3 18.56 18.71 19.17 18.6 19.02 18.41 18.88 18.95 17.83 18.91 17.97 19.29 18.13 19.12 18.8 17.46 18.48 19.84 17.75 17.76 18.72 18.84 Q331S7 Dbndd2 3 153.2178931 499941 + 153.2178931 153.22065 dysbindin domain-containing 2 None TSDRTTSRTSSLSSDSSNLR None None None 17.46 15.68 17.48 16.24 18.42 16.94 16.35 17.14 17.73 15.87 17.29 17.66 17.48 17.87 16.61 16.27 18.07 15.73 18.11 17.26 17.3 17.03 17.14 17.34 17.24 16.03 18.1 16.27 17.29 17.54 18.1 D4A604 Pigt 3 153.2275441 296360 + 153.2275441 153.236923 phosphatidylinositol glycan anchor biosynthesis, class t None FQFRTRWDSDLQREGVSHYR None None 6134 17.42 18.94 17.32 18.16 18.26 15.55 17.23 18.13 17.37 17.27 16.5 16.68 17.12 16.78 17.25 17.48 17.28 16.7 17.27 17.2 16.4 15.95 16.53 17.63 18.55 18.13 16.44 17.58 17.55 16.77 17.01 Q304F3 Tnnc2 3 153.5132531 296369 - 153.5132531 153.516016 rcg32327 None MFDADGGGDISVKELGTVMR None 191039 55727 23.24 21.72 23.12 21.77 21.73 23.07 22.14 22.3 23.42 23.9 23.33 21.67 23.04 23.49 22.51 21.88 22.93 22.95 22.25 22.72 23.9 23.51 23.17 22.79 21.22 22.41 23.05 22.41 23.41 22.59 22.75 F7F557 Acot8 3 153.5300911 170588 - 153.5300911 153.542816 acyl-coenzyme a thioesterase 8 Pte1 None None None None 17.47 15.51 17.43 17.79 17.55 18.5 17.25 17.25 18.31 16.21 17.75 17.68 17.39 16.65 16.87 17.72 17.45 18.05 16.29 18.0 17.34 17.46 17.53 16.43 17.01 16.24 16.74 17.44 19.04 18.89 17.64 Q8VHK0 Acot8 3 153.5300911 170588 - 153.5300911 153.542816 acyl-coenzyme a thioesterase 8 None IEIKLVNPPALNQLQTLEPK None 608123 3991 17.44 15.49 17.34 17.77 17.53 18.36 17.22 17.22 17.92 15.71 17.8 17.62 17.36 16.63 16.85 17.69 17.42 18.03 16.26 17.97 17.32 17.43 17.5 16.4 17.79 16.6 16.72 17.41 19.01 18.86 17.61 Q6AYS3 Ctsa 3 153.5693191 296370 + 153.5693191 153.574981 carboxypeptidase None GRDRSEDTLVVQDFGNIFTR None 613111 None 17.87 17.8 16.89 16.2 16.38 17.77 18.34 17.23 18.05 18.05 17.12 18.04 16.96 17.59 15.77 17.69 17.09 18.56 17.37 17.81 18.01 17.85 16.58 16.21 15.81 16.85 16.89 17.13 18.0 16.82 17.47 E9PSP1 Pltp 3 153.5748261 296371 - 153.5748261 153.592647 phospholipid transfer protein None LRFLEQELEDINIPDVYGAK None 172425 4536 16.44 15.18 16.6 16.26 16.67 16.65 16.78 15.58 17.24 16.05 16.43 16.55 16.21 17.02 15.54 15.6 15.63 17.02 16.88 17.91 17.41 16.58 16.47 15.54 16.15 15.96 16.1 17.13 16.7 17.05 17.93 D4A417 Pcif1 3 153.6141481 362269 + 153.6141481 153.627079 pdx1 c-terminal-inhibiting factor 1 None FSKLWLLYRYSCVDDSAFER None None 11134 16.23 15.45 16.65 16.41 16.51 15.92 16.75 16.12 16.86 15.57 15.91 16.88 16.73 16.59 17.11 15.76 15.48 15.93 17.13 17.33 18.31 16.68 16.5 15.18 17.67 16.43 16.71 17.68 16.37 17.0 18.0 Q63633 Slc12a5 3 153.6965771 171373 + 153.6965771 153.733566 solute carrier family 12 member 5 None LQAISRDGIVPFLQVFGHGK None 606726 10665 21.89 21.52 21.37 21.88 21.43 20.95 21.17 20.98 22.44 21.22 21.83 22.32 21.84 22.84 22.04 20.49 21.71 21.37 22.67 20.11 22.75 21.24 21.78 21.79 21.21 21.48 22.0 22.24 21.28 21.99 22.02 D3ZEI6 Ncoa5 3 153.7364311 296372 - 153.7364311 153.769553 nuclear receptor coactivator 5 None FRDLRDSRDFRDHRDPVYDR None None 32496 17.42 16.19 17.64 17.88 17.25 16.1 16.46 16.75 18.27 17.22 16.73 17.09 17.9 18.17 19.0 17.13 18.49 16.97 16.78 16.82 19.18 17.53 17.94 18.59 18.89 18.13 18.45 16.92 17.35 17.82 18.47 Q63315 Cdh22 3 153.8462021 29182 - 153.8462021 154.034382 cadherin-22 None EPLYVGKIHSDSDEGDGTIK None 609920 23148 14.16 16.09 15.69 15.54 16.34 14.59 15.63 15.05 15.39 15.26 14.43 16.04 16.07 15.15 14.05 14.96 14.64 15.88 15.9 16.06 15.24 15.13 14.27 15.06 14.98 15.59 15.39 16.03 14.16 16.06 15.95 G3V982 Elmo2 3 153.8607911 362271 - 153.8607911 154.072385 engulfment and cell motility 2, ced-12 homolog (c. elegans), isoform cra_b None IQLLNKTWKEMRATAEDFNK None 606421 44338 18.73 18.61 18.66 18.27 18.42 19.5 18.45 17.79 19.27 18.25 19.24 18.99 19.08 19.08 19.91 19.89 19.27 18.39 19.63 17.31 19.93 18.46 19.33 19.08 19.48 19.07 19.71 19.43 18.08 18.46 19.45 Q9Z0Z5 Slc13a3 3 154.1418581 64846 - 154.1418581 154.204599 solute carrier family 13 member 3 None MSWRGWRKKNSKLQDVAEDK None 606411 11266 16.13 13.51 14.81 16.7 16.68 14.25 16.85 14.93 15.18 15.82 17.21 15.55 16.52 14.55 17.46 16.55 14.99 15.34 15.38 15.13 16.47 14.65 16.15 16.06 16.61 15.9 14.64 16.68 14.55 16.28 16.08 A8C4G9 Zmynd8 3 154.5289561 296374 - 154.5289561 154.629576 spikar None SSSTEKSKDSNSTLDLSGSR None None None 15.88 15.24 16.33 15.86 15.68 16.14 14.86 15.95 16.17 14.43 15.77 16.51 16.45 16.76 15.51 15.89 16.82 17.26 15.37 16.33 17.77 16.42 16.28 16.88 17.7 16.86 16.84 15.55 17.41 16.64 17.53 D3ZS72 Prex1 3 155.3073461 311647 - 155.3073461 155.456583 phosphatidylinositol-3,4,5-trisphosphate-dependent rac exchange factor 1 None QLDENSVANTNVFYHIEGSR None None None 17.91 16.59 19.1 17.9 17.89 17.78 18.24 17.51 19.12 17.63 16.99 18.88 18.64 18.52 18.88 17.42 17.9 18.22 19.18 16.71 19.84 18.21 18.28 18.31 17.74 17.71 19.17 18.6 16.54 18.74 19.26 Q7TSU1 Arfgef2 3 155.547611 296380 + 155.547611 155.633666 brefeldin a-inhibited guanine nucleotide-exchange protein 2 None ELAQLIGTGVKTRYLSGSGR None 605371 111880 19.67 19.22 19.18 17.77 17.7 17.9 18.29 17.88 18.9 18.5 19.27 17.44 17.58 18.95 19.51 18.5 18.78 18.7 18.97 16.79 20.3 18.61 18.46 18.81 19.19 18.14 18.59 18.82 18.33 18.1 18.56 D3ZPR0 Cse1l 3 155.641181 362273 + 155.641181 155.678855 chromosome segregation 1-like protein None EDNSEEYIRRDLEGSDIDTR None 601342 1006 19.74 18.67 20.1 19.1 18.6 20.18 19.5 19.69 19.74 18.69 19.55 18.74 19.65 19.58 19.83 18.47 19.38 19.78 20.03 18.2 20.56 20.2 19.48 19.23 19.21 19.3 19.79 19.68 19.07 19.76 20.53 Q9ET50 Stau1 3 155.6800011 84496 - 155.6800011 155.725909 staufen double-stranded rna-binding protein 1 None NKKVAKRNAAENMLEILGFK None None 3384 17.39 14.77 15.88 16.93 16.43 16.24 15.55 16.16 16.83 16.94 18.15 17.23 17.05 17.75 17.69 16.23 17.28 16.61 17.13 14.92 17.7 16.35 17.36 17.63 16.54 15.95 17.06 15.95 17.22 17.3 16.61 Q7TP99 Znfx1 3 155.7640741 296384 - 155.7640741 155.824695 ab1-133 None IVIVEEAAEVLEAHTIATLSK None None None 17.31 14.7 16.55 16.68 15.75 16.06 16.18 16.74 16.54 15.8 16.74 16.39 16.24 16.94 16.14 15.28 17.39 16.43 16.82 15.01 17.77 17.42 17.11 16.85 17.89 16.61 15.33 16.51 17.4 16.86 16.98 P15387 Kcnb1 3 155.827751 25736 - 155.827751 155.913187 potassium voltage-gated channel subfamily b member 1 None ARSIEMMDIVVEKNGESIAK None 600397 37988 16.71 16.08 15.26 16.96 15.65 16.07 15.46 15.42 16.78 16.42 16.33 16.37 16.05 16.87 15.35 15.7 16.28 16.52 17.41 15.25 17.38 15.98 17.11 15.25 16.23 16.86 16.55 16.32 17.61 15.9 15.59 Q62969 Ptgis 3 155.9285651 25527 - 155.9285651 155.964228 prostacyclin synthase None FDLSRYGFGLMQPEEDVPIR None 601699 37374 16.03 14.42 15.86 16.34 16.82 14.25 16.34 16.97 14.86 15.11 17.13 15.58 16.61 15.38 16.76 16.1 14.47 16.15 16.12 15.18 14.97 14.98 16.51 15.18 17.23 16.4 14.46 16.54 17.08 16.71 15.76 Q66HP6 Spata2 3 156.2046041 114210 - 156.2046041 156.213001 spermatogenesis-associated protein 2 None GIHSQVKDKGYSELDVVTER None 607662 4407 17.08 16.31 16.08 16.46 15.98 16.79 16.13 16.29 17.63 16.18 16.33 16.76 16.66 16.78 16.19 16.75 17.18 16.77 16.76 15.35 17.22 17.2 16.9 17.52 16.66 16.26 15.87 16.79 16.9 15.91 17.68 Q6J2U6 Rnf114 3 156.2224831 362277 + 156.2224831 156.234251 e3 ubiquitin-protein ligase rnf114 None TKSVVCPICASMPWGDPSYR None 612451 10265 15.02 15.58 15.79 16.38 16.57 16.56 17.84 16.63 16.83 17.05 16.1 17.08 17.26 15.53 16.79 16.56 15.49 16.22 17.54 16.16 16.98 16.13 17.25 16.67 15.06 16.26 15.5 16.6 15.37 16.41 15.99 D3ZFY8 Ube2v1 3 156.317341 100912618 - 156.317341 156.340198 ubiquitin-conjugating enzyme e2 variant 1-like None GVGDGTVSWGLEDDEDMTLTR None None None 20.8 20.0 20.98 20.52 21.21 20.82 21.63 21.03 19.45 19.21 21.5 20.28 20.75 20.37 19.72 19.7 20.51 20.7 20.92 20.59 19.56 21.26 21.21 20.44 21.88 20.51 20.62 21.08 18.81 21.77 20.13 P20417 Ptpn1 3 156.6388121 24697 + 156.6388121 156.685127 tyrosine-protein phosphatase non-receptor type 1 None AVIEGAKFIMGDSSVQDQWK None 176885 2119 16.73 15.12 16.46 17.58 16.49 16.57 15.89 16.17 16.3 17.74 16.37 17.14 17.28 17.39 18.1 17.23 16.54 16.87 17.65 15.6 17.42 16.96 17.49 17.07 17.51 17.98 17.8 18.14 16.24 17.14 17.41 Q9JKL8 Adnp 3 156.8913921 64622 - 156.8913921 156.918044 activity-dependent neuroprotector homeobox protein None VEKMAAHMRMVHIDEEMGPK None None 7617 15.93 15.17 17.34 16.91 16.4 15.6 15.77 15.71 17.22 16.13 15.9 16.71 16.88 16.41 17.86 16.75 17.18 15.66 16.79 15.43 18.38 16.48 16.68 17.83 16.56 17.08 17.16 16.29 16.53 17.1 18.08 D4A8N1 Dpm1 3 156.919981 296394 - 156.919981 156.939522 dolichol-phosphate mannosyltransferase subunit 1 None VRARQMDYTVGEVPISFVDR None 603503 2865 17.1 15.95 18.81 17.61 15.37 16.89 16.68 17.57 17.79 18.7 17.45 16.61 17.41 18.04 18.49 17.09 16.67 18.0 17.89 16.19 18.72 17.31 17.6 17.99 15.88 17.26 18.27 16.7 17.35 18.23 18.35 D4A8L5 Mocs3 3 156.9397641 311655 + 156.9397641 156.941711 adenylyltransferase and sulfurtransferase mocs3 None QKAVRVLQSLTAVPELDSLK None None 6108 18.14 15.51 16.14 16.48 16.15 15.84 17.33 16.57 15.65 15.61 15.88 16.54 15.82 16.85 16.51 16.06 16.15 17.53 16.17 15.25 15.61 15.83 16.46 15.7 18.06 17.01 16.52 16.3 15.53 16.38 16.47 M0R6E0 Atp9a 3 157.3688461 84011 - 157.3688461 157.433835 phospholipid-transporting atpase None PTVTTKVRRTMSSRVHEAVK None None None 18.73 17.08 18.01 18.16 17.29 18.58 19.05 17.29 18.23 19.96 18.16 18.08 18.64 18.54 19.01 17.2 18.18 17.78 18.92 16.78 18.75 19.08 18.61 17.57 17.0 17.72 17.79 18.03 18.64 19.17 17.45 A0A0G2K079 Bcas1 3 159.1362351 246755 - 159.1362351 159.21192 breast carcinoma-amplified sequence 1 homolog None TLQTVDLTEKETQTEPTDVK None 602968 2714 22.23 21.05 20.25 20.66 21.56 21.65 20.85 21.37 19.61 20.51 21.83 20.15 20.32 20.73 19.81 21.26 21.32 20.52 20.26 22.18 19.51 20.47 20.91 20.7 22.31 20.9 20.61 19.52 22.43 21.52 19.71 Q3ZB98 Bcas1 3 159.1362351 246755 - 159.1362351 159.21192 breast carcinoma-amplified sequence 1 homolog None ANLKSDKADLTPQETQGTAK None 602968 2714 22.17 20.24 20.22 20.52 21.45 21.46 20.85 21.2 19.4 20.32 21.69 20.05 20.35 20.57 19.69 21.12 21.18 20.33 20.17 21.98 19.32 20.31 20.93 20.46 22.17 20.68 20.45 19.34 22.24 21.52 19.71 M0R5N4 Pfdn4 3 159.3031461 100366237 + 159.3031461 159.311269 prefoldin subunit 4 None ATMKKAAAEDVNVTFEDQQK None None None 18.95 17.88 19.58 18.78 18.65 19.02 18.49 18.56 17.97 18.31 19.04 17.69 18.91 18.38 16.92 17.69 18.6 18.58 18.22 19.65 17.5 18.75 18.73 17.68 18.94 17.35 18.26 18.6 18.7 19.27 18.28 B2RYM8 Fam210b 3 161.1182731 296408 + 161.1182731 161.126645 family with sequence similarity 210, member b None PFLVRYFRSVGLFKPPAAKP None None None 17.41 15.66 14.49 16.3 17.56 16.47 17.06 16.04 17.51 17.44 17.23 17.1 17.75 16.77 16.91 16.55 16.04 16.19 18.5 17.15 18.09 17.54 17.22 17.49 17.13 17.37 15.77 17.29 17.33 17.53 17.34 Q5BJQ6 Cstf1 3 161.1448521 311670 + 161.1448521 161.156292 cleavage stimulation factor subunit 1 None ITTFEKAHDGAEVCSAIFSK None None 1012 15.01 13.61 15.66 15.5 15.5 15.14 14.05 15.5 15.45 14.43 15.81 15.54 15.54 15.39 16.4 13.9 14.72 15.12 14.36 15.77 16.78 14.99 15.64 15.41 15.85 14.24 16.13 15.21 15.57 15.72 15.96 Q3T1J8 Rtfdc1 3 161.2079991 296410 + 161.2079991 161.237687 replication termination factor 2 None SAGPSKAKAGKSEEADPDPR None None None 14.3 14.93 15.27 15.16 14.99 15.0 15.62 15.6 15.75 14.38 15.32 15.59 15.24 14.93 16.4 14.13 14.3 14.62 15.21 15.98 16.09 15.93 14.74 14.85 15.09 14.88 14.47 15.51 16.13 15.43 16.48 Q3SWS8 Rae1 3 161.779261 362281 + 161.779261 161.794038 mrna export factor None VLDVCWSDDGSKVFTASCDK None None 2676 17.49 15.83 17.37 16.98 16.44 16.93 16.71 17.33 17.01 16.96 16.41 16.7 17.04 17.49 18.19 16.18 17.79 16.87 16.46 15.65 17.51 17.25 16.4 17.88 18.14 16.22 17.77 16.9 15.94 17.72 18.16 B0BN19 Rab22a 3 162.4597481 366265 + 162.4597481 162.506137 rab22a, member ras oncogene family None VCLLGDTGVGKSSIVWRFVE None 612966 10782 18.69 16.91 18.17 17.68 17.59 19.25 18.14 17.55 17.28 18.75 17.08 17.87 18.34 18.63 18.51 17.59 18.46 18.33 16.82 19.07 18.24 18.38 18.24 17.21 18.63 19.12 19.0 17.93 17.85 18.72 18.5 Q9Z269 Vapb 3 162.5360331 60431 + 162.5360331 162.572743 vesicle-associated membrane protein-associated protein b None TEAPVAAKPLTSPLDDAEVK None 605704 36163 20.14 21.79 20.61 20.27 20.94 20.04 20.25 19.44 20.07 19.64 21.2 19.17 19.59 19.9 19.88 20.37 20.26 20.1 18.99 21.43 19.5 19.93 19.58 19.96 21.27 19.89 19.84 19.11 21.51 20.05 19.31 A0A0G2K528 Stx16 3 162.8537851 362283 + 162.8537851 162.882522 syntaxin 16 None LRNVVASLAQALQELSTSFR None 603666 2791 18.04 15.36 17.05 17.98 16.98 16.87 17.01 17.18 17.28 18.18 17.73 17.57 17.34 17.75 17.23 16.83 16.56 17.92 17.53 17.86 18.73 17.54 17.79 17.45 16.68 17.94 16.92 17.21 18.65 18.19 18.06 D4A3E2 Npepl1 3 162.8946521 311671 + 162.8946521 162.906492 aminopeptidase-like 1 None QTIAWVGKGIVYDTGGLSIK None None 11647 17.49 15.5 16.63 16.91 16.44 15.68 17.71 17.97 15.57 16.39 16.8 15.08 15.84 15.96 15.47 16.2 15.88 16.09 16.34 17.82 15.91 16.0 16.13 15.08 16.86 17.72 16.29 15.87 16.77 15.79 17.83 Q63803 Gnas 3 163.0714181 24896 + 163.0714181 163.127262 guanine nucleotide-binding protein g(s) subunit alpha isoforms xlas None AEKVLAGKSKIEDYFPEFAR None 139320 55534 19.7 18.2 20.49 19.84 18.16 18.34 20.34 19.38 19.29 20.05 19.26 18.09 19.77 18.6 18.14 19.65 19.18 20.15 18.65 20.11 19.55 19.26 19.0 18.2 19.39 19.2 19.27 19.53 18.82 18.94 19.15 P63095 Gnas 3 163.0850151 24896 + 163.0850151 163.135975 guanine nucleotide-binding protein g(s) subunit alpha isoforms short None ETKFQVDKVNFHMFDVGGQR None 139320 55534 19.8 18.72 20.72 19.79 17.86 19.21 20.36 19.29 19.15 19.92 19.59 17.93 19.82 18.99 18.34 19.5 19.21 20.18 18.63 20.24 19.84 19.37 19.02 18.3 18.92 19.63 19.6 19.41 18.81 19.1 19.16 Q9R1T3 Ctsz 3 163.2248761 252929 - 163.2248761 163.235645 cathepsin z None QAKDQECDKFNQCGTCTEFK None 603169 1022 15.2 15.62 16.35 16.71 16.35 16.07 16.6 17.64 17.26 17.39 16.25 17.03 17.26 15.68 17.75 16.39 15.47 17.21 17.2 16.12 17.49 16.8 17.18 16.86 15.26 16.12 17.2 17.25 15.29 16.43 17.35 M0R8B6 Tubb1 3 163.2479741 679312 + 163.2479741 163.255822 tubulin beta chain None PGQLNADLRKLAVNMVPFPR None None None 22.32 24.38 23.38 23.86 23.67 24.35 23.73 23.6 24.13 24.92 23.03 24.32 24.26 22.95 24.68 24.41 24.3 23.7 23.53 22.64 24.12 24.51 24.34 24.62 22.56 23.97 22.87 23.09 25.08 23.13 23.23 P29418 Atp5f1e 3 163.2590731 245958 - 163.2590731 163.261977 atp synthase subunit epsilon None VAYWRQAGLSYIRFSQICAK None 606153 106215 18.82 20.92 19.69 20.46 20.8 20.05 18.9 20.63 21.09 21.14 19.66 21.02 20.8 19.95 21.48 20.83 20.87 19.44 19.63 19.96 20.6 20.29 20.83 21.56 19.07 20.31 20.54 20.66 20.71 19.86 20.07 Q6RFY2 Phactr3 3 165.3432811 362284 + 165.3432811 165.423669 phosphatase and actin regulator 3 None SKATKNVTGQAALFQGSSMK None None 14482 17.49 16.88 16.78 17.87 17.74 16.86 16.42 16.99 17.6 17.6 16.49 16.41 17.25 16.66 15.97 17.55 16.58 18.3 17.27 16.9 16.7 17.28 17.41 18.02 17.22 17.96 17.51 17.35 16.23 16.25 17.43 D3ZSF0 Fam217b 3 165.5056411 311692 + 165.5056411 165.5154 family with sequence similarity 217, member b None RVSSQPRSSLLGISQPAADK None None None 16.25 15.09 15.72 15.47 16.08 15.8 14.38 15.63 16.09 16.05 14.34 14.69 16.21 14.49 15.05 16.43 15.95 15.16 16.81 14.77 14.85 15.51 15.17 15.8 15.91 16.4 16.1 15.46 16.62 15.66 15.71 A0A0G2K728 Cdh4 3 166.8782291 114588 + 166.8782291 166.999997 cadherin-4 None YDEEGGGEEDQDYDLSQLQQPEAMEHVLSK None None None 18.21 17.68 19.24 17.66 17.14 17.77 18.61 17.39 18.35 18.06 18.25 17.13 19.07 18.15 16.75 18.29 19.06 18.58 18.09 17.93 18.37 19.4 18.29 17.81 18.07 17.48 16.76 17.76 19.48 18.27 17.82 Q63149 Cdh4 3 166.8782291 114588 + 166.8782291 166.999997 cadherin-4 None NLTVMDRDQPHSPNWNAVYR None None None 15.66 16.02 16.96 15.19 14.95 15.56 16.48 15.81 14.99 15.65 15.74 14.84 15.38 16.44 15.38 15.49 15.91 15.93 16.2 15.61 15.38 16.38 15.07 15.43 15.72 16.06 15.5 15.51 14.71 15.57 15.56 A0A0G2JZY0 Lsm14b 3 167.1258661 100362102 + 167.1258661 167.134847 lsm family member 14b None PNCYYDKSKSFFDNISSELK None None None 17.68 15.73 16.85 17.96 17.25 17.82 16.51 16.5 18.36 17.87 16.94 18.22 17.38 17.55 17.09 16.63 16.82 18.59 17.44 17.25 17.73 18.38 17.79 17.1 15.89 17.35 17.49 17.36 18.94 17.78 18.69 A0A0G2K0W9 Psma7 3 167.1372771 29674 - 167.1372771 167.143637 proteasome subunit alpha type None AWKANAIGRGAKSVREFLEK None 606607 105299 20.15 22.51 21.23 20.09 19.66 20.28 20.8 20.79 19.57 19.61 21.07 20.93 20.4 19.54 19.62 20.33 19.74 21.23 20.25 22.18 21.6 21.62 19.75 20.58 21.29 21.13 20.38 19.91 21.02 20.0 20.81 P48004 Psma7 3 167.1372771 29674 - 167.1372771 167.143637 proteasome subunit alpha type-7 None KGSTAVGVRGRDIVVLGVEK None 606607 105299 20.18 22.47 21.07 21.17 21.07 19.52 20.54 21.79 19.35 19.68 20.91 20.91 20.47 19.08 19.98 21.38 19.51 21.43 20.34 21.92 19.56 20.36 19.72 21.12 21.1 21.6 20.71 20.05 20.58 20.01 20.81 Q91XJ0 Ss18l1 3 167.1439951 192352 + 167.1439951 167.162464 calcium-responsive transcription coactivator None AFASARPRGKGEVTQQTIQK None 606472 9191 14.89 16.44 15.05 16.07 15.02 14.81 15.47 15.86 17.12 14.85 15.61 17.01 15.87 16.69 14.92 15.8 17.09 15.52 16.36 16.34 17.59 16.03 15.99 16.3 16.01 16.9 15.03 15.73 17.72 15.57 15.83 Q5BK47 Osbpl2 3 167.2109461 296461 + 167.2109461 167.256217 oxysterol-binding protein None KQEKRGDHARKAKSDDAPEK None 606731 77324 17.71 19.62 18.18 17.69 16.81 18.84 19.01 19.2 18.44 19.39 18.72 18.51 17.62 18.35 18.15 18.63 18.08 19.43 18.44 18.81 19.15 18.81 18.09 18.56 17.09 18.98 19.19 18.61 16.67 18.09 18.56 Q9JMB5 Adrm1 3 167.2654291 65138 + 167.2654291 167.270201 proteasomal ubiquitin receptor adrm1 None DPKEGDTKDKKDEEEDMSLD None None 10513 18.84 17.87 19.37 19.35 17.98 18.47 18.96 19.94 19.18 19.19 18.49 18.08 19.1 19.01 19.75 17.51 19.12 19.22 19.04 17.76 18.93 18.43 19.08 18.44 18.82 18.92 19.1 19.33 17.91 19.15 19.34 P05765 Rps21 3 167.3466361 81775 + 167.3466361 167.347309 40s ribosomal protein s21 None RIIAAKDHASIQMNVAEVDR None 180477 90915 19.12 20.93 18.43 19.62 18.96 18.41 17.98 19.86 19.73 19.09 20.48 20.09 18.95 19.21 20.72 19.28 19.75 19.27 18.99 19.1 19.95 19.32 18.65 20.3 19.0 19.8 20.36 18.66 19.94 18.79 19.61 Q9QXY4 Ogfr 3 167.6062151 83525 + 167.6062151 167.704587 opioid growth factor receptor None QKDGNGPEDSNSQVGAEDSK None None 7199 17.01 14.77 17.73 16.43 15.95 16.35 17.33 16.13 17.14 16.25 16.17 16.03 17.25 16.98 16.68 17.11 16.76 17.06 17.48 15.68 17.52 16.97 16.92 16.37 17.83 16.94 17.98 16.8 15.62 16.75 17.43 D3ZWL9 Dido1 3 167.7725361 362286 - 167.7725361 167.807015 death inducer-obliterator 1 None GDLSNEEAPKAIKPTSKEFR None None 34139 15.33 14.82 16.41 16.03 15.53 15.36 14.85 15.01 16.47 14.36 14.76 15.65 15.73 15.87 15.98 15.39 16.07 15.5 15.91 14.82 17.07 15.95 15.35 15.76 16.96 15.75 15.25 15.99 16.72 15.88 17.3 Q6YDN8 Gid8 3 167.8261371 296466 + 167.8261371 167.832653 bwk-1 None KKVKYPKMTDLSKGVIEEPK None None None 17.24 14.89 16.36 17.56 17.62 16.98 15.98 15.52 17.14 16.57 17.24 18.49 17.38 17.07 16.07 16.84 16.52 17.41 17.37 16.41 17.08 17.24 17.53 17.29 16.78 16.02 16.24 16.63 18.6 17.42 17.18 Q4V8J6 Ythdf1 3 168.0246641 296467 - 168.0246641 168.040172 yth n(6)-methyladenosine rna-binding protein 1 None GTLPPPPIKHNMDIGTWDNK None None 9844 17.51 16.21 17.16 18.31 17.36 17.69 16.98 17.47 18.84 16.38 17.62 18.27 18.26 18.81 19.16 16.59 17.38 18.22 17.57 16.43 18.65 17.62 18.55 18.43 18.33 17.83 18.97 17.87 16.6 17.95 18.46 A0A0G2KAP3 Nkain4 3 168.0532941 296469 - 168.0532941 168.073911 sodium/potassium-transporting atpase-interacting 4 None SLSRHRSWWEEYGPDCLHEK None 612873 10978 16.22 15.03 16.53 15.91 15.97 15.17 16.23 15.63 16.25 15.91 16.17 15.14 16.16 17.64 15.07 14.4 17.52 15.65 16.29 15.35 16.01 15.83 15.7 14.86 16.72 15.65 16.48 16.12 15.83 16.59 16.54 Q3S4A4 Arfgap1 3 168.0846431 246310 + 168.0846431 168.098675 adp-ribosylation factor gtpase activating protein 1 heart isoform None TLQFTAHRPAGQPQNVTTSGDK None 608377 5517 19.9 18.41 19.8 20.24 18.65 19.83 18.92 18.13 20.8 18.87 18.76 19.55 19.71 20.56 18.72 18.69 20.08 20.5 18.65 19.32 20.08 19.67 19.61 18.57 19.07 18.79 20.61 19.43 19.69 19.76 19.64 Q62848 Arfgap1 3 168.0846431 246310 + 168.0846431 168.098675 adp-ribosylation factor gtpase-activating protein 1 None VKEGRIFDDVSSGVSQLASK None 608377 5517 19.86 18.0 19.8 20.24 18.65 19.83 18.92 18.13 20.8 18.87 18.76 19.55 19.73 20.56 18.72 18.69 20.08 20.5 18.65 19.32 20.08 19.67 19.71 18.57 19.07 18.79 20.61 19.43 19.69 19.76 19.77 P09483 Chrna4 3 168.1362671 25590 - 168.1362671 168.157089 neuronal acetylcholine receptor subunit alpha-4 None LSPALTRAVEGVQYIADHLK None 118504 592 15.56 16.87 14.45 14.89 15.33 13.53 14.78 15.44 15.64 16.43 15.12 15.53 14.79 16.34 15.0 15.69 16.68 15.14 14.57 15.09 15.21 16.52 16.48 14.88 15.65 16.37 15.35 16.75 15.57 14.49 14.76 F1M6X3 Kcnq2 3 168.1987881 170848 - 168.1987881 168.25374 potassium voltage-gated channel subfamily kqt member 2 None SRQNSEEASLPGEDIVEDNK None 602235 26174 17.93 16.07 17.1 17.09 16.68 18.68 17.13 16.46 17.41 16.71 18.1 17.18 17.37 18.11 17.03 17.6 18.61 17.44 17.66 15.94 16.89 18.24 17.69 17.33 17.08 18.18 17.14 17.4 18.13 18.12 17.21 O88943 Kcnq2 3 168.1987881 170848 - 168.1987881 168.25374 potassium voltage-gated channel subfamily kqt member 2 None GAPDSTRDGALLIAGSEAPK None 602235 26174 17.93 16.07 17.1 17.09 16.68 18.68 17.22 16.46 17.41 16.71 18.1 17.18 17.37 18.11 17.03 17.6 18.61 17.44 17.66 15.94 16.89 18.24 17.69 17.34 17.08 18.18 17.14 17.35 18.08 18.12 17.21 P62632 Eef1a2 3 168.2658971 24799 - 168.2658971 168.275071 elongation factor 1-alpha 2 None AELKEKIDRRSGKKLEDNPK None 602959 121568 23.37 25.26 23.57 23.86 23.8 22.38 24.31 24.46 22.49 23.54 22.7 22.46 22.74 23.02 23.43 23.35 23.15 23.44 24.0 22.8 22.51 22.89 22.58 22.32 24.15 24.54 24.33 23.68 22.35 22.95 23.35 A0A0G2K8P5 Stmn3 3 168.4168161 29246 - 168.4168161 168.42496 stathmin Sclip None None None None 20.86 18.51 19.6 21.09 20.28 19.65 19.96 20.53 19.64 20.82 19.56 20.12 21.0 21.22 19.32 20.52 21.82 20.27 19.36 20.72 19.95 19.24 20.8 21.21 20.85 22.13 19.32 20.75 20.97 20.8 20.45 D3ZI49 Stmn3 3 168.4168161 29246 - 168.4168161 168.42496 stathmin None REHEREVLHKALEENNNFSR None 608362 7528 20.86 18.51 19.6 21.09 20.28 19.65 19.96 20.53 19.64 20.82 19.56 20.12 21.0 21.22 19.32 20.52 21.82 20.27 19.36 20.72 19.95 19.24 20.8 21.21 20.85 22.13 19.32 20.75 20.97 20.8 20.45 Q9JHU6 Stmn3 3 168.4168161 29246 - 168.4168161 168.42496 stathmin-3 None SPVLSSPPKRKDASLEELQK None 608362 7528 20.84 18.44 19.42 21.31 20.79 19.55 20.12 20.99 19.51 20.58 19.72 20.24 21.05 20.28 19.7 21.01 22.07 19.96 19.54 20.63 19.07 19.41 20.82 21.06 21.0 22.12 19.27 20.8 20.98 20.81 20.42 Q63055 Arfrp1 3 168.4679691 117051 - 168.4679691 168.473914 adp-ribosylation factor-related protein 1 None KYYAECHGVIYVIDSTDEER None None 2425 16.43 16.95 14.7 16.51 15.62 15.05 16.5 15.47 15.55 16.29 16.69 16.96 15.98 16.52 17.19 16.55 16.65 16.44 16.54 14.67 17.09 17.12 15.65 16.55 16.96 17.44 15.93 16.55 16.27 15.85 16.9 Q5PPF5 Zgpat 3 168.4739681 296478 + 168.4739681 168.490326 zinc finger ccch-type with g patch domain-containing protein None LAFQKAIAEEAPVDPGNDSK None None 41874 15.3 16.44 15.94 15.4 16.08 14.71 15.33 14.88 15.72 14.56 14.88 16.01 14.51 15.68 15.88 15.31 15.35 14.78 16.59 14.83 16.81 15.52 14.95 15.11 16.13 15.38 14.16 16.17 16.58 15.41 16.75 Q6PCT3 Tpd52l2 3 168.598451 296480 + 168.598451 168.617195 tumor protein d54 None TPAVEGLTEVEEEELRAELAK None 603747 2469 20.92 17.75 20.49 20.86 19.42 18.98 18.81 18.95 19.98 18.95 19.53 18.63 19.41 19.27 19.24 19.05 19.77 19.89 17.98 20.63 19.57 19.76 19.03 19.74 20.71 18.58 20.18 18.62 20.0 19.54 20.32 P60905 Dnajc5 3 168.6223811 79130 + 168.6223811 168.65268 dnaj homolog subfamily c member 5 None APEGEETEFYVSPEDLEAQLQSDER None None 9631 21.99 20.05 21.53 21.2 20.63 21.4 20.99 20.49 22.45 21.56 21.3 22.02 21.94 22.19 20.73 21.16 21.96 21.44 21.19 21.67 22.67 22.38 21.94 20.6 20.52 21.97 21.09 22.21 22.87 22.19 21.95 D3ZYQ8 Uckl1 3 168.6748271 499956 - 168.6748271 168.687406 uridine-cytidine kinase None GTQSKEAFAIGLGGGSASGK None 610866 41203 17.37 16.25 18.14 16.65 16.27 17.64 16.94 17.96 16.44 17.08 17.89 16.64 16.74 17.05 18.76 16.59 17.46 17.21 17.04 16.15 18.03 17.31 17.5 18.26 17.41 18.02 17.18 17.73 16.2 17.72 17.39 A1A5S1 Prpf6 3 168.7042991 366276 + 168.7042991 168.774991 pre-mrna-processing factor 6 None RKRCENAEPRHGELWCAVSK None None 5368 17.13 15.5 17.78 16.69 16.89 17.14 16.08 16.99 17.71 16.7 16.44 16.87 17.33 17.71 18.31 16.18 17.75 16.83 17.61 15.85 19.14 17.51 17.27 18.2 17.98 17.13 17.93 16.72 17.66 17.9 18.52 A0A1B0GWW0 Ube3c 4 5.6487431 362294 + 5.6487431 5.74992 ubiquitin protein ligase e3c None AQPGGTFRIADGPALTLLVR None None 8783 17.57 15.04 15.78 16.36 16.54 18.0 16.67 17.28 16.65 17.6 16.24 17.0 17.35 17.17 17.6 17.41 16.75 17.01 17.37 15.36 16.35 16.45 17.17 17.22 16.1 17.46 16.85 17.06 16.41 17.35 16.91 D3ZHB7 Ube3c 4 5.6487431 362294 + 5.6487431 5.74992 ubiquitin protein ligase e3c None EERQLAILTELPFVVPFEER None None 8783 17.85 15.21 16.78 16.75 17.14 18.31 17.1 17.33 15.95 17.68 17.35 16.82 17.71 18.05 17.9 17.49 17.12 17.17 17.7 15.77 16.81 16.62 17.5 17.36 17.02 17.87 17.12 17.22 17.01 17.76 17.19 Q6AYU3 Dnajb6 4 5.493121 362293 + 5.493121 5.55663 dnaj homolog subfamily b member 6 None QALKWHPDKNPENKEEAERK None None 38058 18.82 16.91 17.59 18.62 18.52 18.67 18.08 17.45 19.32 18.89 18.82 19.33 19.25 18.97 19.36 18.36 18.52 18.67 19.27 17.25 20.14 18.4 19.14 18.94 18.01 18.74 19.17 18.16 19.14 19.19 19.07 F1LMR7 Dpp6 4 7.5893741 29272 - 7.5893741 8.043413 dipeptidyl aminopeptidase-like protein 6 None CFRIQDKLPTATAKEDEEED None 126141 22560 20.83 22.98 21.07 20.86 20.6 21.41 20.5 19.85 20.84 20.91 19.98 20.45 20.21 20.73 20.58 20.44 21.05 19.96 20.82 21.65 21.18 21.7 20.13 21.22 19.92 22.28 19.59 20.86 21.84 20.75 21.04 P46101 Dpp6 4 7.5893741 29272 - 7.5893741 8.043413 dipeptidyl aminopeptidase-like protein 6 None HEVRRRLGFLEEKDQMEAVR None 126141 22560 20.79 23.03 21.12 20.84 20.59 21.38 20.49 19.85 20.79 20.95 19.93 20.43 20.2 20.76 20.7 20.41 20.96 19.93 20.85 21.62 21.21 21.69 20.11 21.16 19.98 22.19 19.64 20.87 21.82 20.72 20.99 F1LY09 Actr3b 4 9.2622331 362298 + 9.2622331 9.290782 actin-related protein 3b None QLLREREVGIPPEQSLETAK None None 4180 18.55 16.93 17.91 18.47 18.06 19.88 18.7 17.85 19.24 17.78 18.67 19.84 19.52 18.96 17.92 19.67 19.31 18.62 19.0 18.59 18.88 19.43 19.66 18.41 18.53 19.02 18.17 18.91 19.03 18.88 18.94 A0A140UHX4 Prkag2 4 10.0109731 373545 + 10.0109731 10.251899 protein kinase amp-activated non-catalytic subunit gamma 2 None SSSKESSPNSNPSTSPGGIR None 602743 99712 17.55 18.6 16.94 17.56 17.03 18.34 17.07 16.99 16.92 17.65 17.08 17.38 17.41 17.92 18.79 18.76 17.88 16.87 17.6 16.05 17.94 16.13 17.05 18.16 17.48 18.14 17.73 17.64 16.63 16.53 17.45 Q62639 Rheb 4 10.2796071 26954 + 10.2796071 10.320087 gtp-binding protein rheb None IKSFEVIKVIHGKLLDMVGK None 601293 123916 19.41 20.43 18.18 20.02 19.75 19.3 18.7 20.61 19.36 19.04 18.32 19.39 19.68 18.89 20.34 19.42 19.62 19.1 19.59 18.11 17.78 19.24 18.53 20.13 19.66 21.09 19.34 19.71 19.5 18.52 20.56 F7ES73 Nub1 4 10.4440321 296731 - 10.4440321 10.470448 negative regulator of ubiquitin-like proteins 1 None IQLWKPPYTEENKEVGLALK None None 41108 17.86 19.19 18.04 18.06 18.99 16.96 18.88 19.68 17.55 17.71 19.17 17.1 18.52 18.22 18.19 17.81 17.77 19.67 18.48 17.16 18.1 17.35 16.71 18.03 18.15 19.78 18.08 19.2 17.23 17.73 19.44 Q5U3Y2 Smarcd3 4 10.5487521 296732 + 10.5487521 10.580328 rcg24403, isoform cra_a None SKQKRKFSSFFKSLVIELDK None 601737 2314 16.37 18.49 17.2 17.14 16.9 17.09 16.48 16.84 17.18 16.88 16.33 17.68 16.64 16.87 18.19 16.73 17.58 16.53 17.01 16.56 19.01 17.16 16.89 16.46 16.87 16.45 18.42 17.37 16.74 16.34 17.91 A0A096MIV5 Abcf2 4 10.5948911 311959 + 10.5948911 10.607669 atp-binding cassette subfamily f member 2 None LAYKEHLKSKLVDEEPQLTK None 612510 21408 16.92 17.61 18.92 18.35 16.36 17.47 17.99 18.66 18.67 18.28 18.84 16.84 18.66 17.54 19.09 17.93 18.7 17.99 17.86 16.6 18.11 18.23 17.66 18.09 16.99 18.65 18.29 16.92 19.16 17.61 19.63 A2VD14 Abcf2 4 10.5948911 311959 + 10.5948911 10.607669 atp-binding cassette subfamily f member 2 None YGLTGKQQVSPIRNLSDGQK None 612510 21408 16.86 17.55 18.86 18.11 16.44 17.4 17.93 18.67 18.62 18.22 18.78 16.78 18.61 17.53 19.03 17.73 18.64 17.93 17.8 16.54 18.17 18.05 17.6 18.03 16.93 18.6 18.23 16.86 19.11 17.55 19.57 A0A0G2JZ83 Agap3 4 10.6740651 362300 - 10.6740651 10.724814 arfgap with gtpase domain, ankyrin repeat and ph domain 3 None AKDKTRLGNQSTALAVQTVR None None 23742 20.47 18.05 18.91 19.07 19.27 19.65 18.61 18.82 19.13 18.97 18.9 19.36 19.54 19.18 20.14 20.73 19.86 18.88 19.5 17.7 18.7 18.94 19.66 20.21 19.55 20.37 18.9 19.18 19.62 19.44 19.23 A0A0G2K2D4 Agap3 4 10.6740651 362300 - 10.6740651 10.724814 arfgap with gtpase domain, ankyrin repeat and ph domain 3 None AGSQECADILIQHGCPGEGCGLAPTPNR None None 23742 19.84 17.92 18.68 18.81 18.96 20.05 18.39 18.45 19.39 19.07 19.01 19.72 19.59 19.16 20.04 20.36 19.74 18.83 19.38 17.65 19.27 19.02 19.67 20.0 18.77 19.87 19.21 19.07 19.48 19.43 19.32 Q53AQ4 Tmub1 4 10.7294951 362301 + 10.7294951 10.732059 transmembrane and ubiquitin-like domain-containing protein 1 None MTAIDSIREEAPGAESPSLR None None 11187 17.0 15.91 17.96 16.78 15.37 15.8 16.36 16.15 16.09 16.52 16.57 15.88 16.82 17.15 15.37 14.86 15.78 17.39 17.45 16.3 17.22 17.37 16.28 16.41 16.14 16.76 15.51 16.97 17.41 16.52 16.94 P23347 Slc4a2 4 10.7364261 24780 - 10.7364261 10.752965 anion exchange protein 2 None LQERRRIGSMTGVEQALLPR None 109280 128699 16.87 15.3 16.11 16.2 15.95 17.09 17.4 15.64 15.63 15.36 18.18 17.21 16.81 16.59 16.46 17.21 17.03 15.94 15.93 16.97 16.7 16.43 16.98 15.65 16.92 15.96 17.06 16.29 15.61 17.05 15.72 Q03114 Cdk5 4 10.7546911 140908 + 10.7546911 10.760125 cyclin-dependent-like kinase 5 None MQKYEKLEKIGEGTYGTVFK None 123831 3623 18.06 17.63 18.88 18.01 17.44 19.25 19.28 18.37 19.79 19.67 19.16 18.5 19.09 19.39 19.13 17.7 18.59 18.48 19.48 17.58 20.06 19.29 19.43 18.03 17.18 18.01 18.86 19.11 18.02 18.69 18.7 Q5RKI8 Abcb8 4 10.7679521 362302 - 10.7679521 10.783621 mitochondrial potassium channel atp-binding subunit None MRKALFSSLLRQDIAFFDAK None 605464 5203 20.2 17.54 19.51 18.29 17.87 17.71 18.06 18.17 18.42 19.97 18.2 17.46 18.04 18.52 18.83 18.83 18.69 17.81 17.92 19.12 18.78 18.98 17.82 18.29 18.38 18.7 18.51 17.94 19.47 18.16 19.06 Q62600 Nos3 4 10.7924151 24600 - 10.7924151 10.814176 nitric oxide synthase, endothelial None NAPRCVGRIQWGKLQVFDAR None 163729 504 16.11 16.96 15.73 16.07 15.38 16.43 15.92 14.67 15.46 14.25 16.02 16.63 15.3 16.37 17.11 15.9 14.49 16.01 15.85 14.99 16.18 16.22 14.46 15.86 16.39 16.01 16.17 16.96 14.16 14.9 15.88 O08962 Kcnh2 4 10.8273431 117018 + 10.8273431 10.859021 potassium voltage-gated channel subfamily h member 2 None VTEKVTQVLSLGADVLPEYK None 152427 201 15.51 13.7 16.36 17.2 14.98 15.13 14.54 14.22 15.03 16.0 14.56 14.61 15.72 14.94 15.19 14.22 14.93 14.45 16.56 14.65 15.34 15.96 16.29 15.36 15.72 14.66 15.47 14.26 16.24 15.71 15.36 D4AE31 Fam126a 4 11.1319251 499975 + 11.1319251 11.239173 family with sequence similarity 126, member a None FARKQTQRAQSENLELLSLK None None None 15.27 16.66 15.18 15.98 14.5 15.93 15.0 14.51 15.93 14.83 15.25 14.5 14.73 15.79 15.49 14.06 16.13 14.67 14.81 14.37 15.76 15.96 14.62 16.39 14.71 16.5 15.8 15.24 13.84 14.71 14.86 D4A4T6 Rint1 4 11.3213981 296750 - 11.3213981 11.355618 rad50 interactor 1 None DRYKNLPTASRKLQFLELQK None None None 17.94 16.76 17.44 17.12 16.57 17.7 17.13 15.47 17.09 16.8 17.42 17.08 16.02 17.32 18.0 16.21 17.27 15.99 17.29 15.52 16.87 18.27 16.19 17.24 17.4 15.07 17.52 15.5 17.08 17.09 16.58 A0A0G2JX62 Srpk2 4 11.5373861 296753 + 11.5373861 11.655995 srsf protein kinase 2 None TKTRAADLLVNPLDPQNADK None None 69164 18.7 16.41 17.41 18.04 18.04 18.13 16.8 17.63 19.15 19.28 18.76 18.45 18.73 19.33 17.48 17.75 18.38 19.01 17.8 18.91 19.28 18.7 19.02 18.63 17.14 18.25 19.1 17.76 19.29 18.65 18.61 F1LZI7 Reln 4 12.7362211 24718 + 12.7362211 13.162369 reelin Reelen; Rl; reeler None None None None 16.15 16.5 17.02 16.55 17.1 16.17 17.31 17.17 17.53 16.09 16.1 16.78 17.18 17.0 18.36 16.93 16.17 16.88 17.3 16.36 18.19 16.75 16.67 16.79 18.14 18.45 18.04 17.82 15.67 17.53 18.73 P58751 Reln 4 12.7362211 24718 + 12.7362211 13.162369 reelin None IYHASEFTQWRRVTVILPQK None 600514 3699 16.15 16.5 17.02 16.55 17.1 16.17 17.31 17.17 17.53 16.09 16.1 16.78 17.18 17.0 18.36 16.93 16.17 16.88 17.3 16.36 18.19 16.75 16.67 16.79 18.14 18.45 18.04 17.82 15.67 17.53 18.73 G3V7L6 Psmc2 4 13.2558211 25581 - 13.2558211 13.270203 26s proteasome aaa-atpase subunit rpt1 None AIRARRKIATEKDFLEAVNK None 154365 2096 20.64 21.46 19.52 20.46 19.09 19.14 20.16 21.29 19.58 20.1 19.09 19.17 19.91 19.48 20.52 19.47 21.24 19.91 19.44 18.48 18.81 20.32 19.02 20.11 20.87 20.9 20.61 19.89 18.81 19.07 20.03 Q63347 Psmc2 4 13.2558211 25581 - 13.2558211 13.270203 26s proteasome regulatory subunit 7 None IKESDTGLAPPALWDLAADK None 154365 2096 20.41 21.19 19.29 20.22 18.82 18.86 19.95 21.01 19.3 19.74 18.93 18.84 19.67 19.29 20.17 19.14 21.01 19.75 19.15 18.23 18.52 20.08 18.78 19.81 20.76 20.61 20.49 19.52 18.54 18.82 19.74 Q7TQ20 Dnajc2 4 13.2716261 116456 + 13.2716261 13.297434 dnaj homolog subfamily c member 2 None KAAGEPIKEGDNDYFTCITK None 605502 31656 19.29 16.59 17.35 19.74 17.71 18.35 19.34 18.16 17.71 18.67 17.04 18.79 18.62 18.0 19.42 18.42 18.83 17.57 19.13 17.01 18.15 19.01 18.72 18.73 19.12 19.93 19.25 16.97 17.79 18.72 18.81 Q03346 Pmpcb 4 13.2975771 64198 - 13.2975771 13.310358 mitochondrial-processing peptidase subunit beta None IGRQMLCYNRRIPIPELEAR None None 3160 19.82 21.52 18.79 18.79 19.61 20.22 19.7 18.93 19.91 20.97 18.38 19.79 18.87 20.87 19.27 18.89 18.5 19.16 20.01 21.15 20.72 19.2 19.08 18.65 18.88 19.67 19.17 19.55 21.06 18.81 19.78 Q769K2 Napepld 4 13.3610421 296757 + 13.3610421 13.396405 n-acyl-phosphatidylethanolamine-hydrolyzing phospholipase d None KLNEALERYGLKSEDFFILK None None None 17.39 19.07 15.79 16.81 18.74 17.15 16.87 18.33 17.21 17.28 18.48 16.49 16.84 17.16 16.38 17.25 16.94 18.4 16.42 18.4 16.57 16.17 17.02 16.44 17.21 18.17 16.29 18.31 18.45 16.59 17.12 B1WBW4 Armc10 4 13.3990071 296758 - 13.3990071 13.414599 armadillo repeat-containing protein 10 None QLEKLLYLLESTDDPIITEK None 611864 12097 19.54 17.82 19.41 18.88 18.24 19.15 18.66 18.83 19.47 19.63 19.87 17.87 19.83 20.08 19.29 18.65 18.78 19.71 18.79 19.56 20.87 19.24 19.9 20.04 19.57 19.9 19.29 20.58 17.98 19.25 19.7 M0RDY2 Fam185a 4 13.6594491 - 13.6594491 13.662716 family with sequence similarity 185, member A None ECDSCKIDTEQGTSILQSVK None None None 17.7 16.85 17.05 18.63 16.49 15.61 16.65 17.3 17.5 17.05 18.15 14.96 17.37 17.19 17.23 15.94 15.62 18.41 16.62 17.36 16.29 16.85 16.58 16.42 17.5 16.74 16.25 17.44 17.85 16.79 17.64 G3V7Q4 Ptpn12 4 14.0210531 117255 + 14.0210531 14.092927 tyrosine-protein phosphatase non-receptor type 12 None AIAQLFEKQLQLYEIHGAQK None 600079 37691 16.61 18.1 16.38 16.61 15.64 15.71 16.49 17.45 16.49 16.77 15.2 15.95 15.62 16.81 17.13 16.04 16.28 15.98 16.73 15.38 15.77 16.06 15.34 16.61 16.23 17.39 17.47 16.38 14.63 15.51 16.12 D3ZY03 Magi2 4 14.3371521 113970 - 14.3371521 15.00161 membrane-associated guanylate kinase, ww and pdz domain-containing protein 2 None VVDILKDCPVGSETSLIIHR None None 8189 18.83 17.0 17.01 18.26 18.07 17.82 17.55 16.64 17.54 18.07 18.12 18.82 18.02 18.44 17.55 18.29 18.57 17.57 18.01 18.12 17.43 18.15 18.56 18.1 18.23 18.22 18.0 17.55 18.35 18.09 17.27 O88382 Magi2 4 14.3371521 113970 - 14.3371521 15.00161 membrane-associated guanylate kinase, ww and pdz domain-containing protein 2 None YPAPVYSQPEELKDQMDDTK None None 8189 18.7 16.88 16.8 18.3 18.11 17.75 17.59 16.52 17.43 17.82 18.06 18.69 18.09 18.35 17.7 18.39 18.43 17.63 17.88 18.33 17.5 18.12 18.62 18.03 18.55 18.51 17.99 17.6 18.28 18.18 17.26 P10824 Gnai1 4 16.8140011 25686 + 16.8140011 16.895434 guanine nucleotide-binding protein g(i) subunit alpha-1 None KAAVERSKMIDRNLREDGEK None 139310 74417 21.45 23.52 22.79 21.82 21.03 21.46 22.22 21.58 21.11 22.66 20.66 21.12 21.06 22.15 21.26 21.12 21.43 22.14 20.98 22.1 23.4 21.56 21.36 21.27 21.92 22.1 21.2 21.62 21.8 21.23 21.21 P29348 Gnat3 4 17.1624931 286924 - 17.1624931 17.212283 guanine nucleotide-binding protein g(t) subunit alpha-3 None ETQFSFKDLNFRMFDVGGQR None None 24284 19.22 21.15 19.97 20.16 20.0 19.29 18.97 18.95 19.04 19.63 20.26 19.68 19.29 19.41 18.97 20.22 20.28 20.07 20.79 18.83 19.71 20.12 19.81 19.02 20.31 19.62 19.94 19.87 20.82 18.67 19.03 A0A0G2K7E5 Cacna2d1 4 18.9506151 25399 - 18.9506151 19.374969 voltage-dependent calcium channel subunit alpha-2/delta-1 None GAYESGIMVSKAVELYIQGK None None 579 20.13 20.99 20.08 20.4 18.93 19.38 19.61 19.78 20.19 20.71 20.09 19.76 20.63 20.28 19.95 20.1 19.73 20.13 20.95 19.49 20.08 20.57 19.98 19.31 19.64 20.74 19.2 20.64 21.69 19.13 19.77 D3ZKP9 Cacna2d1 4 18.9506151 25399 - 18.9506151 19.374969 voltage-dependent calcium channel subunit alpha-2/delta-1 None NRDEDPTLLWQVFGSATGLAR None None 579 20.18 20.54 20.11 20.47 18.95 19.37 19.65 19.7 20.21 20.72 20.14 19.81 20.78 20.24 20.0 20.27 19.74 20.14 20.97 19.54 20.16 20.64 20.17 19.29 19.64 20.75 19.27 20.66 21.7 19.37 19.93 P54290 Cacna2d1 4 18.9506151 25399 - 18.9506151 19.374969 voltage-dependent calcium channel subunit alpha-2/delta-1 None LVTLAKTASGVTQLADIYEK None None 579 20.02 20.86 20.1 20.47 18.94 19.46 19.64 19.68 20.19 20.71 20.11 19.86 20.74 20.25 20.02 20.26 19.74 20.14 20.94 19.55 20.21 20.64 20.1 19.29 19.51 20.79 19.3 20.65 21.69 19.31 19.87 F1M7V4 Pclo 4 19.6953151 56768 - 19.6953151 20.049885 protein piccolo None RLLQDDITFGLRKNITDQQK None 604918 69111 19.55 19.26 19.88 19.26 19.88 19.58 19.21 19.49 20.53 19.46 18.98 20.45 20.7 20.8 19.23 19.71 20.01 20.82 19.2 20.61 20.38 19.64 20.42 20.32 19.15 20.77 19.99 21.09 18.94 19.81 20.64 Q9JKS6 Pclo 4 19.6953151 56768 - 19.6953151 20.049885 protein piccolo None IRARVDAKVEIIKHISAPEK None 604918 69111 19.77 20.14 20.2 19.67 20.35 20.15 19.46 19.86 21.07 20.09 19.27 20.86 21.15 21.32 19.32 20.18 20.65 21.29 19.69 21.11 20.81 20.1 20.86 20.68 19.62 21.25 20.14 21.71 19.85 20.26 21.03 P31422 Grm3 4 24.3651161 24416 + 24.3651161 24.609804 metabotropic glutamate receptor 3 None DNYLLPGVKLGVHILDTCSR None 601115 651 20.42 21.21 19.25 20.07 19.41 20.1 19.51 19.35 20.4 20.04 19.87 20.56 19.59 20.6 19.78 19.59 20.67 19.95 20.64 18.23 20.59 19.8 20.35 20.17 19.09 19.92 19.9 19.44 20.09 19.17 19.09 F1M4B6 Rgd1563349 4 24.6336881 502727 - 24.6336881 24.71939 similar to riken cdna 9330182l06 None SFIDINRKSTNVVESWGGTK None None 27396 16.73 16.2 17.65 17.81 18.11 17.96 17.43 18.07 18.24 18.35 17.56 18.18 18.63 17.82 17.11 17.01 17.55 17.97 16.99 19.23 17.79 17.71 18.64 17.79 16.25 17.3 16.71 18.15 18.46 17.8 17.68 P11466 Crot 4 25.0857381 83842 + 25.0857381 25.133109 peroxisomal carnitine o-octanoyltransferase None IAKEEGLPVPELFEDPLFSR None 606090 10899 16.29 14.51 16.83 16.13 17.42 15.12 17.33 15.95 17.27 15.53 17.15 17.4 17.0 16.75 14.94 15.79 16.76 17.23 15.77 17.56 17.64 16.33 17.11 16.37 16.51 15.82 16.93 16.71 14.99 16.93 17.1 Q08201 Abcb4 4 25.1506731 24891 - 25.1506731 25.442843 phosphatidylcholine translocator abcb4 None PQKFDTLVGDRGAQLSGGQK None 171060 55496 17.53 18.89 16.63 16.83 16.88 18.13 17.36 17.36 18.14 17.92 16.82 18.07 16.71 17.32 16.97 17.66 18.13 18.23 17.63 16.08 18.89 17.49 16.67 17.86 16.22 17.33 17.61 16.38 18.0 17.08 17.57 Q9JK64 Abcb4 4 25.1506731 170913 - 25.1506731 25.442843 multidrug resistance protein 1a None DSFSKSGHKPDNIQGNLEFK None 171050 55496 20.34 18.53 17.29 17.68 18.58 20.21 18.86 18.2 19.2 18.53 18.74 18.28 17.4 18.34 18.41 19.11 19.38 19.39 18.94 17.3 19.81 19.1 18.05 19.14 20.06 18.92 18.88 17.45 19.21 19.19 18.98 P43245 Abcb1b 4 25.2430871 - 25.2430871 25.325086 atp-dependent translocase abcb1 None TIAENIRYGRENVTMDEIEK None None None 19.42 19.66 17.43 17.5 18.45 19.97 18.68 17.92 19.01 18.16 18.64 18.15 17.36 18.34 18.08 19.0 19.48 19.15 18.71 17.18 19.7 19.03 17.79 18.98 20.1 18.39 18.81 17.26 19.03 18.63 18.58 Q3B7K9 Rundc3b 4 25.4627441 688590 + 25.4627441 25.599473 run domain-containing protein 3b None LEELLRLRENQLSESVSQNK None None None 17.26 14.68 17.04 17.14 15.68 16.02 15.74 16.38 16.83 15.41 15.58 17.19 16.86 16.93 17.58 17.07 17.31 16.61 17.19 15.12 15.95 18.41 16.66 17.36 16.75 17.75 17.31 16.54 16.68 17.25 17.39 M0R5P8 Adam22 4 25.6795941 57033 + 25.6795941 25.852351 adam metallopeptidase domain 22 None CCKKCTLTQDSQCSDGLCCK None None None 20.02 20.67 19.53 20.53 21.08 20.08 19.93 20.79 20.83 20.62 20.29 21.42 21.07 20.56 20.14 20.47 19.99 20.7 20.37 21.68 20.72 19.95 20.9 20.07 20.05 20.76 20.48 20.02 22.24 20.66 20.47 B0BNJ1 Sri 4 25.9750141 683667 - 25.9750141 25.987793 loc683667 protein None TFDDYIACCVKLRALTDSFR None None None 18.86 16.97 20.14 16.17 19.01 19.02 17.57 19.13 19.5 17.48 18.68 18.31 18.92 19.04 19.91 19.07 17.99 18.23 18.89 18.77 19.14 19.05 18.86 18.83 18.72 17.77 18.86 18.32 20.26 19.18 19.78 D4A8Y0 Cldn12 4 28.5274931 500000 + 28.5274931 28.533647 claudin 12 None SSRSRLSAIEIDIPVVSHST None None 40809 16.61 15.66 15.63 14.88 15.37 15.94 16.0 15.44 15.9 17.61 15.96 15.58 16.59 15.74 16.42 16.92 15.96 16.26 16.72 14.13 15.98 16.24 15.83 15.99 15.58 15.56 15.65 15.86 16.18 15.18 15.55 D3ZSZ0 Cdk14 4 28.6666891 362316 + 28.6666891 29.258549 cyclin-dependent kinase 14 None LLKGLKHANIVLLHDIIHTK None 610679 None 16.69 18.92 17.81 17.9 16.87 16.87 18.2 17.2 16.53 16.91 17.44 16.31 17.18 16.93 16.44 17.78 17.64 18.37 17.29 16.33 17.67 17.29 16.93 17.63 18.54 18.1 17.32 18.07 15.66 16.18 16.81 Q64654 Cyp51 4 30.0366351 25427 + 30.0366351 30.05541 lanosterol 14-alpha demethylase None AALLFNSKNEDLNAEEVYGR None 601637 55488 18.35 15.79 17.85 17.64 17.82 17.24 17.72 17.74 17.04 17.49 18.62 16.69 17.75 17.01 17.45 17.69 17.31 17.52 17.63 17.62 17.03 17.59 17.8 17.02 18.63 16.59 17.83 17.48 17.25 18.12 17.49 A0A0G2K548 Akap9 4 30.0567391 246150 - 30.0567391 30.192606 a-kinase-anchoring protein 9 None QTSLMCLQESTKASQILEIK None 604001 17517 18.53 16.46 18.48 18.73 17.66 17.37 17.55 17.93 17.11 17.35 19.34 17.23 18.7 18.73 19.14 17.92 19.13 17.81 17.32 17.0 18.39 18.99 18.13 19.0 19.39 18.62 18.62 18.11 17.6 18.58 18.62 F1LPB4 Akap9 4 30.0567391 246150 - 30.0567391 30.192606 a-kinase-anchoring protein 9 None EHGLTISEEIFSKDETFLVR None 604001 17517 18.56 16.49 18.5 18.78 17.72 17.42 17.59 17.97 17.17 17.37 19.38 17.26 18.75 18.78 19.14 17.95 19.18 17.82 17.37 17.04 18.41 18.98 18.19 19.04 19.42 18.67 18.66 18.15 17.63 18.64 18.66 G3V8Z6 Krit1 4 30.2992041 362317 - 30.2992041 30.333351 krit1, ankyrin repeat-containing None YGNYESKKHKQGFLNEENLK None 604214 12746 16.03 16.36 16.67 15.67 16.67 16.03 16.3 17.28 16.47 15.93 16.53 16.02 16.01 16.21 17.04 16.87 16.7 15.71 16.82 15.22 15.62 16.65 15.74 16.82 17.19 15.88 17.22 16.48 14.67 17.36 16.13 D4A731 Ankib1 4 30.3336791 368062 + 30.3336791 30.457781 rbr-type e3 ubiquitin transferase None FMHYYTRYKNHEHSYQLEQR None None 19076 16.6 14.19 16.7 15.85 15.69 16.4 16.28 16.45 16.78 17.12 15.68 15.88 16.68 16.46 17.0 16.57 16.97 16.12 16.68 14.51 15.0 17.53 16.75 16.91 15.26 17.28 16.12 16.1 15.69 16.2 15.89 D3ZZB2 Pex1 4 30.5199561 500006 - 30.5199561 30.558898 peroxin-1 None EKEKEQGRTVFVLSPILLQK None 602136 27006 17.77 15.33 17.64 16.37 17.41 16.1 17.03 15.92 17.0 16.37 16.64 16.1 17.29 16.33 16.47 15.88 17.37 17.25 16.94 15.2 17.38 17.36 16.1 16.75 18.14 15.71 16.51 16.16 16.87 16.97 17.65 A0A0G2K5A4 Golga3-ps1 4 31.081011 - 31.081011 31.085469 golgin A3, pseudogene 1 None SLKFDKEQMIALTEANETLK None None None 19.22 16.23 18.03 18.54 16.73 17.82 16.81 17.52 17.33 17.56 19.15 17.0 18.61 18.57 17.67 18.41 19.38 17.81 17.13 17.91 17.26 19.22 17.91 18.55 19.28 18.58 18.11 17.65 18.53 18.26 17.9 A0A0G2JVW6 Samd9 4 31.1646751 500011 - 31.1646751 31.16985 sterile alpha motif domain-containing 9 None DFFQIKMHWHKDETWQQIPK None None 75072 16.58 16.33 16.02 15.47 15.2 15.62 15.94 15.55 15.61 15.19 16.43 15.15 14.82 15.59 15.29 15.72 15.4 16.22 16.64 14.37 16.9 15.37 15.74 16.47 16.33 15.32 16.07 15.19 14.72 15.22 14.58 F1LSG8 Vps50 4 31.4844641 312083 + 31.4844641 31.585617 syndetin None KEFVEIYIKAYYLTENDMER None None 11498 19.76 16.88 17.42 19.35 18.72 18.09 18.98 17.65 17.58 18.14 18.91 17.31 18.01 17.02 19.7 17.84 18.18 17.67 18.2 16.93 17.61 19.22 17.84 18.47 19.41 19.08 17.24 17.86 18.56 18.97 17.99 Q62896 Bet1 4 32.116231 29631 - 32.116231 32.126617 bet1 homolog None LRSKVTAIKSLSIEIGHEVK None None 38108 15.7 17.4 17.1 17.35 16.55 15.39 17.61 17.45 15.16 16.46 17.81 15.79 15.58 17.15 16.92 15.26 16.96 16.47 15.28 16.33 16.6 15.9 17.11 16.43 16.65 16.91 17.17 16.23 15.02 16.39 17.74 O35867 Ppp1r9a 4 33.0244511 84685 + 33.0244511 33.286907 neurabin-1 None DEDGLGISIIGMGVGADAGLEK None 602468 14247 20.37 19.26 18.96 19.62 19.55 19.58 19.38 19.0 20.09 19.76 19.44 19.89 19.67 20.28 19.86 19.48 19.35 19.02 19.88 19.61 19.51 20.14 20.14 20.08 19.23 19.54 19.33 19.98 19.03 19.2 19.05 P55159 Pon1 4 33.2947391 84024 - 33.2947391 33.321371 serum paraoxonase/arylesterase 1 None ENPPGSEVLRIQSILSEDPK None 168820 385 17.26 14.69 16.07 17.42 15.6 15.29 17.09 16.04 15.31 15.2 15.75 16.07 16.2 14.65 15.54 15.54 15.33 16.09 15.51 16.61 15.55 15.23 16.28 15.75 16.01 16.41 15.71 14.92 15.25 15.06 15.46 Q6AXM8 Pon2 4 33.3897121 296851 - 33.3897121 33.425128 serum paraoxonase/arylesterase 2 None VKLVAEGFDSANGINISPDK None 602447 385 18.19 17.35 18.84 18.61 18.97 16.68 18.3 18.8 17.08 17.1 18.32 17.18 18.06 17.67 18.04 18.85 16.65 18.08 18.42 19.26 17.2 17.12 17.07 18.2 19.5 18.42 19.16 16.63 17.91 18.67 19.37 G3V792 Dync1i1 4 33.8529281 29564 + 33.8529281 34.166149 cytoplasmic dynein 1 intermediate chain 1 None RVIERALAEDSDIFFDYSGR None None 68398 19.91 18.06 19.43 20.49 19.46 20.34 18.95 18.79 19.73 20.21 19.37 19.05 19.73 19.59 18.18 18.73 19.77 20.27 18.68 20.23 19.42 19.26 20.17 18.76 19.79 19.25 19.05 19.2 21.12 20.13 19.67 Q63100 Dync1i1 4 33.8529281 29564 + 33.8529281 34.166149 cytoplasmic dynein 1 intermediate chain 1 None NRVRWAQGGKEVAVGDSEGR None None 68398 19.91 18.06 19.43 20.47 19.47 20.4 18.9 18.76 19.73 20.21 19.37 19.05 19.73 19.55 18.18 18.79 19.77 20.27 18.68 20.23 19.39 19.26 20.17 18.77 19.79 19.25 19.11 19.19 21.14 20.13 19.67 A0A0G2JT86 Samd9l 4 31.2682521 + 31.2682521 31.273662 sterile alpha motif domain containing 9 like None DTSLFVREGASSRDILGNPK None None None 17.1 16.28 18.63 16.63 17.35 16.19 17.11 17.14 17.27 16.38 17.28 16.65 17.44 17.38 18.26 16.62 16.53 17.21 17.83 16.2 18.93 17.14 16.51 17.11 18.4 16.67 18.07 18.22 15.63 17.4 18.86 A0A0G2JVT8 Samd9l 4 31.2682521 + 31.2682521 31.273662 sterile alpha motif domain containing 9 like None CENFYSFMILKDNFDTTYIK None None None 17.32 16.52 18.74 16.67 17.43 16.35 17.19 17.2 17.44 16.53 17.44 16.75 17.31 17.43 18.35 16.65 16.62 17.3 17.92 16.28 19.11 17.25 16.54 17.2 18.32 16.7 18.15 18.31 15.72 17.3 18.95 D3ZTE2 Vps50 4 31.567091 100911994 + 31.567091 31.585063 coiled-coil domain-containing protein 132-like None NKKARQKLLAAIDDIDRPKR None None None 19.61 17.73 17.26 18.35 17.87 18.12 18.27 17.37 17.6 18.89 18.51 16.62 17.41 17.06 18.96 17.41 17.94 17.21 18.08 16.65 17.74 18.96 16.94 18.09 17.84 18.47 17.33 17.58 18.22 18.09 17.62 P02466 Newgene_621351 4 32.5639391 84352 + 32.5639391 32.598867 collagen alpha-2(i) chain None ATLKSLNNQIETLLTPEGSR None 120160 69 16.26 17.94 17.64 16.19 16.39 16.65 16.81 18.07 15.82 15.07 17.34 16.37 16.06 17.29 17.47 16.17 15.96 17.08 16.14 16.61 16.82 16.69 15.89 14.98 17.07 16.13 16.52 17.49 17.18 16.35 16.43 F1LZW6 Slc25a13 4 34.2134611 362322 - 34.2134611 34.335496 solute carrier family 25 member 13 None RSTGSFVGELMYKNSFDCFK None 603859 22800 21.22 22.24 19.95 20.4 20.78 20.94 21.39 21.29 20.14 22.08 19.23 20.57 19.64 19.84 22.12 20.75 20.71 19.95 20.2 20.16 19.6 20.91 19.79 20.54 20.45 21.66 20.88 20.59 19.62 20.4 20.98 P49088 Asns 4 35.7857261 25612 - 35.7857261 35.803527 asparagine synthetase [glutamine-hydrolyzing] None HYEVLDLKPNGKVASVEMVK None 108370 69113 19.51 16.49 18.79 17.89 18.74 18.96 18.95 19.03 16.82 18.5 19.47 17.72 18.73 17.26 17.72 18.53 17.61 19.53 17.99 19.16 17.49 18.29 18.29 17.43 18.35 17.63 18.83 18.24 17.75 18.86 18.1 D3Z9C0 Mios 4 36.2632911 362324 + 36.2632911 36.289544 meiosis regulator for oocyte development None RDQKLLLAGMHRNLAIFDLR None None None 16.92 14.59 17.0 16.88 15.76 16.24 15.74 15.08 16.45 15.37 16.22 17.03 16.87 17.0 16.99 16.36 17.14 16.04 16.85 15.03 16.84 16.97 17.37 17.23 16.45 17.03 16.05 16.51 16.22 16.27 16.79 B2RYK0 Glcci1 4 36.3079571 296884 + 36.3079571 36.635612 glucocorticoid-induced 1 None HYRSSSTRSIDTQTPSVQER None None None 16.38 16.7 17.08 14.84 15.83 15.89 16.76 14.49 15.46 15.67 16.01 14.97 15.18 16.25 14.87 15.17 14.46 16.76 16.67 15.62 16.1 16.3 14.66 15.52 16.22 15.48 14.42 15.35 16.43 16.08 16.09 Q63054 Ica1 4 36.6564731 81024 - 36.6564731 36.80472 islet cell autoantigen 1 None ATGKKEDEHVVASDADLDAK None 147625 7777 17.92 19.44 17.12 18.87 16.8 18.46 17.05 17.76 18.4 16.83 18.38 17.22 17.74 17.92 18.16 18.11 19.02 18.21 16.84 16.88 17.37 17.75 17.32 18.39 18.53 18.47 17.8 17.43 18.7 16.9 17.45 Q6AZ05 Ica1 4 36.6564731 81024 - 36.6564731 36.80472 ica1 protein Ica69 None None None None 17.92 19.44 17.12 18.87 16.8 18.46 17.05 17.76 18.4 16.83 18.38 17.22 17.74 17.92 18.16 18.11 19.02 18.21 16.84 16.88 17.37 17.75 17.32 18.39 18.53 18.47 17.8 17.43 18.7 16.9 17.45 B2RZD6 Ndufa4 4 40.0022171 681024 - 40.0022171 40.009384 ndufa4 complex-associated None WDRKNNPEPWNKLGPNEQYK None None 37629 21.58 21.97 20.91 21.91 21.96 20.61 21.63 22.84 21.33 21.7 20.4 21.34 22.36 20.52 22.76 22.09 21.18 21.35 22.34 20.14 20.51 20.92 21.2 21.85 21.78 22.92 21.86 20.88 21.48 20.74 22.59 A0A0G2K7P2 Phf14 4 40.0092651 500030 + 40.0092651 40.195883 phd finger protein 14 None PIRNTRTRGRKRSFVPEEEK None None 8775 13.69 15.47 15.3 15.66 14.84 16.2 14.43 14.18 16.78 15.87 14.33 15.45 16.12 15.87 16.44 15.73 16.32 15.03 15.37 14.58 16.92 15.59 16.27 15.46 14.65 15.78 15.3 16.02 16.15 15.01 15.42 F1MA97 Thsd7a 4 40.4611251 500032 - 40.4611251 40.899345 thrombospondin type 1 domain-containing 7a None RTIRQFPIGSEKECPELEEK None 612249 46582 16.28 16.88 17.25 17.91 16.67 17.85 17.69 17.71 18.25 18.11 17.4 18.57 18.67 17.9 16.56 18.59 18.8 17.96 16.94 17.87 18.55 17.09 18.4 18.12 16.24 17.48 18.4 17.32 17.29 17.38 17.22 Q6AYA5 Tmem106b 4 41.3279951 312132 + 41.3279951 41.345619 transmembrane protein 106b None NEDGRSGDVSQFPYVEFTGR None 613413 56806 16.12 13.51 16.29 16.59 16.48 15.2 16.6 15.92 14.87 15.02 17.01 16.78 16.39 15.05 16.19 16.97 15.59 15.5 16.59 16.07 15.26 15.03 16.23 15.23 16.52 14.76 15.86 15.62 15.51 16.45 16.19 A0A0G2K2E4 Cwc22 4 41.8289161 + 41.8289161 41.829409 peptidyl-prolyl cis-trans isomerase None HTGPGILSMANAGPNTNGSQFFICTAK None None None 25.55 23.87 24.78 25.67 25.75 24.93 26.27 25.39 25.04 25.8 25.09 25.92 25.6 25.53 23.87 24.99 25.28 24.97 25.09 25.97 25.36 24.67 25.65 25.11 24.57 24.49 24.1 24.57 25.42 25.64 25.38 Q2IBD4 Cttnbp2 4 46.8009821 282587 - 46.8009821 46.964631 cortactin-binding protein 2 None RQKKLEMEKLQLQALEQEHK None 609772 14125 19.52 18.84 18.63 18.78 18.99 19.99 18.12 18.22 19.87 19.32 18.42 19.67 19.19 19.99 19.15 19.66 19.84 18.67 20.05 18.28 19.95 19.17 20.16 19.57 19.19 19.55 18.97 19.93 19.77 18.73 19.37 Q2LAP6 Tes 4 45.3653051 500040 + 45.3653051 45.403827 testin None CAGCDELIFSNEYTQAENQNWHLK None 606085 41051 17.49 18.6 18.51 17.78 17.5 17.82 17.05 17.44 18.28 17.79 18.68 17.55 17.77 17.74 17.76 18.06 17.26 19.44 17.41 17.47 19.45 17.47 18.2 19.02 17.36 17.68 18.62 17.62 16.94 16.35 17.48 P41350 Cav1 4 45.6406251 25404 + 45.6406251 45.673702 caveolin-1 None GHLYTVPIREQGNIYKPNNK None 601047 1330 18.31 15.58 18.06 16.54 17.72 17.98 17.26 18.76 18.01 18.02 19.12 16.22 17.63 18.64 17.38 16.53 17.52 17.67 18.14 16.81 18.47 16.69 18.31 17.15 17.03 16.86 16.91 17.08 19.48 18.17 17.83 Q3T1K5 Capza2 4 45.9781431 493810 + 45.9781431 46.014029 f-actin-capping protein subunit alpha-2 None RKEATDPRPYEAENAIESWR None 601571 55956 21.15 19.92 20.14 20.0 19.67 21.97 20.59 19.74 20.94 20.0 20.73 21.27 20.84 21.01 19.57 21.07 20.83 20.41 20.83 21.17 20.98 20.51 21.09 19.51 20.13 20.4 19.93 20.63 21.78 20.71 20.51 Q2IBC9 St7 4 46.0422371 296911 + 46.0422371 46.289742 suppression of tumorigenicity 7 None QAYADVQAVLAKYDDISLPK None 600833 10185 15.75 17.08 16.66 15.22 14.45 14.98 15.21 14.87 15.63 14.8 16.08 15.51 14.96 16.05 16.54 14.93 15.84 15.83 14.79 14.36 17.36 15.88 14.64 14.67 15.88 14.5 15.78 14.93 16.32 14.86 15.27 B2RZB6 Lsm8 4 47.306261 296913 + 47.306261 47.312125 u6 snrna-associated sm-like protein lsm8 None INRTVAVITSDGRMIVGTLK None None 9419 18.31 16.88 18.34 17.98 18.16 17.83 17.87 17.85 19.02 16.97 18.13 17.77 18.43 18.32 19.18 17.51 17.63 17.91 17.44 19.22 19.69 18.54 18.2 19.04 18.71 18.22 17.89 16.99 18.91 18.76 19.25 Q63881 Kcnd2 4 49.7767031 65180 + 49.7767031 50.277742 potassium voltage-gated channel subfamily d member 2 None RQERKRTQDALIVLNVSGTR None 605410 40828 17.71 16.12 17.71 17.71 17.83 16.52 18.12 17.11 18.4 17.33 17.31 17.98 18.05 17.93 18.59 17.1 17.57 16.96 18.89 16.63 18.44 18.28 17.99 16.22 18.19 17.13 17.27 18.03 18.78 18.12 18.93 Q810F4 Fam3c 4 50.8389571 312159 - 50.8389571 50.887251 protein fam3c None GRGINVALVNGKTGDVIDTK None None 8926 14.83 16.63 16.07 17.69 17.37 15.88 16.1 17.05 16.62 16.63 15.86 17.29 17.28 16.21 16.53 17.09 16.25 17.41 16.35 16.23 15.44 15.37 17.08 16.86 15.13 16.87 15.65 16.42 17.02 15.94 16.08 F1LMY3 Ptprz1 4 51.3944421 25613 + 51.3944421 51.595218 protein-tyrosine-phosphatase None ESTRNALEDSAPSGSEESLK None 176891 2136 21.65 20.64 21.16 21.19 21.19 22.25 20.81 20.57 21.0 21.48 20.72 20.92 21.8 21.49 21.14 22.78 21.78 21.39 21.01 22.65 21.42 21.96 21.92 21.45 22.1 23.05 21.62 21.43 22.51 21.96 22.28 Q62656 Ptprz1 4 51.3944421 25613 + 51.3944421 51.595218 receptor-type tyrosine-protein phosphatase zeta None KWPNPDSPISKTFELISIIK None 176891 2136 21.69 20.49 21.07 21.19 21.19 22.32 20.81 20.57 20.87 21.4 20.93 21.01 21.83 21.49 21.14 22.78 21.78 21.39 21.01 22.65 21.42 21.96 21.93 21.45 22.11 23.02 21.62 21.43 22.51 21.97 22.27 A2VCW9 Aass 4 51.6069091 296925 - 51.6069091 51.654528 alpha-aminoadipic semialdehyde synthase None GAQEVFNELPCEYVEPHELK None 605113 4212 16.21 16.27 16.0 17.37 16.79 16.4 16.6 16.42 16.0 15.58 15.28 17.63 17.35 17.16 18.0 16.63 16.98 15.75 16.79 15.53 17.03 15.02 15.29 17.67 17.8 16.85 17.46 14.96 16.2 16.14 18.08 F1LWT1 Cadps2 4 51.7804151 312166 - 51.7804151 52.30909 calcium-dependent secretion activator 2 None PVVKVKLFTESTGVLALEDK None 609978 23060 19.75 19.11 20.05 19.85 20.43 19.65 20.58 20.07 21.23 19.79 19.38 20.96 20.84 20.81 20.87 19.66 19.49 20.51 21.56 19.09 21.43 19.98 20.18 19.52 20.07 20.04 20.99 20.98 19.41 20.82 21.47 Q63362 Ndufa5 4 52.9973281 25488 - 52.9973281 53.005685 nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 None LVKKTTGLVGLAVCDTPHER None 601677 3664 20.27 19.77 18.23 19.83 20.55 20.98 20.11 19.91 19.88 19.12 19.7 20.93 20.8 19.91 19.33 20.34 20.41 19.35 20.41 20.05 18.6 20.24 20.09 19.67 20.59 20.61 20.08 20.43 19.57 19.48 21.23 F1LSG0 Wasl 4 53.0835371 682507 - 53.0835371 53.132022 neural wiskott-aldrich syndrome protein None APTAAPPPPPPSRPGVVVPPPPPNR None None 133716 19.01 20.06 18.65 18.94 19.57 19.59 19.46 18.91 17.97 20.39 18.16 18.84 18.21 18.54 18.53 20.28 18.94 20.24 18.03 19.47 17.95 18.21 19.54 18.2 19.24 20.24 19.87 19.8 17.49 18.21 18.61 O08816 Wasl 4 53.0835371 682507 - 53.0835371 53.132022 neural wiskott-aldrich syndrome protein None SVSDGQESTPPTPAPTSGIVGALMEVMQK None None 133716 19.01 20.06 18.61 18.94 19.57 19.69 19.5 18.91 17.84 20.33 18.33 18.88 18.21 18.54 18.72 20.28 19.05 20.13 18.05 19.46 17.95 18.21 19.54 17.68 19.35 20.19 19.94 19.84 17.96 18.21 18.61 Q9QYC6 Gpr37 4 54.1388511 117549 - 54.1388511 54.16103 prosaposin receptor gpr37 None PLVIFHELTKKWLLEDFSCK None 602583 3875 17.04 15.12 15.29 16.91 17.11 17.79 16.58 16.15 16.04 17.28 17.93 16.02 16.55 16.22 15.92 17.57 17.24 17.02 16.48 16.82 15.98 17.17 17.9 16.55 17.71 17.2 15.89 16.49 18.56 17.9 16.1 F1LRA6 Grm8 4 55.8057631 60590 - 55.8057631 56.730845 metabotropic glutamate receptor 8 None IAPVYQQEEIAEGAVTILPK None 601116 654 16.81 15.45 15.53 16.28 15.53 16.43 17.03 16.53 16.11 17.75 16.17 15.61 17.17 16.73 16.1 15.19 16.86 16.37 16.74 15.26 16.01 16.98 16.58 15.38 16.21 16.83 15.81 15.99 16.6 16.29 15.83 P70579 Grm8 4 55.8057631 60590 - 55.8057631 56.730845 metabotropic glutamate receptor 8 None IGLCPRMVTIDGKELLGYIR None 601116 654 16.94 15.59 15.53 16.28 15.53 16.43 17.03 16.53 16.11 17.75 16.17 15.61 17.16 16.73 16.1 15.19 16.86 16.37 16.74 15.26 16.01 16.98 16.7 15.38 16.21 16.83 15.81 15.99 16.6 16.12 15.79 D3ZPA1 Gcc1 4 57.0318741 100361513 - 57.0318741 57.036397 grip and coiled-coil domain-containing 1 None KDGNLGKELEAAQEQLAELK None None None 16.2 17.88 15.41 16.26 16.21 16.08 16.46 16.05 15.73 15.01 16.54 15.72 15.75 14.44 16.04 16.67 15.86 17.13 16.14 15.55 15.39 16.42 15.45 15.67 17.34 17.11 16.48 15.1 16.51 15.34 16.0 P84083 Arf5 4 57.0385221 79117 + 57.0385221 57.041447 adp-ribosylation factor 5 None VFANKQDMPNAMPVSELTDK None 103188 55593 22.49 23.32 21.52 21.73 21.82 21.51 22.74 21.83 21.91 22.83 21.09 22.19 21.51 21.43 21.39 22.43 21.51 22.21 22.55 20.92 21.53 22.06 21.47 21.37 20.81 22.52 21.85 21.99 21.01 21.27 22.02 Q66X93 Snd1 4 57.0952451 64635 + 57.0952451 57.4945 staphylococcal nuclease domain-containing protein 1 None TFRRETDGSETPEPFAAEAK None 602181 8665 19.52 18.34 18.94 20.07 20.02 18.64 18.96 19.96 18.57 18.1 19.01 19.23 19.98 18.85 20.08 19.62 19.52 18.75 18.56 20.3 18.32 18.89 18.68 19.9 20.62 20.17 20.81 18.73 18.35 19.11 21.09 Q45R42 Lrrc4 4 57.4335191 641521 - 57.4335191 57.437114 leucine-rich repeat-containing protein 4 None PSYAFNRVPSLMRLDLGELK None None 36403 17.51 15.27 16.35 18.04 17.4 16.33 16.7 16.44 16.98 17.35 17.16 16.89 17.22 18.31 16.02 16.3 16.51 17.39 17.09 17.38 16.24 15.89 17.4 16.42 17.29 16.88 16.43 16.89 18.31 17.22 17.1 D3ZLZ7 Impdh1 4 57.8018441 362329 - 57.8018441 57.817389 inosine-5'-monophosphate dehydrogenase 1 None KFEQGFITDPVVLSPSHTVGDVLEAK None None None 18.19 18.43 19.41 18.92 18.59 17.13 17.26 18.0 18.38 18.15 17.83 17.59 17.23 17.47 19.06 17.62 17.06 18.07 17.61 18.61 18.61 18.24 17.71 18.1 18.39 17.43 19.21 18.16 17.55 17.48 18.46 G3V6S3 Calu 4 57.9490371 64366 + 57.9490371 57.976588 calumenin None IATKEEFTAFLHPEEYDYMK None 603420 936 19.7 17.94 20.2 18.94 19.49 18.75 20.21 20.27 19.77 18.75 21.12 19.61 20.15 20.15 19.28 19.21 19.24 21.26 18.9 20.37 20.78 19.42 19.62 19.19 20.13 18.59 19.46 19.4 19.81 20.53 20.51 O35783 Calu 4 57.9490371 64366 + 57.9490371 57.976588 calumenin None DKYDLFVGSQATDFGEALVR None 603420 936 19.07 16.86 19.52 18.13 18.71 17.25 19.28 19.31 18.78 17.85 20.07 18.3 19.14 19.28 18.48 18.23 18.71 19.87 17.56 19.71 19.9 18.42 18.82 18.49 19.65 17.98 18.5 18.11 18.99 19.48 19.57 Q3MID6 Calu 4 57.9490371 64366 + 57.9490371 57.976588 calumenin Cbp50; Rcn None None None None 19.64 17.8 20.15 18.87 19.33 18.61 19.98 20.15 19.63 18.63 21.11 19.44 20.06 20.09 19.18 19.03 19.27 20.98 18.39 20.59 20.71 19.47 19.55 19.14 20.13 18.6 19.62 19.32 19.64 20.43 20.42 D4AAR7 Ccdc136 4 57.9979251 362331 + 57.9979251 58.027646 coiled-coil domain-containing 136 None QLLRQQLLGAEEQMHDMQDK None 611902 23378 18.17 17.42 17.64 18.44 17.24 18.07 18.26 17.39 19.03 19.86 18.48 18.22 19.03 18.55 18.64 18.19 19.16 18.0 17.76 18.85 19.32 19.15 19.6 17.82 17.68 18.17 18.38 17.7 20.18 18.67 18.74 D3ZHA0 Flnc 4 58.0341531 362332 + 58.0341531 58.061894 filamin-c None DPVPKSPFVVNVAPPLDLSK None 102565 37481 19.14 17.11 19.07 18.53 18.57 18.01 19.46 19.87 18.74 17.67 20.37 18.19 18.27 19.22 19.19 18.23 18.7 18.26 18.83 18.7 18.34 18.37 18.44 18.62 18.56 18.39 18.9 19.29 16.87 19.42 19.82 P50408 Atp6v1f 4 58.0676651 116664 + 58.0676651 58.070627 v-type proton atpase subunit f None PNFLVVEKDTTINEIEDTFR None None 3119 20.93 22.56 21.7 20.25 19.33 21.06 20.08 20.54 20.51 21.16 20.33 20.16 19.93 20.86 20.19 20.82 20.15 21.97 20.53 19.53 19.89 21.22 20.26 20.08 21.21 19.52 20.74 19.64 22.22 20.34 19.9 D4AAM0 Tnpo3 4 58.143021 296954 - 58.143021 58.220355 transportin 3 None DDLFRLATRFIQRSPVTLLR None 610032 40848 19.67 17.49 19.88 18.03 17.21 18.72 19.04 18.51 18.9 18.71 18.39 16.88 18.82 18.31 19.16 18.59 18.69 18.72 19.41 17.33 20.42 19.62 18.74 18.32 19.42 19.23 18.76 19.46 17.78 18.08 18.84 D3ZWL6 Ahcyl2 4 58.3812641 312192 + 58.3812641 58.531091 adenosylhomocysteinase-like 2 None PALMALRKRAQGEKPLAGAK None None 69337 19.97 20.56 21.0 21.39 21.45 21.49 21.08 21.23 21.84 21.9 20.98 22.15 22.2 21.28 21.31 20.61 20.99 21.6 20.43 22.63 22.48 21.19 21.92 21.68 20.05 20.96 21.27 21.28 21.39 21.46 21.56 A0A0G2JT26 Strip2 4 58.5361311 500066 + 58.5361311 58.576046 striatin-interacting protein 2 None AGDNSQFCWRNLFSCINLLR None None None 16.76 18.41 16.61 16.59 17.73 17.34 16.62 16.12 17.75 17.0 17.05 17.42 16.67 17.73 17.24 17.13 17.15 16.02 18.08 17.23 17.57 18.08 16.95 17.45 17.41 16.65 17.08 17.12 17.94 16.81 17.21 M0R4P9 Ube2h 4 58.8346751 296956 - 58.8346751 58.930266 ubiquitin-conjugating enzyme e2h None EYKQKIKEYIQKYATEEALK None None None 18.31 16.42 17.0 18.05 18.26 16.61 19.57 18.96 16.95 17.31 17.71 17.77 18.54 16.96 17.6 18.83 16.9 18.54 18.14 18.79 16.79 17.51 18.18 16.88 18.94 19.47 17.48 17.55 17.79 18.0 18.44 A0A140UHX2 Zc3hc1 4 58.989991 296957 - 58.989991 59.011925 zinc finger, c3hc-type-containing 1 None SWESSSPVDRPELEAASPTTR None None 32315 15.12 13.81 15.22 14.16 15.65 15.79 14.42 14.38 15.32 14.31 13.95 16.14 15.51 15.47 15.56 14.67 15.26 15.64 16.02 13.76 16.45 15.51 15.43 15.32 15.9 15.22 15.78 15.03 15.59 15.68 16.16 A0A096MJP4 Cep41 4 59.2712191 500069 - 59.2712191 59.310602 centrosomal protein of 41 kda None LKKIECYLEADQGPANNPSR None None 10284 16.71 15.21 16.6 16.01 15.54 16.83 16.83 15.38 15.91 15.89 16.48 15.36 16.2 15.59 15.03 16.62 16.82 15.49 16.36 16.83 15.29 18.04 16.85 15.71 15.37 17.6 16.63 16.7 14.81 16.11 16.1 Q4KM37 Cep41 4 59.2712191 500069 - 59.2712191 59.310602 centrosomal protein of 41 kda None EPSGKDKPYPDCPFLLLDVR None None 10284 16.59 15.08 16.57 15.89 15.42 16.74 16.74 15.26 15.87 15.56 16.73 15.34 16.08 15.47 15.29 16.5 16.85 15.09 16.21 16.5 15.17 17.92 16.73 15.48 15.32 17.12 16.4 16.49 14.92 15.98 15.98 Q6P5P5 Mest 4 59.3547011 58827 + 59.3547011 59.36483 mesoderm-specific transcript homolog protein None IRNNDGNLVIDSLLQYINQR None None None 16.26 13.9 16.12 16.54 15.57 14.28 15.1 16.33 14.51 15.93 16.8 14.76 15.94 15.22 16.03 14.99 15.27 16.24 15.1 14.65 14.28 15.58 15.35 16.0 15.37 15.18 15.02 16.11 14.95 16.3 15.47 A0A0H2UHV9 Copg2 4 59.3665261 301742 - 59.3665261 59.501492 coatomer subunit gamma None NLITDSNRSIATLAITTLLK None None None 19.12 18.03 19.95 18.37 18.51 18.41 18.71 19.1 20.12 17.64 19.7 18.95 19.07 19.04 20.26 18.72 18.92 18.94 18.82 17.79 20.52 19.74 19.53 18.68 18.91 18.39 19.94 19.63 18.39 19.47 20.11 D4ABY2 Copg2 4 59.3665261 301742 - 59.3665261 59.501492 coatomer subunit gamma-2 None AKFGAQNESLLPSILVLLQR None None None 18.72 17.57 19.65 17.9 18.22 18.52 18.34 18.21 19.89 17.21 19.05 18.73 18.73 19.25 19.92 18.14 18.26 18.75 18.72 17.4 20.5 19.16 19.28 18.41 18.43 18.23 19.56 19.28 18.04 19.18 19.71 Q9WTQ2 Podxl 4 60.1351271 192181 - 60.1351271 60.181829 podocalyxin None FCKGSPPNERFLELLCHSAK None 602632 136790 15.31 16.86 16.66 17.11 17.18 16.31 15.58 17.83 15.95 15.97 18.38 17.0 17.34 16.45 15.96 16.56 16.87 17.29 16.44 16.92 16.95 16.02 17.58 17.66 16.95 16.67 17.01 15.64 17.64 16.3 16.34 D3ZES7 Plxna4 4 60.7265091 312213 - 60.7265091 61.089196 plexin a4 None PREGGTKVTIRGENLGLEFR None None None 18.73 20.7 19.33 20.11 18.98 19.54 17.96 18.4 19.25 20.04 18.67 18.79 19.01 18.52 19.59 20.18 19.81 18.19 18.74 19.59 18.43 19.93 19.64 19.08 19.12 19.91 19.86 20.45 18.9 18.03 18.29 D3ZUX5 Chchd3 4 61.3603551 296966 - 61.3603551 61.616821 coiled-coil-helix-coiled-coil-helix domain containing 3, isoform cra_a None SRLEERSSEFYKVTTEEYQK None None 9851 19.63 19.5 19.91 19.09 20.16 18.85 19.21 18.76 20.83 20.36 19.57 20.32 19.45 19.86 19.4 19.77 19.31 19.94 20.17 19.36 21.37 20.52 19.63 19.36 18.77 19.2 19.54 19.17 21.63 20.29 20.56 D4A6A9 Hmgb1 4 61.8059831 - 61.8059831 61.806602 high-mobility group box 1 None SEKWKIMSAKEKGKFEDMAK None None None 20.9 19.04 21.19 20.61 20.6 21.23 20.52 19.82 21.05 20.1 19.96 21.63 20.84 20.99 20.51 19.96 19.54 20.46 21.31 21.5 22.71 20.74 21.18 21.03 21.01 20.32 19.97 20.79 20.78 21.4 21.44 Q62824 Exoc4 4 61.8077791 116654 + 61.8077791 62.584316 exocyst complex component 4 None LKKIPETVKAIKERLEQELK None None 40654 19.43 17.26 18.68 19.06 17.31 19.37 18.97 19.07 17.93 19.18 18.95 19.25 19.6 18.97 19.97 19.95 19.18 18.53 19.7 17.54 18.89 19.55 19.5 19.25 19.17 20.02 19.35 19.21 18.24 19.44 19.18 P07943 Akr1b1 4 62.9320321 24192 - 62.9320321 62.946123 aldo-keto reductase family 1 member b1 None QNEKEVGVALQEKLKEQVVK None 103880 133743 21.73 23.42 21.66 21.46 21.84 20.88 22.19 22.28 20.11 21.48 21.82 19.9 20.91 20.96 20.53 21.55 20.68 21.96 21.01 22.77 20.53 21.2 20.97 20.96 22.58 21.61 20.85 21.04 21.7 21.11 20.9 A0A0G2JT64 Akr1b8 4 62.9971481 286921 + 62.9971481 63.053854 aldo-keto reductase family 1, member b8 None None None None 18.94 21.32 20.63 19.2 21.22 19.02 19.1 19.24 20.68 18.67 20.94 18.65 18.83 19.0 20.22 21.08 20.35 17.85 20.24 20.49 18.81 20.85 20.4 19.05 19.18 20.83 20.94 20.94 18.75 18.69 20.7 G3V786 Akr1b8 4 62.9971481 296972 + 62.9971481 63.053854 aldo-keto reductase family 1, member b8 None AKPDDPSLLQDPKIKEIAAK None None 116462 19.74 22.25 20.0 20.04 21.86 19.67 19.65 20.18 20.11 20.42 19.15 19.7 19.51 19.46 20.81 21.66 20.92 18.46 20.85 21.14 19.14 21.18 20.46 19.7 21.43 21.85 21.57 21.53 19.37 19.39 20.97 Q6AY99 Akr1b8 4 62.9971481 296972 + 62.9971481 63.053854 aldo-keto reductase family 1, member b10 (aldose reductase) None DQGLVKALGVSNFNHFQIER None None 116462 18.9 21.04 20.72 19.2 21.26 19.08 19.19 19.28 20.75 18.74 20.98 18.72 18.91 19.05 20.3 21.13 20.42 17.91 20.31 20.54 18.96 20.97 20.68 19.04 19.23 20.89 20.98 21.02 18.85 18.73 20.81 Q7TP58 Bpgm 4 63.140111 296973 + 63.140111 63.16858 phosphoglycerate mutase None DVLERLLPYWKERISPEILK None 222800 55599 18.45 19.05 18.07 17.57 17.46 17.56 19.0 18.66 17.78 18.19 19.4 18.11 17.72 18.35 16.77 17.13 17.89 19.22 17.17 18.66 18.74 17.46 16.8 19.18 17.36 16.99 16.96 17.63 17.29 17.33 18.28 A0A0G2JTV2 Cald1 4 63.3762891 25687 + 63.3762891 63.447048 non-muscle caldesmon l-Cad None None None None 19.07 17.82 19.89 18.38 18.82 18.39 19.39 20.34 19.16 18.66 20.71 18.35 19.55 19.91 19.2 18.91 18.79 19.05 18.34 20.32 18.61 19.2 19.59 19.43 19.0 18.65 20.0 19.21 17.51 19.78 19.51 Q62736 Cald1 4 63.3762891 25687 + 63.3762891 63.447048 non-muscle caldesmon None FEKLKQKQQEAALELEELKK None 114213 137254 19.09 17.84 19.84 18.4 18.85 18.32 19.43 20.42 18.98 18.63 20.68 18.13 19.54 19.87 19.26 18.88 18.78 19.01 18.34 20.3 18.62 19.14 19.57 19.38 19.08 18.97 19.98 19.23 17.52 19.76 19.53 B2RYI0 Wdr91 4 63.5543651 312225 - 63.5543651 63.591733 wd repeat-containing protein 91 None GKERRELLSTSSSQTQCAEK None None 8562 17.62 15.41 16.36 16.01 16.23 18.17 17.24 17.7 16.54 16.02 16.27 16.13 16.07 16.26 16.81 15.85 14.67 17.43 17.27 16.72 17.61 15.98 16.33 15.67 17.5 17.62 16.0 15.78 18.15 17.48 17.37 Q498M7 Cnot4 4 63.7127721 312227 - 63.7127721 63.814308 ccr4-not transcription complex, subunit 4 None CRFCWHRIRTDENGLCPACR None 604911 40870 15.71 15.58 16.1 17.01 16.78 16.57 15.72 15.52 16.11 16.03 17.08 16.14 17.03 17.59 15.97 16.79 17.06 17.51 15.69 16.51 16.68 16.4 16.57 16.02 18.0 16.61 16.64 16.94 17.24 15.86 16.67 D4A7R3 Nup205 4 63.8549351 362335 + 63.8549351 63.920844 nucleoporin 205 None EKIQKASSEGVAIQGQQGTR None None 45971 17.4 15.67 17.49 17.12 17.3 17.52 17.13 16.82 17.36 16.42 17.39 17.56 17.38 17.52 18.18 16.88 17.56 17.28 18.02 15.93 19.14 17.34 17.33 17.8 18.01 16.94 17.83 16.99 17.19 17.77 18.94 Q5EC47 Slc13a4 4 63.9443131 503568 - 63.9443131 63.988168 sodium sulfate cotransporter-2 None FLYPFFGVLRSSEVAAEYFK None None None 17.73 16.79 16.36 16.79 17.71 15.65 16.34 17.52 15.91 15.91 18.43 16.01 17.29 16.23 16.03 16.53 17.19 16.58 16.87 15.21 14.99 15.88 15.28 16.6 17.32 16.19 16.69 15.89 17.5 15.44 16.77 P62775 Mtpn 4 64.1592761 79215 - 64.1592761 64.186686 myotrophin None EFMWALKNGDLDEVKDYVAK None 606484 40607 20.86 23.13 20.75 20.62 20.72 22.29 21.33 20.21 20.71 21.46 20.35 21.41 20.5 20.95 20.34 21.71 20.31 21.95 21.06 21.5 21.15 21.06 20.58 20.99 20.38 21.48 20.36 21.8 20.12 20.69 20.34 P63090 Ptn 4 65.2937351 24924 - 65.2937351 65.375306 pleiotrophin None AECKYQFQAWGECDLNTALK None 162095 2117 17.1 18.05 18.21 18.72 18.15 18.78 17.21 18.23 19.27 19.2 18.13 19.42 19.18 18.78 19.04 18.24 18.65 18.64 18.27 18.13 20.04 18.83 19.4 19.12 17.18 18.24 19.81 18.59 18.06 18.28 18.38 F1MAB7 Dgki 4 65.4201091 688705 - 65.4201091 65.872733 diacylglycerol kinase iota None PRQVFDLSQEGPKDALELYR None 604072 37956 18.9 16.79 15.86 17.55 17.88 18.37 18.01 17.64 18.7 18.92 17.99 18.34 18.45 18.88 18.72 17.87 18.24 18.43 18.86 16.2 19.09 18.19 18.38 18.06 18.37 18.15 18.18 17.83 18.68 18.06 18.55 D3Z9D0 Rgd1306271 4 66.8426541 312246 - 66.8426541 66.968142 similar to kiaa1549 protein None IQLIAMQPIPAPPVPHPVLADR None None None 19.06 18.82 17.18 18.74 17.6 17.95 17.09 17.95 18.32 18.31 18.21 18.66 18.16 18.98 17.86 18.58 19.02 18.23 18.54 17.02 18.33 17.94 18.39 19.0 18.5 18.69 18.07 17.87 19.29 17.6 17.51 Q4G012 Fmc1 4 67.2741051 500087 + 67.2741051 67.28214 protein fmc1 homolog None SVEESAGLVGLQLPHQPGGK None None 41627 16.82 16.77 15.94 16.36 16.17 15.95 17.21 15.61 16.57 14.64 16.91 16.68 16.48 16.01 15.72 16.42 15.99 16.97 15.6 16.97 16.7 16.53 15.43 15.38 16.38 16.33 16.7 16.58 15.4 15.58 17.24 B2RYP6 Luc7l2 4 67.2876621 312251 + 67.2876621 67.347964 luc7-like 2 (s. cerevisiae) None GECLKVHDLALRADYEIASK None 613056 56737 18.47 17.61 19.25 18.56 18.7 18.35 17.4 18.74 19.47 17.56 18.22 19.61 19.05 19.09 19.48 18.0 18.68 19.21 18.5 18.92 20.66 18.6 18.64 19.24 19.38 18.64 19.64 18.31 19.83 19.21 20.31 Q0ZCA7 Clec2l 4 67.3982671 296985 + 67.3982671 67.414537 c-type lectin domain family 2 member l None GPEGLLRRSGSGYEGSTSWK None None 35527 17.96 15.72 17.04 17.31 18.87 18.4 16.82 17.63 18.22 18.96 17.38 18.96 18.48 18.06 17.28 18.09 17.46 18.99 17.5 18.79 18.85 16.94 18.73 18.29 16.82 17.41 17.76 17.23 19.52 18.34 17.96 D4A9Z8 Chmp4bl1 4 68.0497431 679886 + 68.0497431 68.050777 chromatin-modifying protein 4b-like 1 None DPTPQEAIQRLRDTEEMLSK None None None 20.7 17.96 19.16 20.26 20.39 19.64 19.25 20.99 19.57 19.44 20.74 19.96 20.46 19.33 19.25 20.19 21.08 20.29 19.13 20.29 18.32 19.97 20.09 20.36 20.74 20.91 20.03 18.79 21.4 20.34 20.54 A0A0G2QC40 Mkrn1 4 68.1758871 296988 - 68.1758871 68.197177 ring-type e3 ubiquitin transferase None PMDAAQRSQHIKSCIEAHEK None None 32175 15.48 12.85 15.48 15.58 14.99 14.26 15.43 15.19 14.78 15.06 14.8 14.22 15.42 15.91 15.32 15.48 15.56 15.67 15.51 15.42 15.98 14.31 15.64 16.09 17.05 15.6 15.22 14.71 15.42 15.71 15.43 D3ZLQ1 Dennd2a 4 68.2330271 312257 - 68.2330271 68.291861 denn domain-containing 2a None DHRKSYEFEDLLQSSSENSR None None 35238 16.3 16.55 17.16 18.38 17.42 16.43 17.97 18.0 16.99 16.74 18.32 17.32 17.47 16.36 17.26 17.1 18.29 16.54 17.23 16.77 17.37 16.35 17.21 17.4 17.19 17.77 16.43 16.84 17.48 17.4 17.71 F1M9C3 Braf 4 68.3855411 114486 - 68.3855411 68.509899 non-specific serine/threonine protein kinase None VAVKMLNVTAPTPQQLQAFK None None None 18.27 20.49 19.42 18.7 18.57 18.64 18.73 18.17 18.54 17.33 18.1 18.07 18.04 18.25 18.63 19.43 18.66 18.6 19.03 16.96 17.85 18.13 18.01 18.78 19.17 18.87 18.86 18.48 17.32 17.76 18.11 Q0ZFS4 Mrps33 4 68.5967341 296995 - 68.5967341 68.600168 mitochondrial ribosomal protein s33 None PTDSKSMKVVNLFSEQPLAK None 611993 7729 17.02 16.07 15.95 17.32 17.45 15.88 16.13 16.98 16.49 16.41 15.91 16.07 17.48 16.66 15.6 16.46 15.5 17.18 17.11 17.58 15.28 15.94 15.55 16.93 17.94 17.49 16.92 15.33 18.17 16.75 18.02 D3Z9L0 Agk 4 69.1146351 502749 + 69.1146351 69.193217 acylglycerol kinase None DLTSKEDFMNICIEPDTVSK None 610345 41239 19.87 21.91 19.87 20.9 20.45 18.81 20.69 20.15 20.67 20.0 19.2 18.98 18.99 19.44 20.58 21.15 20.81 19.32 19.53 20.07 19.07 20.33 20.13 20.77 20.34 21.91 19.6 20.75 18.48 19.2 20.22 Q0PGW2 Dennd11 4 69.2021341 312270 - 69.2021341 69.228745 denn domain-containing protein 11 None LEQNNRIFQTLLEVSASQDK None None None 15.89 16.26 15.42 15.76 15.84 15.83 16.92 16.09 15.87 14.47 16.64 16.59 15.32 16.54 16.74 15.37 15.45 15.42 16.98 15.79 16.85 16.59 15.33 15.21 16.89 16.46 15.78 16.83 15.68 16.92 16.88 P28042 Ssbp1 4 69.2661071 54304 + 69.2661071 69.276195 single-stranded dna-binding protein None NEMWRSGDNEAYQMGDVSQK None 600439 74462 17.97 15.85 16.98 16.53 17.79 17.57 18.32 16.1 16.98 18.38 18.02 17.0 17.96 17.44 17.13 17.45 16.89 17.87 16.92 18.63 17.51 18.56 17.48 16.44 18.08 16.75 17.9 16.99 17.87 17.95 18.3 M0RC17 Chl1 4 136.4211151 + 136.4211151 136.5021 cell adhesion molecule l1-like None LTRVRGEETDVVLPLAPYVR None None None 17.97 17.35 18.47 18.0 18.54 18.38 18.27 18.14 19.24 18.3 17.31 19.26 18.94 18.63 17.95 18.54 19.02 18.34 17.48 20.08 18.97 18.26 17.65 18.4 17.8 18.37 18.87 19.35 17.8 18.8 19.84 P00762 Prss1 4 70.364591 24691 + 70.364591 70.367792 anionic trypsin-1 None LGEHNINVLEGDEQFINAAK None 276000 88408 16.59 15.54 16.03 15.99 16.57 17.05 16.75 15.89 16.21 16.35 17.16 15.96 16.31 15.32 16.67 16.56 15.81 15.67 16.13 16.31 15.09 16.75 16.61 15.24 16.15 15.39 15.56 16.54 16.94 16.53 16.36 P0C0K7 Ephb6 4 70.4919741 312275 + 70.4919741 70.50723 ephrin type-b receptor 6 None DPTYIKIEEVIGAGSFGEVR None 602757 20940 15.74 16.81 15.3 15.96 14.97 15.4 15.05 14.22 15.73 16.48 15.88 15.68 15.08 16.59 14.85 15.2 15.88 14.35 16.89 15.81 15.96 16.77 15.31 16.05 15.16 15.23 14.82 16.44 15.75 15.3 14.5 P24473 Gstk1 4 71.1189321 297029 + 71.1189321 71.123309 glutathione s-transferase kappa 1 None IWSRDEDITESQNILSAAEK None None 41075 17.68 18.2 18.06 18.21 18.32 17.83 18.48 18.62 17.68 17.18 17.77 17.66 18.58 17.87 18.4 18.03 18.88 18.18 18.34 16.82 17.38 17.38 17.49 18.67 18.3 18.56 18.91 18.22 16.5 17.61 19.54 F8WFH6 Fam131b 4 71.2010391 500102 - 71.2010391 71.210228 protein fam131b None LAPEEEEDAGCRDLESLSPR None None 8797 18.73 17.01 18.03 18.44 18.79 18.43 18.32 17.27 20.55 18.91 18.43 18.52 18.95 19.1 17.47 18.78 18.76 19.06 18.9 18.38 18.12 19.07 19.1 18.95 17.54 18.51 18.43 18.6 18.45 18.75 19.0 Q568Z1 Fam131b 4 71.2010391 500102 - 71.2010391 71.210228 protein fam131b None VSDVTSSGVQSFDEEEGDANN None None 8797 18.66 16.83 17.78 18.31 18.65 18.39 18.4 17.14 20.4 18.6 18.58 18.57 18.75 18.97 17.7 18.65 18.43 19.65 18.31 17.92 17.99 18.94 18.93 18.8 17.31 18.4 18.02 18.31 18.55 18.61 18.94 D4A7U1 Zyx 4 71.2376981 114636 + 71.2376981 71.246553 zyxin None PQPPSFTYAQQKEKPLVQEK None 602002 19894 16.33 17.51 18.1 17.63 17.73 17.53 18.52 19.12 18.51 17.56 18.66 17.8 18.59 18.32 16.86 18.05 18.84 18.63 16.72 18.26 17.81 16.86 18.78 16.97 17.64 17.44 17.69 17.18 19.06 17.56 17.63 D3Z8A4 Tcaf1 4 71.5945531 362353 - 71.5945531 71.614069 similar to mkiaa0738 protein, isoform cra_a None PGRQVIDVSLPEDAASADLK None None None 16.04 14.28 15.66 15.46 15.0 14.92 15.83 15.29 14.44 16.18 15.42 14.76 15.73 15.18 15.89 14.53 15.7 14.4 15.51 14.92 14.9 16.48 14.92 15.04 15.26 14.9 15.17 15.26 15.4 15.76 15.39 B5DEJ6 Tpk1 4 72.1701351 680668 - 72.1701351 72.557694 thiamine pyrophosphokinase None PVPIIIIQKESLIYLLQPGK None None None 14.75 15.24 15.51 15.35 17.15 15.7 16.19 16.31 16.62 16.42 15.81 16.66 16.72 15.32 15.15 15.92 15.79 16.79 16.02 16.36 16.73 15.85 16.76 16.84 14.51 15.69 16.74 15.12 15.19 15.62 15.49 B1WBY1 Cul1 4 76.5518721 362356 + 76.5518721 76.620245 cul1 protein None FYTRESTEFLQQNPVTEYMK None None 2663 20.07 17.55 19.42 17.96 18.23 19.13 20.1 19.6 19.24 17.98 19.74 19.64 19.83 19.15 19.44 19.56 19.53 19.17 18.45 20.05 19.74 20.56 19.89 18.93 20.96 19.15 20.23 19.64 18.01 19.96 19.41 G3V6T7 Pdia4 4 76.8033451 116598 - 76.8033451 76.822245 protein disulfide-isomerase a4 None KKGQAVDYDGSRTQEEIVAK None None 21020 19.82 16.86 19.69 18.73 19.41 18.83 19.0 19.93 18.48 18.63 20.51 18.28 19.5 19.3 19.19 17.96 18.86 19.42 17.59 20.13 18.81 18.66 19.07 19.85 19.2 17.86 19.16 18.76 17.98 19.55 19.46 P38659 Pdia4 4 76.8033451 116598 - 76.8033451 76.822245 protein disulfide-isomerase a4 None QKDLVIAKMDATANDITNDR None None 21020 19.82 16.86 19.69 18.73 19.41 18.83 19.0 19.93 18.48 18.63 20.51 18.28 19.5 19.3 19.19 17.96 18.86 19.42 17.59 20.13 18.81 18.66 19.07 19.85 19.2 17.86 19.16 18.76 17.98 19.55 19.46 B1WC25 Tra2a 4 78.2208391 500116 - 78.2208391 78.239724 tra2a protein None SYYDRGYDRGYDRYEDYDYR None None 40866 16.66 17.14 16.37 17.03 17.31 15.9 16.16 17.71 16.91 17.03 16.09 17.2 16.68 16.5 17.62 16.93 16.76 17.28 17.89 16.96 17.74 16.47 16.82 17.3 17.37 18.67 18.22 16.31 17.58 16.18 17.81 Q4V8D7 Fam221a 4 78.3373291 500118 + 78.3373291 78.358954 protein fam221a None QAVDEYLEYRRIVGEDDGGK None None None 14.72 15.7 15.05 13.63 15.03 15.71 14.35 14.02 12.74 15.62 13.85 15.24 14.6 15.99 13.73 14.15 14.95 14.66 16.36 14.12 15.42 13.79 14.08 14.94 15.23 15.06 13.89 14.62 15.91 14.7 13.73 D3ZYK5 Rgd1563352 4 78.3675981 500119 - 78.3675981 78.368073 similar to ribosomal protein s11 None GETGKEKLPRYHKNIGLGFK None None None 20.25 21.38 19.03 20.51 19.71 18.86 18.78 20.46 20.21 19.55 19.26 20.78 18.93 20.06 19.95 20.24 19.82 20.25 19.57 19.7 19.72 20.45 19.23 20.64 20.16 21.23 20.35 18.97 20.41 18.97 19.93 A0A0G2JWJ2 Stk31 4 78.3706511 500120 + 78.3706511 78.466222 serine threonine kinase 31 None YSVDVDTEGRVIQRAASYHR None None None 20.06 20.26 19.55 20.49 18.06 19.92 18.62 19.34 19.66 21.24 19.29 19.3 20.01 19.61 19.92 19.2 20.33 19.98 17.89 20.21 19.79 20.69 19.47 21.11 19.53 19.77 19.89 19.04 20.09 19.25 19.15 A0A0G2K4N7 Mpp6 4 79.1734891 362359 + 79.1734891 79.25414 membrane palmitoylated protein 6 None TSEFMPYVVFIAAPELETLR None 606959 22976 19.91 20.55 20.36 20.33 20.38 19.44 21.54 20.04 20.7 20.17 19.34 20.69 20.47 20.56 20.61 19.6 19.29 19.67 21.77 20.6 21.23 20.18 19.65 20.3 20.33 20.39 20.56 20.38 18.82 21.23 21.52 B5DFE0 Mpp6 4 79.1734891 362359 + 79.1734891 79.25414 membrane palmitoylated protein 6 None EGNLYGTKIGSILDVVQTGR None 606959 22976 19.98 20.74 20.34 20.34 20.4 19.44 21.61 20.06 20.71 20.19 19.32 20.68 20.39 20.53 20.41 19.63 19.27 19.64 21.91 20.48 21.21 20.14 19.62 20.37 20.35 20.4 20.41 20.33 18.84 21.18 21.46 F1MAG0 Gsdme 4 79.2623251 - 79.2623251 79.310695 gasdermin e None GTLRKQEVDVQQLIQDAVGR None None None 17.57 16.41 17.08 17.88 16.11 17.97 17.79 17.86 18.7 18.07 17.69 18.12 17.56 17.24 18.44 17.5 18.02 18.24 17.4 16.69 18.06 19.54 18.25 17.09 16.19 17.68 18.59 18.76 16.31 17.98 18.97 D3ZHZ3 Osbpl3 4 79.3465711 362360 - 79.3465711 79.428896 oxysterol-binding protein None FRPDQRLLEEGNIEEAEVQK None 606732 49422 16.59 14.48 15.84 16.71 16.23 15.76 16.48 15.01 17.16 16.42 16.58 16.78 16.31 16.35 15.48 15.38 15.84 16.96 15.88 16.17 17.0 16.18 17.37 15.74 15.82 14.64 16.45 16.18 15.8 16.27 15.94 P62898 Cycs 4 79.6518961 100363502 - 79.6518961 79.653994 cytochrome c, somatic None YLENPKKYIPGTKMIFAGIK None None None 22.24 24.44 23.37 23.09 22.74 21.21 22.91 20.55 22.29 22.09 21.68 21.53 21.6 22.04 20.82 22.01 21.71 22.24 22.81 23.13 23.27 21.84 21.68 21.66 23.62 22.04 21.65 21.8 22.62 21.76 21.93 A7VJC2 Hnrnpa2b1 4 80.5390541 362361 - 80.5390541 80.54284 heterogeneous nuclear ribonucleoproteins a2/b1 None GFGFVTFSSMAEVDAAMAARPHSIDGR None None 22992 22.48 22.56 23.18 22.42 22.57 22.09 21.5 22.34 23.7 21.97 21.34 22.68 22.69 23.21 23.77 21.76 22.76 21.72 23.08 22.61 24.17 22.74 22.65 23.43 23.29 22.5 23.51 21.49 23.41 22.95 23.89 F1LNF1 Hnrnpa2b1 4 80.5390541 362361 - 80.5390541 80.54284 heterogeneous nuclear ribonucleoproteins a2/b1 Hnrpa2; Hnrpa2b1; hnRNP None None None None 22.48 22.56 23.18 22.42 22.57 22.09 21.51 22.34 23.7 21.97 21.34 22.68 22.69 23.21 23.77 21.76 22.76 21.72 23.08 22.61 24.17 22.74 22.65 23.46 23.29 22.5 23.5 21.5 23.38 22.95 23.89 Q5RJK5 Cbx3 4 80.5460231 297093 + 80.5460231 80.559283 chromobox 3 None GFTDADNTWEPEENLDCPELIEAFLNSQK None None 40583 18.2 18.99 19.48 18.91 18.88 18.69 19.45 18.58 20.0 18.17 18.42 19.88 19.26 19.49 19.45 18.49 18.69 18.06 19.48 20.12 20.84 19.27 18.71 17.81 19.23 18.83 19.52 19.99 18.85 19.61 20.41 P29266 Hibadh 4 81.6491851 63938 - 81.6491851 81.747244 3-hydroxyisobutyrate dehydrogenase None GTTLMAKDLGLAQDSATSTK None None 15088 19.86 18.16 19.84 19.33 19.55 18.86 19.95 18.47 19.23 19.54 20.2 18.35 19.33 19.58 18.23 18.9 18.68 19.39 19.03 20.8 19.31 19.06 19.57 18.33 19.57 18.54 19.85 18.16 19.48 20.03 19.52 Q66HA4 Tax1bp1 4 81.8220671 246244 + 81.8220671 81.879093 tax1-binding protein 1 homolog None QQGFERHVQTHFDQNVLNFD None 605326 4395 18.56 17.12 18.14 17.65 17.11 17.89 18.01 16.85 16.69 18.41 17.88 17.03 17.97 16.9 16.24 18.51 18.25 18.41 17.6 18.4 17.31 18.78 17.52 19.04 17.52 18.5 16.21 17.27 17.99 17.8 16.88 A0A0G2JXD5 Chn2 4 83.1486941 84031 + 83.1486941 83.407703 chimaerin None SSLVRRAALTHNDNHFNYEK None 602857 31213 17.29 16.91 17.66 17.03 17.78 17.18 18.34 17.72 18.07 16.64 16.94 18.38 18.14 18.17 18.99 16.94 16.8 17.34 18.01 17.55 18.61 17.64 17.13 16.83 17.96 17.45 18.44 17.98 16.54 17.96 19.15 Q03070 Chn2 4 83.1486941 84031 + 83.1486941 83.407703 beta-chimaerin None SSLVRRAALTHNDNHFNYEK None 602857 31213 16.41 15.72 16.68 15.9 16.79 16.26 17.14 16.64 16.8 15.51 15.83 17.39 17.08 16.98 17.73 15.97 15.62 16.23 17.04 16.52 17.56 16.5 16.17 16.48 16.9 16.35 17.21 16.75 15.29 16.83 18.14 Q9Z0G8 Wipf3 4 83.5504691 259242 + 83.5504691 83.629922 was/wasl-interacting protein family member 3 None GGSTPPALGDLFAGGFPVLRPAGQR None 612432 113391 17.8 19.32 17.02 17.3 18.12 18.85 16.64 17.28 16.99 17.91 17.68 18.32 16.94 17.31 16.68 19.16 17.76 18.06 17.04 18.17 16.83 17.03 18.2 17.02 18.0 18.37 17.37 18.03 19.35 16.82 16.82 Q6AY84 Scrn1 4 83.6321251 502776 - 83.6321251 83.69408 secernin-1 None DHEAESKVECTYISIDQVPR None None 8853 22.18 19.45 22.67 20.6 22.2 21.71 22.45 20.97 21.12 21.94 19.7 21.29 22.01 20.82 20.01 20.24 21.68 20.57 22.2 22.55 22.81 21.99 21.14 20.63 21.82 20.96 20.89 20.9 21.88 22.57 21.59 D3ZPV8 Ggct 4 84.1231191 362368 - 84.1231191 84.129308 gamma-glutamylcyclotransferase None VVWKMNKSNLSSLDEQEGVK None 137170 11437 17.06 16.46 16.71 16.97 16.61 17.43 17.96 16.56 16.86 16.31 17.56 16.51 16.7 17.53 16.19 15.51 15.59 17.95 16.62 18.03 17.6 16.93 16.71 16.51 17.51 16.16 16.83 16.92 16.15 17.21 18.07 Q5I0G4 Gars 4 84.1716471 297113 + 84.1716471 84.212568 glycine--trna ligase None KRVLEAKELALQPKDDIVDR None 600287 1547 21.6 19.45 21.48 19.72 21.4 21.29 21.85 20.28 18.77 20.94 20.18 20.09 20.48 19.65 18.97 19.21 20.67 19.46 20.98 21.59 21.21 19.73 19.66 20.4 21.44 19.17 19.48 19.33 20.35 21.92 19.57 P32215 Adcyap1r1 4 84.5938931 24167 + 84.5938931 84.6427 pituitary adenylate cyclase-activating polypeptide type i receptor None AIAMHSDCIFKKEQAMCLER None 102981 870 15.92 17.47 18.28 18.04 17.46 16.2 17.94 17.55 16.87 17.68 18.57 16.36 18.25 17.05 18.9 17.96 18.29 16.68 17.73 16.46 17.47 17.69 18.13 17.75 18.34 17.77 17.64 17.64 17.32 17.11 17.31 Q8CJC8 Ppp1r17 4 85.2138881 266705 + 85.2138881 85.230603 g substrate, isoform cra_b None KKPRKGKNVQATLNVESDQK None 604088 None 15.9 14.86 16.0 15.53 16.5 15.92 17.08 16.01 16.39 15.34 15.3 16.78 16.59 16.44 15.44 15.35 14.74 16.02 17.08 16.8 17.05 15.88 15.84 14.7 16.32 15.94 15.61 16.18 16.56 16.43 17.36 A0A0G2KAI1 Pde1c 4 85.3008591 81742 - 85.3008591 85.572861 phosphodiesterase None SSGSEGSAPINNSVIPVDYK None 602987 3682 18.21 15.76 18.47 17.41 17.61 18.32 18.34 17.43 17.13 16.53 17.85 17.41 17.83 18.31 17.35 17.37 17.06 17.31 17.9 18.23 17.37 18.62 17.42 17.61 18.54 16.9 17.45 17.14 17.24 18.53 18.2 Q63421 Pde1c 4 85.3008591 81742 - 85.3008591 85.572861 calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1c None FRQGDREAELGLPFSPLCDR None 602987 3682 17.04 15.94 18.47 17.41 17.61 18.32 18.58 17.43 17.13 16.53 17.85 17.41 18.27 18.31 17.55 17.37 16.96 17.21 17.92 18.29 17.37 18.62 18.35 17.24 18.54 16.9 16.82 17.81 17.45 17.89 17.49 D3ZVU6 Avl9 4 85.9616011 312371 + 85.9616011 86.001726 avl9 cell migration-associated None YLPSLALPDGAHNYQEDTVFFHLPPR None None None 18.78 18.17 19.3 17.91 16.59 18.65 18.68 17.5 18.47 17.68 17.64 16.75 17.9 18.31 18.17 17.32 18.48 18.74 18.14 16.93 18.64 19.14 18.11 17.61 17.59 18.87 18.66 18.45 16.83 18.09 17.46 D3ZVS6 Kbtbd2 4 86.0279481 312372 - 86.0279481 86.050211 kelch repeat and btb (poz) domain containing 2, isoform cra_a None YSPQAEKVYKLCSPPADLHK None None 17122 16.87 16.0 15.36 14.75 16.9 16.46 14.66 15.66 16.44 14.67 15.7 15.47 14.67 14.85 16.08 16.34 15.15 16.07 15.26 16.85 16.64 15.05 15.86 16.56 16.16 16.35 15.05 15.96 16.41 15.95 15.55 B2GUX5 Nt5c3a 4 86.1612671 312373 - 86.1612671 86.204601 5'-nucleotidase None SSVRIKNPTRVEEIICGLIK None 606224 9534 19.75 16.81 19.1 19.1 18.78 19.01 20.07 18.65 17.13 18.96 17.99 18.81 19.11 17.9 17.89 18.64 18.96 17.37 19.78 19.63 18.96 17.55 18.37 19.08 20.46 17.91 18.0 17.81 17.97 19.45 19.03 Q68FQ9 Lancl2 4 87.4433051 362375 - 87.4433051 87.482908 lanc lantibiotic synthetase component c-like 2 (bacterial) None SFPNPFLDYEVAASATGFASGTAEETGR None 612919 23116 18.2 19.97 20.46 19.58 18.75 19.74 20.43 19.35 20.29 20.19 19.13 19.35 20.67 20.24 19.74 19.64 19.52 21.12 20.5 19.13 21.78 20.69 20.65 19.0 20.24 21.32 19.64 20.61 20.37 19.56 19.62 D4A7X5 Ppm1k 4 87.6122051 312381 + 87.6122051 87.636152 protein phosphatase 1k (pp2c domain containing) None EAAHAVTEQAIQYGTEDNSTAVVVPFGAWGK None 611065 36819 17.22 15.39 15.52 16.88 17.15 15.36 17.64 17.25 18.1 18.12 17.82 18.06 17.87 18.25 18.39 17.01 17.32 16.51 17.89 16.83 18.58 18.33 18.17 16.15 17.79 17.71 17.59 17.62 18.0 17.89 17.97 Q5PPG6 Nap1l5 4 88.0226741 688843 - 88.0226741 88.02454 nucleosome assembly protein 1-like 5 None QKRCDKIEAKFDKEFQALEK None 612203 36397 19.55 18.88 19.59 19.51 18.57 18.76 19.74 19.06 18.07 19.7 19.15 18.19 19.12 18.64 18.41 18.68 19.04 19.4 18.18 19.98 18.04 19.5 18.55 18.95 18.51 19.22 18.84 18.15 18.89 19.78 18.2 D3ZF21 Gprin3 4 88.5724671 502784 - 88.5724671 88.575114 gprin family member 3 None IRNDPPNTSTCPVPEDSLVK None None None 18.38 16.38 17.33 17.68 18.11 17.86 16.34 16.71 18.1 17.56 17.34 16.96 17.37 18.42 16.29 17.56 18.54 16.7 18.03 18.01 17.42 18.4 18.68 18.04 17.73 18.09 17.56 17.28 18.7 18.12 17.55 P37377 Snca 4 89.6963831 29219 - 89.6963831 89.796289 alpha-synuclein None GEEGYPQEGILEDMPVDPSSEAYEMPSEEGYQDYEPEA None 163890 293 25.07 26.24 24.68 25.19 24.51 25.19 25.2 24.46 25.02 25.35 24.41 25.29 24.93 24.83 23.66 25.62 25.31 25.39 25.05 24.5 25.35 24.6 25.0 25.1 24.76 25.05 23.65 24.85 25.6 23.72 23.98 Q63226 Grid2 4 93.1119311 79220 + 93.1119311 93.857174 glutamate receptor ionotropic, delta-2 None CIRKNSKPWQGGRSMLETIK None 602368 74399 19.04 18.66 19.03 18.85 19.52 18.85 18.87 19.38 19.93 18.65 18.65 20.09 19.87 19.87 19.22 18.68 18.49 19.44 20.55 19.13 20.25 19.2 18.97 18.86 19.39 19.25 19.4 20.36 19.42 19.45 20.7 Q5XIM3 Rsa-14-44 4 95.2516581 297173 + 95.2516581 95.253028 rsa-14-44 protein None LVIVGDGACGKTCLLIVFSK None None 130028 17.79 18.9 19.94 18.45 18.12 20.18 20.59 17.99 18.9 19.36 19.74 19.1 19.9 19.92 18.26 19.52 18.84 19.68 18.74 20.05 20.16 20.5 19.91 18.03 18.93 18.53 18.85 18.79 19.89 18.81 18.66 D4ACM2 Mad2l1 4 95.9067831 297176 + 95.9067831 95.912785 mad2 (mitotic arrest deficient, homolog)-like 1 (yeast), isoform cra_a None SVQKLVVVISNIESGEVLER None 601467 1768 15.97 13.8 16.5 15.91 16.27 15.59 15.74 16.24 15.89 14.9 16.72 15.36 16.38 14.69 16.64 16.95 16.31 15.99 16.44 14.91 16.74 16.93 16.57 17.06 16.82 16.82 16.83 15.36 15.43 16.8 17.01 G3V6P8 Gng12 4 96.0362471 114120 + 96.0362471 96.131342 guanine nucleotide-binding protein subunit gamma None STAQARRTVQQLRLEASIER None None 32427 19.14 17.93 18.06 18.5 19.37 19.74 19.68 19.86 18.3 19.28 20.09 19.12 18.79 18.98 19.09 18.92 19.81 18.61 17.91 20.0 18.22 18.87 19.8 18.38 19.44 18.27 17.77 18.74 20.23 20.2 18.45 Q6AXS5 Serbp1 4 96.4015821 246303 + 96.4015821 96.418594 plasminogen activator inhibitor 1 rna-binding protein None PSVGVADKKEETQPPVALKK None None 134208 20.24 18.47 20.48 19.85 19.69 19.53 19.11 19.18 20.45 19.27 20.49 20.3 20.49 20.8 19.18 19.48 19.99 20.4 20.16 20.34 22.02 20.18 20.64 20.35 20.58 20.6 19.86 19.56 21.58 20.62 20.53 F1LTN6 Igkc 4 96.5709371 + 96.5709371 96.791434 immunoglobulin kappa constant None None None None 21.23 18.82 20.36 21.23 21.0 21.85 21.62 20.91 21.34 20.04 21.99 19.75 21.18 20.08 20.5 20.04 21.3 19.47 20.2 21.34 21.05 18.93 20.61 20.53 19.6 20.51 19.2 20.22 20.97 20.03 21.6 Q5M7T9 Thnsl2 4 103.1129661 297332 - 103.1129661 103.132064 threonine synthase-like 2 None SDELDEPIKAVFADVAFVQR None None 5489 18.09 17.37 17.92 18.31 18.12 18.01 19.6 18.58 17.6 18.84 17.94 18.36 18.06 17.77 17.1 17.34 17.95 17.44 19.4 18.39 18.65 17.41 17.14 17.38 17.17 17.49 17.45 18.26 17.51 19.5 19.13 D3ZWU9 Rmnd5a 4 103.3803211 312439 - 103.3803211 103.432502 ring-type e3 ubiquitin transferase None SIFACPILRQQTTDNNPPMK None None 5668 17.39 15.01 16.73 16.4 15.82 17.61 15.12 15.45 17.21 16.79 17.09 17.27 16.93 17.77 16.91 16.3 17.03 17.74 16.28 15.27 17.65 17.29 17.85 17.45 16.33 14.87 17.24 16.91 16.94 16.56 16.49 Q8CGS4 Chmp3 4 103.5764571 282834 + 103.5764571 103.622226 charged multivesicular body protein 3 None VTDALPEPEPAGAMAASEGDEEDDEEDLEAMQSR None None None 19.35 20.32 18.98 18.52 18.38 18.41 18.37 19.86 18.4 19.47 17.69 18.42 18.71 18.64 17.61 18.3 20.13 19.45 18.28 18.44 18.88 18.68 18.67 19.13 19.28 19.92 18.37 17.79 20.56 18.11 17.75 D4A193 Reep1 4 103.7461011 362384 + 103.7461011 103.862337 receptor expression-enhancing protein None VAATAAVMAASKGQGALSER None 609139 41504 17.38 19.01 17.47 17.83 17.18 18.55 17.85 17.92 17.65 17.83 18.19 17.2 17.57 17.89 17.26 17.69 18.1 17.61 18.37 16.71 17.36 17.77 17.3 17.72 17.48 18.63 17.34 17.96 17.83 16.67 17.09 A0A0G2JVH4 Immt 4 103.8805211 312444 + 103.8805211 103.919278 micos complex subunit mic60 None ARFYAVQKLAGRVAMIDETK None 600378 38234 21.48 23.49 21.33 21.12 22.29 19.97 20.72 20.19 21.4 22.2 20.98 20.27 20.61 21.51 21.64 21.34 21.5 21.05 21.54 19.93 21.22 21.01 20.6 20.9 21.93 21.04 20.97 20.51 23.07 21.07 20.98 Q3KR86 Immt 4 103.8805211 312444 + 103.8805211 103.919278 micos complex subunit mic60 None LAQQKATEKQHIELALERQK None 600378 38234 21.44 23.42 21.27 21.13 22.34 20.16 20.69 20.41 21.38 22.1 20.96 20.33 20.54 21.25 21.63 21.57 21.39 21.07 21.48 19.91 21.0 20.84 20.47 20.83 21.99 20.78 20.96 20.49 23.04 20.98 21.0 A0A0G2JU15 Ptcd3 4 103.9224511 500199 - 103.9224511 103.949791 pentatricopeptide repeat domain 3 None RDLELAYQLHGLLNTGDNRK None None 41211 16.45 15.67 17.05 17.34 17.32 16.29 17.24 16.57 17.69 18.08 17.27 17.26 18.13 17.74 17.9 15.8 16.76 16.48 17.81 17.07 18.76 16.35 16.96 16.13 17.54 15.49 17.58 16.14 18.49 18.02 17.11 B2GV41 Usp39 4 104.3739561 297336 - 104.3739561 104.406359 ubiquitin specific protease 39, isoform cra_b None GSMRIFTKKLPHPDLPAEEK None 611594 13183 16.37 16.39 16.7 16.83 16.59 15.93 15.65 16.53 17.04 15.81 15.98 16.91 16.56 17.36 17.75 15.77 16.7 16.37 17.37 15.55 17.93 16.85 16.22 17.26 17.93 16.51 17.76 16.69 16.31 16.72 18.35 Q6AXU4 Rnf181 4 104.4146061 297337 - 104.4146061 104.421309 e3 ubiquitin-protein ligase rnf181 None DWEHHLPPPAAKAVVESLPR None 612490 9537 17.38 17.75 16.84 17.04 17.04 15.67 17.92 17.77 16.57 16.7 17.57 16.8 16.44 16.47 17.11 17.36 16.73 16.3 16.61 17.24 15.12 17.82 16.5 15.66 17.57 16.66 16.04 17.17 17.42 16.44 16.4 F1LRB8 Mat2a 4 104.4884751 171347 - 104.4884751 104.49548 s-adenosylmethionine synthase None LPWLRPDSKTQVTVQYMQDR None 601468 38112 20.42 20.37 18.95 20.25 20.7 18.95 20.12 20.46 19.2 18.47 19.07 20.13 19.73 19.5 19.33 19.27 19.41 19.6 19.28 21.42 18.68 19.81 18.85 18.97 21.3 20.31 19.14 19.42 20.6 19.5 20.94 P18298 Mat2a 4 104.4884751 171347 - 104.4884751 104.49548 s-adenosylmethionine synthase isoform type-2 None DYQKVVREAIKHIGYDDSSK None 601468 38112 20.46 20.14 19.01 20.27 20.65 19.04 20.19 20.6 19.23 18.41 19.11 20.08 19.81 19.44 19.42 19.31 19.52 19.54 19.2 21.39 18.37 19.86 18.98 19.01 21.44 20.21 19.07 19.3 20.69 19.55 20.95 Q6AYC4 Capg 4 104.6000631 297339 + 104.6000631 104.611855 macrophage-capping protein None FISRMRYSPNTQVEILPQGR None 153615 37523 18.59 16.29 18.52 17.42 17.92 17.59 18.2 18.1 16.68 17.58 18.43 16.99 17.63 16.23 17.03 16.79 17.01 17.57 18.58 17.87 18.03 18.14 17.24 17.86 17.62 16.9 17.99 16.45 17.29 18.44 18.68 G3V7V6 Retsat 4 104.6531121 246298 + 104.6531121 104.662242 all-trans-13,14-dihydroretinol saturase, isoform cra_b None SAAILAKAGKRVLVLEQHTK None None 41195 17.87 19.13 18.57 17.34 17.11 18.06 17.26 18.67 18.08 15.9 18.83 17.19 17.44 19.01 19.86 18.83 17.49 17.24 17.81 17.36 16.49 18.84 18.59 16.97 18.8 18.74 19.32 19.05 17.49 16.93 17.64 Q8VHE9 Retsat 4 104.6531121 246298 + 104.6531121 104.662242 all-trans-retinol 13,14-reductase None TFREASMSVIMKLFPQLEGK None None 41195 17.87 19.14 18.59 17.26 17.1 17.99 17.24 18.82 18.13 15.88 18.83 17.2 17.45 18.81 19.86 19.01 17.49 17.24 17.81 17.36 16.47 18.83 18.51 16.98 18.78 18.72 19.32 19.04 17.51 16.85 17.68 P19814 Tgoln2 4 104.6633581 192152 - 104.6633581 104.671106 trans-golgi network integral membrane protein tgn38 None ETADAKLKETLQQLLPVDPK None None 137224 17.4 16.23 17.82 16.79 16.08 17.54 15.94 17.89 16.12 16.95 17.71 17.7 17.44 17.72 17.88 17.37 16.69 16.89 16.51 17.79 16.33 17.66 17.17 17.22 16.79 17.08 18.14 16.83 17.52 17.83 17.4 A0A0G2JX46 Kcmf1 4 104.8898551 684322 - 104.8898551 104.914082 e3 ubiquitin-protein ligase kcmf1 None AHLTLEHRAPRDLDESSGVR None None None 16.33 17.39 15.83 14.82 15.71 18.05 16.03 16.45 16.65 16.03 16.98 16.47 16.76 16.79 14.96 16.38 15.97 16.27 17.89 16.57 16.35 17.08 16.23 15.82 15.88 16.32 15.54 16.07 17.75 16.38 16.14 F1LRJ0 Kcmf1 4 104.8898551 684322 - 104.8898551 104.914082 e3 ubiquitin-protein ligase kcmf1 None SERADRSLFVQELLLSTLVR None None None 16.33 17.39 16.45 14.82 15.71 18.21 16.53 16.45 16.02 15.63 16.48 16.55 16.76 16.79 14.71 16.38 16.79 16.25 17.57 16.26 16.35 17.08 16.23 15.22 16.45 16.38 15.65 16.48 17.12 16.38 16.14 P13086 Suclg1 4 105.3073091 114597 + 105.3073091 105.337654 succinate--coa ligase [adp/gdp-forming] subunit alpha None PGIINPGECKIGIMPGHIHK None 611224 55785 20.97 23.15 21.0 20.79 20.94 20.26 21.25 21.63 21.04 22.02 19.82 20.53 20.27 20.07 19.58 22.0 20.27 21.54 21.25 22.13 20.56 21.19 20.44 19.88 20.92 22.27 21.62 21.15 20.85 20.53 20.49 A0A0G2K5D2 Igkc 4 98.153171 + 98.153171 98.153827 immunoglobulin kappa constant None ASGVPDRFSGSGSETDFTLK None None None 17.08 14.43 16.13 15.94 15.35 17.21 16.62 16.04 16.21 15.09 17.72 15.53 15.62 16.67 17.02 15.16 16.65 14.93 15.06 15.74 15.45 15.41 16.38 15.16 14.99 15.84 15.28 16.98 14.87 15.13 15.8 A0A0G2JZW1 Igkv14-111 4 96.9996111 + 96.9996111 96.999909 ig-like domain-containing protein None None None None 21.23 18.82 20.36 21.23 21.0 21.85 21.62 20.91 21.34 20.04 21.99 19.75 21.18 20.08 20.5 20.04 21.3 19.47 20.2 21.34 21.05 18.93 20.61 20.53 19.6 20.51 19.2 20.22 20.97 20.03 21.6 M0R7M5 Igkc 4 98.0013171 - 98.0013171 98.00209 immunoglobulin kappa constant None KISRVEHDDLGVYYCGQASK None None None 16.34 16.09 15.74 16.49 15.35 16.23 17.19 16.25 16.21 16.43 17.28 15.34 15.87 15.98 16.81 15.38 15.92 14.56 15.13 16.26 16.08 14.45 15.84 15.07 14.65 14.79 14.58 15.73 16.1 14.31 16.03 M0RDZ5 Igkc 4 97.9650411 - 97.9650411 97.965324 immunoglobulin kappa constant None FSGVPDRFSGSGSGTDFTLK None None None 16.6 16.35 16.0 16.67 16.06 16.85 17.47 16.4 16.47 16.69 17.54 15.59 16.13 15.82 16.38 15.69 16.81 14.79 15.56 16.53 16.09 14.4 16.1 15.41 14.91 15.05 14.62 15.95 16.37 14.57 16.29 A0A0G2JXF0 Igkv16-104 4 97.8702451 - 97.8702451 97.870567 ig-like domain-containing protein None GIPSRFSGSGSGTDFTLTIR None None None 16.9 15.1 14.89 16.12 15.97 16.44 16.72 15.41 15.76 15.97 17.49 15.57 16.2 14.81 16.93 15.02 15.8 14.65 15.22 15.69 16.83 14.59 15.28 15.37 14.91 15.08 14.57 15.1 16.4 14.31 16.66 G3V9M8 Fam50a 4 152.0954841 100910130 + 152.0954841 152.102188 protein fam50a-like None TKARGKSGPLFNFDVHDDVR None None None 16.54 17.37 16.38 16.04 16.82 15.99 16.97 17.28 16.43 14.56 15.48 16.26 15.12 15.01 15.52 16.64 15.24 16.27 16.72 17.72 16.37 15.34 15.34 15.08 17.36 16.79 16.88 15.7 15.87 15.67 17.25 A0A0G2JW41 Igkv16-104 4 98.6218771 + 98.6218771 98.622525 ig-like domain-containing protein None GTPSRFSGSGSGTDFTLTIR None None None 17.06 15.26 15.05 16.27 16.13 16.6 17.02 15.57 15.92 16.13 17.65 15.73 16.36 14.97 15.04 15.17 16.59 14.97 15.82 16.74 16.99 14.75 15.44 15.35 15.07 15.23 14.26 16.2 16.19 14.47 16.82 A0A0G2JY03 Ctnna2 4 109.2951941 - 109.2951941 109.410991 uncharacterized protein None RGALKKNATMLYTASQAFLR None None None 20.25 21.72 19.46 19.75 18.75 20.75 19.37 18.86 20.69 21.24 19.94 20.54 20.3 20.72 19.1 20.17 20.1 20.75 19.8 20.26 20.72 20.96 19.89 20.95 18.35 19.92 19.76 19.28 21.0 19.45 19.59 D4A6H8 Ctnna2 4 109.2951941 297357 - 109.2951941 109.410991 catenin alpha 2 None LLAYLQRIALYCHQLNICSK None 114025 68394 20.61 20.15 20.47 19.94 18.98 19.14 19.13 19.43 20.21 21.29 20.0 19.75 20.37 20.5 18.88 19.97 20.76 20.41 19.82 20.27 19.74 21.06 20.08 20.61 19.4 20.01 19.66 19.64 20.69 19.46 19.57 D4A6D8 Lrrtm1 4 109.7018161 679668 + 109.7018161 109.717184 leucine-rich repeat transmembrane neuronal protein 1 None ANTTFRPMPNLRSVDLSYNK None 610867 41763 16.08 18.61 15.73 16.59 15.06 16.73 17.11 15.25 17.18 17.92 16.47 16.08 16.21 16.35 16.05 17.33 17.34 16.24 16.61 16.55 17.35 16.67 16.16 16.93 15.36 16.37 15.73 17.03 15.84 15.59 15.95 B4F7C5 Lrrtm4 4 112.5458381 500219 + 112.5458381 113.336793 leucine-rich repeat transmembrane neuronal protein 4 None DDSPSLELGRDHSFIATIAR None None None 17.09 16.71 16.5 16.98 16.28 16.72 17.75 17.04 17.36 17.2 15.97 16.66 16.94 17.76 17.51 16.39 16.76 16.87 17.36 15.74 17.69 16.41 17.33 16.88 16.84 17.78 15.6 16.91 17.06 15.89 16.71 D4A4A9 Mrpl19 4 114.5218251 297372 - 114.5218251 114.526053 mitochondrial ribosomal protein l19 None HEIQVVKLEKRLDDSLLYLR None 611832 6768 16.32 16.6 14.98 15.29 15.18 16.8 14.46 16.48 14.77 14.42 15.62 16.17 15.11 15.72 15.33 16.02 14.99 16.12 16.41 14.91 15.07 15.45 14.8 15.19 17.28 16.48 17.19 16.36 15.73 15.15 16.77 D4A3V0 Eva1a 4 114.5937741 500221 + 114.5937741 114.643011 eva-1 homolog a, regulator of programmed cell death None RRFERTLNKNVFTSAEELER None None 12969 16.33 14.62 15.81 17.17 17.32 15.76 16.14 15.89 15.74 16.56 15.56 17.42 16.75 15.15 16.84 15.37 15.29 14.86 17.4 16.38 15.88 15.45 16.13 16.92 16.98 15.29 14.96 15.54 17.43 16.53 17.43 P27881 Hk2 4 115.2330571 25059 - 115.2330571 115.283876 hexokinase-2 None PGKQLFEKMISGMYMGELVR None 601125 37273 20.93 23.1 21.6 21.49 21.32 19.87 21.59 21.98 21.48 21.96 19.75 20.07 20.49 20.29 20.82 21.4 21.43 20.47 20.57 22.22 20.46 20.52 20.45 21.57 21.61 21.65 21.39 21.63 19.13 20.57 20.93 B0BNB9 Htra2 4 115.5569161 297376 - 115.5569161 115.560239 htra serine peptidase 2 None VRIRRGPETLTLYVTPEVTE None 606441 113300 18.63 15.83 17.06 18.01 17.93 18.65 16.74 16.6 16.5 18.28 16.81 17.39 17.57 17.42 18.6 18.72 18.66 17.52 16.66 17.56 16.71 17.32 18.12 17.37 18.88 18.5 19.22 17.09 17.86 17.99 17.84 A1L134 Aup1 4 115.5603611 680423 + 115.5603611 115.563344 lipid droplet-regulating vldl assembly factor aup1 None RQLGEENEEFALRVQQLVAK None 602434 7239 16.84 18.48 17.95 17.1 16.67 16.58 16.24 16.38 16.7 16.43 17.49 16.04 16.24 17.59 16.73 17.1 18.2 16.94 15.81 15.78 16.75 15.85 16.01 17.75 17.36 15.44 17.0 16.99 16.08 16.77 16.37 B2RYW4 Mrpl53 4 115.6153341 103692169 + 115.6153341 115.615966 39s ribosomal protein l53 None ASHIRARNAAAAASAPSADK None None None 16.05 16.0 15.74 17.02 16.78 17.11 15.26 16.62 16.04 15.7 15.92 17.32 17.02 16.87 17.17 17.64 17.22 15.89 17.57 15.18 15.82 16.9 17.75 16.98 18.02 17.86 16.74 17.89 17.18 16.97 17.24 A0A0G2KBB1 Rtkn 4 115.6423091 103692165 + 115.6423091 115.657948 rhotekin None GACKLLAACSQREQALEATK None None None 17.89 17.16 16.73 16.76 17.38 17.22 16.04 17.12 16.32 17.12 17.98 15.34 16.56 16.72 16.17 17.32 17.38 17.77 16.68 16.43 15.7 17.15 16.88 17.21 17.51 17.7 17.34 17.61 16.26 17.04 16.19 D3ZX63 Wdr54 4 115.6549691 103692166 - 115.6549691 115.661562 similar to d3mm3e, isoform cra_a None NPESGSIEVEHCHGECISDTQVCGAR None None None 17.0 18.37 18.43 14.86 17.5 16.95 17.34 17.46 17.14 17.8 16.94 16.37 16.45 17.23 16.83 17.54 16.47 17.54 16.72 18.22 17.79 18.1 16.86 17.31 17.05 17.01 17.63 16.81 16.69 16.97 16.76 A0A0G2K8S6 Gcs1 4 115.6216241 103692171 + 115.6216241 115.625032 glucosidase 1 None LLPVIHMLEGRAPEDLAFLR None None None 18.48 16.23 18.91 17.79 16.05 16.91 17.7 18.08 17.5 17.68 18.63 16.57 18.13 17.82 18.04 17.55 17.46 18.04 17.31 17.45 17.99 18.18 17.76 17.95 17.65 17.41 16.66 18.23 17.78 17.77 17.88 Q6V7V2 Rtkn 4 115.6423091 103692165 + 115.6423091 115.657948 rhotekin None WRSEDADSGQEPLFTILINK None None None 18.23 15.66 16.62 16.75 17.46 17.7 16.61 17.2 16.41 16.45 18.89 15.92 16.89 16.7 15.94 17.27 17.43 17.47 17.08 16.63 15.85 17.14 17.53 16.26 17.42 16.86 16.82 17.9 17.13 17.68 16.58 A0A0G2K428 Dctn1 4 115.6840221 29167 + 115.6840221 115.703822 dynactin subunit 1 None SSPAAKSPSAQLMEQVAQLK None 601143 3011 22.25 21.45 21.67 21.69 19.88 21.65 21.64 21.37 20.75 21.87 20.57 20.87 21.17 20.69 21.78 21.38 22.64 20.76 21.1 20.06 21.03 22.04 21.06 20.75 21.94 21.83 22.1 21.67 20.16 21.36 21.74 D4A8U7 Dctn1 4 115.6840221 29167 + 115.6840221 115.703822 dynactin subunit 1 None QSQIQVFEDGADTTSPETPDSSASK None 601143 3011 22.22 21.23 21.73 21.76 19.82 21.65 21.62 21.31 20.8 21.82 20.59 20.86 21.28 20.74 21.8 21.34 22.61 20.82 21.08 20.02 21.09 22.12 21.16 20.73 21.91 21.84 22.11 21.72 20.17 21.41 21.71 P28023 Dctn1 4 115.6840221 29167 + 115.6840221 115.703822 dynactin subunit 1 None SAQLMEQVAQLKSLSDTIEK None 601143 3011 22.16 21.22 21.63 21.64 19.83 21.61 21.57 21.37 20.84 21.94 20.47 20.84 21.32 20.74 21.77 21.38 22.58 20.84 21.05 20.01 21.13 22.08 21.16 20.78 21.84 21.92 22.08 21.77 20.14 21.36 21.73 Q6RI88 Slc4a5 4 115.7255931 297386 + 115.7255931 115.808993 electrogenic sodium bicarbonate cotransporter 4 NBC4 None None None None 19.84 21.26 20.47 20.09 20.32 19.72 20.72 20.37 20.65 20.41 20.29 20.33 19.61 20.51 20.66 19.59 20.63 19.22 20.85 19.86 20.77 20.45 19.58 20.1 19.84 19.84 19.53 21.09 19.86 19.97 21.33 Q3T1J9 Mob1a 4 115.8315821 297387 + 115.8315821 115.848556 mob kinase activator 1a None QEFNLIDRRELAPLQELIEK None None 10076 16.53 18.14 18.66 17.48 16.68 17.7 17.7 17.51 18.07 16.7 17.17 16.42 16.4 18.74 17.11 16.43 16.44 18.88 16.93 17.11 17.31 17.13 16.9 16.64 16.74 17.24 17.61 18.15 16.49 17.37 17.38 D3ZT98 Bola3 4 115.8533511 297388 + 115.8533511 115.862797 bola family member 3 None ATAIQVTDISGGCGAMYEIK None 613183 5288 18.77 19.32 16.79 18.24 18.46 17.03 17.02 18.24 17.29 18.5 18.63 18.05 16.67 17.18 16.99 17.7 17.31 19.64 17.09 17.51 16.78 17.07 17.26 16.88 17.87 17.86 19.01 18.93 16.9 17.49 17.43 A0A0G2K478 Dguok 4 115.9871061 297389 - 115.9871061 116.014733 deoxyguanosine kinase None None None None 18.75 16.96 17.37 19.88 17.67 18.06 18.98 17.31 16.97 18.81 16.8 18.94 18.54 17.65 18.46 17.44 18.24 16.27 18.51 19.23 18.17 17.6 18.4 18.85 19.04 18.85 16.89 16.92 18.89 18.98 19.1 D3ZDE4 Dguok 4 115.9871061 297389 - 115.9871061 116.014733 deoxyguanosine kinase None DSTSRRLGNLLDMMYQEPAR None 601465 8456 18.75 16.96 17.37 19.88 17.67 18.06 18.97 17.31 16.97 18.81 16.8 18.94 18.54 17.65 18.46 17.44 18.24 16.27 18.51 19.23 18.17 17.6 18.4 18.69 19.04 18.85 16.96 16.84 18.98 18.98 19.1 Q8R424 Stambp 4 116.0560631 171565 - 116.0560631 116.08178 stam-binding protein None FHPHGRDPPLFCDCSHVTVK None 606247 4719 19.17 16.47 18.66 19.09 17.98 17.73 18.6 18.64 17.0 17.56 18.5 17.76 18.51 17.76 19.04 17.85 18.48 17.61 18.55 17.2 17.53 17.64 17.88 18.97 19.92 18.12 18.17 17.79 17.25 19.07 18.83 D3ZZS8 Atp6v1b1 4 116.223281 312488 + 116.223281 116.243927 atpase h+-transporting v1 subunit b1 None CEKHVLVILTDMSSYAEALR None None 68198 19.89 21.73 19.3 19.56 20.05 20.95 19.49 19.08 19.29 21.12 18.26 20.13 19.16 19.68 18.82 20.85 19.51 21.34 19.62 19.51 19.35 19.49 19.41 20.31 19.59 20.44 19.85 18.32 21.07 19.43 19.11 P81799 Nagk 4 116.2811371 297393 + 116.2811371 116.288763 n-acetyl-d-glucosamine kinase None FAGFCQKIAEGAQQGDPLSR None 606828 9720 17.93 15.7 17.26 18.07 15.31 16.96 18.15 17.14 15.13 17.05 16.88 16.69 17.2 17.93 16.47 16.6 17.33 15.98 17.27 18.3 16.56 17.55 17.37 17.31 18.2 18.09 15.91 16.52 17.29 18.35 16.51 D4A0U3 Zfp638 4 116.4024291 312491 + 116.4024291 116.479845 zinc finger protein 638 None TSRRSVRSDRKKALEDGGQR None None 7447 17.1 16.23 18.3 17.57 17.72 16.99 16.47 17.0 18.61 16.29 17.12 17.99 17.66 17.86 18.31 16.96 18.55 17.98 17.38 16.13 19.47 17.8 17.94 18.36 18.32 18.05 17.97 16.71 18.88 17.93 18.85 A0A0G2JYR1 Exoc6b 4 117.0947421 500233 - 117.0947421 117.550174 exocyst complex component None NILDSDNYSPIPVTSEETYK None 607880 44781 18.72 19.97 18.77 16.83 16.97 18.76 18.28 18.69 17.27 18.39 17.87 17.26 17.7 18.14 19.15 17.84 17.99 17.94 18.81 16.54 18.46 18.67 17.29 18.06 17.9 18.69 18.46 18.08 17.51 17.9 17.86 P18297 Spr 4 117.6719571 29270 - 117.6719571 117.675842 sepiapterin reductase None VRVLSYAPGPLDTNMQQLAR None 182125 26090 18.59 16.05 17.05 16.98 17.08 16.84 18.24 18.33 15.99 16.95 18.89 17.17 17.1 17.19 15.75 17.32 17.47 17.92 16.67 18.09 16.57 16.91 16.79 16.47 17.12 17.33 17.24 17.53 16.44 17.67 17.08 D3ZT59 Rgd1560795 4 117.6901651 297402 + 117.6901651 117.692891 sepiapterin reductase None GKAARDMLYQVLAVEEPSVR None None None 17.93 16.25 17.02 16.72 16.79 16.72 17.83 18.0 15.86 16.4 18.67 16.72 16.83 16.96 15.57 16.95 17.14 17.6 16.21 17.95 16.39 16.62 17.03 16.62 17.15 16.87 17.14 16.96 16.19 17.63 16.52 Q8CFD0 Sfxn5 4 117.7514831 261737 - 117.7514831 117.869887 sideroflexin-5 None QLWSAQKIKQAILHPDTNEK None None 16936 20.07 22.53 20.43 19.37 19.75 20.69 20.08 19.76 21.3 21.1 20.75 21.19 19.46 21.48 21.68 20.52 20.66 19.56 20.85 19.72 21.68 21.1 19.98 20.6 18.89 19.96 21.36 21.21 19.37 20.13 20.81 A0A0G2K1W1 Rab11fip5 4 117.8733111 312502 - 117.8733111 117.90861 rab11 family-interacting protein 5 None LQSEAGSGILAPAGMGLEEDGLQDPGPR None None None 18.66 16.62 18.21 18.47 18.06 17.4 18.94 17.34 19.33 18.66 18.5 17.98 18.44 19.18 16.63 17.16 18.78 18.01 18.98 18.05 18.87 18.52 18.73 17.05 17.75 17.99 18.01 18.01 18.85 18.77 18.48 A0A0G2K4A0 Rab11fip5 4 117.8733111 312502 - 117.8733111 117.90861 rab11 family-interacting protein 5 None RGSHGTSSLEAVPGQEELSK None None None 19.13 17.09 18.54 17.8 18.17 17.13 18.01 18.44 18.81 19.39 17.95 17.72 18.17 18.8 17.72 17.17 18.5 18.25 19.26 17.55 18.68 18.61 18.13 17.39 17.62 18.51 19.17 18.55 18.27 18.75 19.0 D3ZII8 Smyd5 4 117.9696161 312503 + 117.9696161 117.984082 set and mynd domain containing 5 None LELKPQEREQLDTFIDQLYK None None 6143 17.0 16.19 17.19 17.54 16.96 19.22 18.69 17.78 16.56 17.81 19.25 17.61 18.79 17.99 17.15 16.94 18.47 17.15 17.54 19.41 18.29 18.76 18.85 18.24 17.85 18.56 16.38 17.55 18.25 18.21 17.8 D4AC23 Cct7 4 117.9892331 297406 + 117.9892331 118.006478 t-complex protein 1 subunit eta None RTATQLAVNKIKEIAVTVKK None None 4694 21.17 22.41 22.07 20.59 21.3 20.88 22.02 21.41 21.48 22.19 19.87 19.99 21.17 20.94 20.72 20.17 20.95 20.74 20.8 22.34 21.52 21.61 20.56 20.64 21.12 20.97 20.65 20.21 21.79 21.08 21.57 A0A0G2K9A9 Fbxo41 4 118.0109841 312504 - 118.0109841 118.022375 f-box protein 41 RGD1566130 None None None None 17.42 17.62 17.47 18.6 17.2 18.41 17.25 18.13 18.67 18.63 18.73 18.66 18.91 18.82 18.15 18.47 19.23 18.06 18.71 16.89 18.8 18.0 19.53 19.34 18.06 18.25 18.13 17.78 19.1 17.68 17.67 D3ZT20 Fbxo41 4 118.0109841 312504 - 118.0109841 118.022375 f-box protein 41 None LLAVPGARREVFESTSFQGK None None None 17.42 17.62 17.47 18.6 17.2 18.41 17.25 18.13 18.67 18.63 18.73 18.66 18.91 18.82 18.23 18.47 19.22 18.07 18.67 16.88 18.8 18.0 19.53 19.34 18.06 18.25 18.13 17.78 19.1 17.68 17.67 F8WFS9 Add2 4 118.3093711 24171 + 118.3093711 118.409577 beta-adducin None KDKTESVTSGPLSPEGSPSK None 102681 1221 21.36 19.2 20.38 21.07 20.36 21.45 20.18 20.07 20.76 21.3 20.66 21.35 21.33 20.96 21.03 21.07 20.7 20.66 20.53 21.26 20.97 20.85 21.57 21.28 20.55 21.06 21.22 20.9 20.57 21.06 20.78 Q05764 Add2 4 118.3093711 24171 + 118.3093711 118.409577 beta-adducin None IENPNQFVPLYTDPQEVLDMR None 102681 1221 21.37 19.24 20.4 21.08 20.37 21.44 20.18 20.11 20.71 21.3 20.63 21.3 21.33 20.96 21.02 21.06 20.69 20.65 20.51 21.35 20.96 20.8 21.58 21.3 20.59 21.1 21.22 20.88 20.65 21.03 20.73 G3V805 Tprkb 4 118.3509791 103690067 + 118.3509791 118.356386 ekc/keops complex subunit tprkb None QVHQEHLVSQVEGQQVPLESLPEITR None None None 15.61 16.3 15.98 16.63 14.95 15.3 16.35 16.1 15.9 16.25 14.54 16.24 16.48 16.01 16.68 15.36 15.03 15.95 15.72 15.74 17.29 15.7 15.93 16.43 15.62 16.8 15.77 15.83 14.97 16.06 16.59 Q5PQR8 Tprkb 4 118.3509791 103690067 + 118.3509791 118.356386 ekc/keops complex subunit tprkb None QVHQEHLVSQVEGQQVPLESLPEITR None None None 15.44 14.35 15.94 16.08 14.57 14.93 14.99 16.16 14.8 14.01 15.25 16.0 15.64 15.12 16.38 15.19 14.19 15.08 15.36 14.93 15.27 15.57 15.72 14.96 16.14 15.52 14.25 16.2 15.64 16.35 16.09 B0BN94 Fam136a 4 118.805131 297415 + 118.805131 118.811046 protein fam136a None MHLIPTMTKKIKESLSSIGK None None 37730 17.81 19.98 19.67 18.93 18.01 19.37 19.29 18.95 19.37 20.42 18.67 18.72 20.22 19.3 19.01 19.38 18.8 19.49 18.98 20.56 20.1 20.45 19.69 19.4 17.69 19.53 18.66 19.77 19.49 18.51 18.42 Q99ML5 Pcyox1 4 118.8321161 246302 - 118.8321161 118.842951 prenylcysteine oxidase None EKIAIVGAGIGGTSSAYYLR None 610995 9458 19.77 18.04 19.02 19.23 18.11 19.25 18.14 18.23 18.05 19.84 19.39 18.19 19.0 19.18 18.73 19.55 18.55 19.5 18.2 19.68 18.93 18.75 19.01 18.49 18.38 19.32 19.44 18.05 20.18 18.52 18.08 Q5PQR7 Tia1 4 118.8527861 312510 + 118.8527861 118.880214 rcg56007, isoform cra_c None DTSNHFHVFVGDLSPEITTEDIK None 603518 20692 16.44 17.39 17.57 16.41 16.96 15.95 15.36 17.63 15.35 16.01 16.57 15.96 15.43 16.12 16.85 16.36 16.02 16.87 16.44 16.75 16.61 15.89 16.18 17.51 17.68 16.26 17.52 15.51 16.53 16.7 17.74 D3ZR17 Snrnp27 4 119.1236771 362392 - 119.1236771 119.179883 u4/u6.u5 small nuclear ribonucleoprotein 27 kda protein None ETKEVKNKERQITEEDLEGK None None None 15.36 13.59 15.63 14.91 15.29 15.4 14.96 14.77 16.09 14.86 15.77 15.87 15.9 15.58 15.94 14.84 15.77 15.22 14.85 15.79 16.99 16.59 16.42 14.65 15.46 15.17 16.47 15.11 16.74 15.81 16.02 P55260 Anxa4 4 119.1843811 79124 - 119.1843811 119.241153 annexin a4 None QEIRTAYKSTIGRDLLEDLK None 106491 68164 18.87 18.29 17.81 17.41 18.71 17.85 17.06 18.88 18.88 17.34 19.23 17.49 17.01 19.36 18.36 18.29 17.91 18.68 17.28 18.06 17.75 17.8 18.83 18.14 18.77 17.96 17.92 17.89 19.97 18.65 18.52 Q5U362 Anxa4 4 119.1843811 79124 - 119.1843811 119.241153 annexin None QDAQDLYEAGEKRWGTDEVK None 106491 68164 18.95 18.06 17.89 17.53 18.82 17.93 17.17 19.0 18.95 17.44 19.42 17.6 17.21 19.48 18.32 18.42 18.05 18.78 17.31 18.27 17.85 17.93 19.11 18.24 18.9 18.11 18.03 18.02 20.08 18.79 18.7 F1LRI7 Aak1 4 119.3012291 500244 + 119.3012291 119.440877 ap2-associated protein kinase 1 None PASKSTQLLHAAAAEASLSK None None 128746 20.89 20.02 19.64 20.58 20.15 20.7 20.55 19.97 20.61 20.75 19.79 20.97 20.54 21.22 19.14 20.21 21.08 20.21 20.73 20.29 20.98 19.78 21.05 19.69 20.4 20.56 19.97 21.04 20.88 20.6 20.29 P0C1X8 Aak1 4 119.3012291 500244 + 119.3012291 119.440877 ap2-associated protein kinase 1 None VKCALKRMFVNNEHDLQVCK None None 128746 20.88 20.24 19.64 20.59 20.21 20.63 20.58 20.0 20.58 20.73 19.78 20.91 20.48 21.23 19.07 20.2 20.98 20.21 20.8 20.31 20.97 19.73 21.02 19.7 20.54 20.59 19.82 21.07 20.95 20.57 20.28 D3ZA85 Nfu1 4 119.4590721 297416 + 119.4590721 119.479593 nfu1 iron-sulfur cluster scaffold homolog None DTPNPNSLKFIPGKPVLETR None None 6369 19.18 18.71 17.5 18.76 18.99 17.76 18.55 19.25 19.0 19.31 17.51 18.91 18.26 17.69 17.9 18.78 17.8 18.09 18.29 20.19 17.58 18.02 17.88 17.86 17.27 18.47 17.91 18.13 19.2 17.51 18.94 P82808 Gfpt1 4 119.4967011 297417 + 119.4967011 119.54648 glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 None SSFMQKEIFEQPESVVNTMR None None 68220 16.36 15.46 18.44 16.64 15.2 16.15 17.84 17.9 16.81 17.0 18.08 15.71 17.68 17.17 17.73 16.59 16.81 17.29 17.85 15.95 18.31 17.6 16.81 16.75 16.94 17.44 17.75 17.31 15.54 17.76 17.47 D3ZGL1 Arhgap25 4 119.8968451 500246 - 119.8968451 119.974982 rho gtpase-activating protein 25 None VERSREDVEKRNRVLEEEVK None 610587 45507 17.65 17.65 16.07 16.3 16.32 17.16 16.49 16.06 17.43 18.19 17.26 16.65 16.44 17.66 16.28 17.32 17.15 17.78 17.12 15.85 17.35 17.64 17.68 17.13 16.55 16.33 16.81 17.61 16.55 16.42 15.61 Q53B90 Rab43 4 120.249881 500249 - 120.249881 120.269174 ras-related protein rab-43 None EVPLAEAQSLAEHYDILCAIETSAK None None 6283 20.7 22.82 20.46 20.26 20.46 20.6 20.25 21.13 21.16 22.15 19.71 20.91 20.24 19.78 21.33 21.87 20.15 20.67 21.49 19.83 20.19 20.84 20.01 21.38 19.21 21.27 19.54 21.44 21.33 19.84 20.64 Q6AYB3 Isy1 4 120.2765371 362394 - 120.2765371 120.297227 pre-mrna-splicing factor isy1 homolog None IQNAGLGEFRIRDLNDEINK None 612764 6283 15.76 13.57 15.01 15.86 15.82 16.25 15.68 14.47 16.34 16.62 16.25 15.19 16.29 17.08 16.7 15.28 15.15 15.46 15.9 16.37 16.6 15.75 16.15 15.34 15.07 16.6 16.17 14.76 17.4 16.49 16.43 P62634 Cnbp 4 120.302791 64530 - 120.302791 120.311645 cellular nucleic acid-binding protein None TKVKCYRCGETGHVAINCSK None None 2567 17.4 17.46 18.28 18.67 18.3 18.31 18.53 18.6 19.3 19.15 18.0 19.3 19.35 18.84 17.48 18.13 18.67 19.32 18.47 19.21 20.2 17.89 19.36 17.4 17.25 18.32 18.62 19.53 19.27 18.66 18.9 Q4AEF8 Hmces 4 120.3666391 297428 + 120.3666391 120.415615 coatomer subunit gamma-1 None SAKELAPAVSVLQLFCSSPK None None 56745 18.86 16.8 17.85 18.58 17.52 17.81 19.24 18.74 16.78 18.82 19.53 19.16 19.49 18.42 18.81 17.44 17.89 18.78 18.9 16.74 19.45 17.97 18.47 17.92 17.9 17.53 18.3 18.26 17.63 18.74 18.09 D3ZIX4 H1f10 4 120.4408711 500252 - 120.4408711 120.441448 h1.10 linker histone None TYLKYSIRALVQNDTLLQVK None None 4397 15.44 17.62 16.76 16.35 15.98 15.27 15.13 16.5 17.52 17.19 15.39 15.65 15.46 15.14 17.14 16.22 16.59 16.09 16.62 14.53 17.47 16.7 15.73 16.78 16.14 15.37 17.36 16.42 15.55 15.61 17.28 P09527 Rab7a 4 120.4619791 29448 - 120.4619791 120.506874 ras-related protein rab-7a None VNKKFSNQYKATIGADFLTK None None 3408 21.61 20.0 22.57 20.46 19.65 20.32 21.55 20.96 21.57 20.37 22.32 19.89 21.55 21.98 19.91 21.06 21.08 21.53 20.47 22.61 21.78 22.32 21.61 21.13 20.72 20.52 21.31 20.34 21.02 21.41 21.23 P07153 Rpn1 4 120.5437041 25596 + 120.5437041 120.565061 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 None SEIAVLQSRLKTEGSDLCDR None 180470 2101 20.62 21.99 20.59 21.05 19.0 19.19 19.9 21.16 19.34 20.24 22.04 20.09 19.67 21.33 21.92 20.53 20.43 20.2 20.6 19.21 20.4 20.54 19.39 21.28 21.71 20.35 21.17 20.8 19.54 20.9 20.48 Q6P7A7 Rpn1 4 120.5437041 25596 + 120.5437041 120.565061 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 None THYIVGYNLPSYEYLYNLGDQYALK None 180470 2101 20.56 22.16 20.59 21.05 19.0 19.19 19.85 21.16 19.34 20.24 22.04 20.09 19.7 21.33 21.92 20.53 20.44 20.21 20.58 19.17 20.4 20.54 19.46 21.31 21.71 20.35 21.16 20.73 19.62 20.77 20.36 B5DEJ5 Eefsec 4 120.7196171 500255 - 120.7196171 120.915779 eefsec protein None FGQSGKFKIHIPGGLSPESK None None 11073 18.97 18.34 19.21 17.35 18.84 18.29 18.63 19.09 18.27 18.31 18.46 18.0 18.62 17.26 18.14 17.97 18.06 18.92 18.53 17.36 17.92 18.83 17.47 16.48 16.98 17.18 19.2 18.73 17.98 18.22 17.01 P60123 Ruvbl1 4 120.9322871 65137 + 120.9322871 120.967397 ruvb-like 1 None TENPMGGYGKTISHVIIGLK None 603449 37839 18.98 19.74 19.26 19.01 18.2 18.75 18.43 18.81 17.76 18.78 18.24 18.3 18.06 18.71 19.23 18.41 18.54 18.34 18.65 19.86 19.82 19.19 18.36 19.31 20.5 18.82 18.64 17.55 20.23 18.85 19.69 M0R763 Rps25 4 120.9337721 - 120.9337721 120.934236 40s ribosomal protein s25 None DKKKKDAGKSAKKDKDPVNK None None None 17.02 19.04 17.41 19.03 18.48 17.03 16.76 18.98 18.33 18.43 18.15 17.17 18.0 16.99 18.56 19.18 18.88 17.88 17.32 18.28 16.91 17.4 17.31 19.2 17.89 19.72 18.59 17.08 18.83 17.54 18.27 P61621 Sec61a1 4 120.9735241 80843 - 120.9735241 120.987871 protein transport protein sec61 subunit alpha isoform 1 None LGSCAFFSKTWIEVSGSSAK None None 55537 18.36 18.39 17.58 17.74 17.88 16.2 17.65 19.36 17.38 17.68 17.8 17.85 17.34 17.06 19.06 17.99 17.64 17.23 18.37 16.5 17.11 16.99 16.74 18.19 17.35 18.79 18.01 17.7 17.31 17.1 18.19 Q8R431 Mgll 4 121.1922211 29254 + 121.1922211 121.291817 monoglyceride lipase None NKSEVDLYNSDPLICHAGVK None 609699 38298 18.58 18.12 18.5 18.4 19.18 18.81 18.12 18.43 19.92 19.45 18.71 20.2 19.43 19.66 18.22 17.94 19.09 18.99 19.84 19.22 20.34 19.42 19.87 19.48 18.03 18.83 18.26 19.17 20.21 18.77 19.48 B1WC18 Podxl2 4 121.3062261 297433 - 121.3062261 121.338112 podocalyxin-like 2 None LTPWDSTQVICKDWSNLAGK None None 9254 15.2 16.77 16.09 16.1 15.11 13.98 15.21 15.48 14.66 16.04 14.76 14.45 15.09 14.4 15.11 15.19 15.33 14.37 15.23 16.37 14.58 15.8 14.28 15.52 15.2 15.65 15.29 15.04 14.66 14.93 15.73 D3Z981 Plxna1 4 121.7379061 362398 - 121.7379061 121.778161 plexin a1 None LDQREGDRGSKMVSEIYLTR None None None 18.82 20.62 18.58 19.14 17.66 19.92 17.62 18.1 19.1 19.84 17.77 18.99 18.18 19.09 18.0 19.47 19.18 19.54 18.05 19.16 18.5 19.65 18.77 18.86 18.3 19.22 18.24 19.82 19.78 18.12 18.03 D4A7N1 Chchd6 4 121.7927171 297436 - 121.7927171 122.024216 micos complex subunit mic25 None GSSESAEARRVSFEMDEEER None None 11920 17.86 20.26 18.37 18.69 19.45 19.13 18.29 18.22 19.34 19.63 18.59 19.48 18.52 18.88 19.02 19.2 19.46 18.19 18.91 17.75 19.19 19.03 18.99 18.49 17.25 18.42 18.2 18.35 20.78 18.03 18.12 A0A0G2K0G3 Txnrd3 4 122.0366141 297437 + 122.0366141 122.112521 thioredoxin-disulfide reductase None PAEVREEVRRRLRDLIEGNR None None None 17.36 17.86 17.53 16.54 16.04 16.63 17.1 16.51 15.67 17.1 16.89 14.87 15.51 16.48 16.06 16.66 16.0 16.42 16.55 17.37 15.73 16.71 15.8 15.79 16.49 17.03 17.42 15.86 15.73 16.02 16.21 P11654 Nup210 4 123.511561 58958 - 123.511561 123.609874 nuclear pore membrane glycoprotein 210 None PNSFIKLQTNRDGAAILSYR None 607703 41286 16.08 17.28 16.68 16.52 16.7 15.61 16.3 15.84 17.0 16.57 16.01 16.66 16.52 17.4 16.62 15.93 17.81 16.95 16.49 16.26 18.54 16.81 16.31 17.14 18.23 16.81 16.61 15.9 18.25 16.71 18.27 B2GUW3 Hdac11 4 123.6501581 297453 + 123.6501581 123.667405 hdac11 protein None GMLVEAREASEEDLLVVHTR None None 11743 18.25 16.9 16.67 18.1 17.7 17.59 16.9 17.66 15.43 16.75 17.77 16.7 16.43 17.27 16.89 16.77 17.92 16.55 16.79 17.62 15.52 16.68 16.73 17.0 18.54 17.52 16.85 16.67 17.78 17.83 16.31 G3V6X1 Fbln2 4 123.7044891 282583 + 123.7044891 123.763851 fibulin 2 None PEAQATSRSVTQEGAAPLPK None 135821 1514 14.84 16.46 14.76 14.58 15.7 15.68 13.56 14.6 16.19 14.11 14.7 15.3 14.15 16.23 14.38 15.02 15.4 15.96 14.59 14.52 15.31 15.91 15.27 14.78 15.24 15.24 16.05 15.91 15.62 14.43 14.7 Q5XIP9 Tmem43 4 123.9776811 362401 + 123.9776811 123.992822 transmembrane protein 43 None DNFKPLSLAKLEDPHVDIIR None 612048 11532 17.97 16.13 18.69 16.85 17.2 16.64 17.04 18.18 17.5 17.08 17.87 16.02 17.2 17.12 17.74 17.47 16.43 18.45 16.85 16.73 18.14 16.78 17.24 16.74 17.13 16.88 16.72 17.33 18.33 17.68 17.54 D4A7U6 Lsm3 4 124.0210241 297455 + 124.0210241 124.027269 u6 snrna-associated sm-like protein lsm3 None NIPMLFVRGDGVVLVAPPLR None 607283 6548 18.3 19.57 18.86 18.45 18.27 18.23 18.29 18.03 18.68 17.5 17.36 18.84 17.84 18.19 18.02 17.3 17.78 18.91 18.09 19.37 19.72 18.12 17.65 18.79 18.5 17.6 17.77 17.34 19.22 17.92 18.4 A0A0G2JUG7 Iqsec1 4 123.1698971 686590 + 123.1698971 123.315603 iq motif and sec7 domain-containing protein 1 None LDEALRKFQAHIRVQGEAQK None None None 19.91 18.85 19.26 18.01 19.43 20.04 18.86 19.24 19.93 18.97 19.42 19.83 19.43 20.53 19.63 19.78 20.2 19.4 19.3 18.5 20.18 18.84 20.01 20.37 19.06 19.58 19.32 19.56 19.32 19.58 19.38 A0A0G2K1G1 Slc41a3 4 123.1127991 641603 - 123.1127991 123.154768 solute carrier family 41 member 3 None PVFRDVKDLLTLVPPLVGLK None 610803 23052 15.62 14.92 15.84 15.1 16.18 15.19 15.21 15.61 16.61 14.92 14.97 15.39 15.59 16.16 15.78 15.26 14.77 17.32 15.31 15.03 16.78 15.57 15.29 14.72 16.18 15.85 16.06 17.14 15.45 15.67 17.15 Q3SWT5 Slc41a3 4 123.1127991 641603 - 123.1127991 123.154768 solute carrier family 41 member 3 None EMTLASRLSTSANTGQIDDR None 610803 23052 14.5 13.19 14.97 14.13 15.19 14.18 14.28 14.73 15.25 13.7 14.37 14.63 14.94 15.04 14.8 14.32 13.36 16.2 14.52 14.27 15.6 14.47 14.94 13.6 15.06 14.55 14.98 15.73 15.02 14.91 15.88 P28037 Aldh1l1 4 123.0644931 64392 - 123.0644931 123.106235 cytosolic 10-formyltetrahydrofolate dehydrogenase None EGIKGMVQAVRLIAEGTAPR None 600249 122031 20.64 20.56 20.53 21.59 20.69 18.88 21.3 20.58 19.53 20.3 20.35 20.6 20.11 21.11 19.89 19.8 20.13 19.17 21.64 21.47 19.66 19.61 20.12 21.6 21.2 21.01 19.63 20.01 19.65 21.25 21.56 Q9WTW1 Grip2 4 124.2714561 171571 + 124.2714561 124.321267 glutamate receptor-interacting protein 2 None VHTVRIDGPAQHGGLQPFDR None None 16327 15.61 17.63 16.12 16.28 15.29 16.42 15.57 14.71 16.14 15.25 16.27 15.28 15.2 15.52 14.32 15.43 16.4 15.19 16.38 16.61 16.94 16.27 15.27 14.48 16.34 15.81 16.23 16.51 16.1 15.16 15.31 P31643 Slc6a6 4 124.1952021 29464 - 124.1952021 124.265298 sodium- and chloride-dependent taurine transporter None MLLVLLVRGLTLPGAGEGIK None 186854 2291 17.72 15.22 16.61 18.02 17.3 17.83 17.51 16.9 17.91 17.71 17.23 17.8 17.37 16.61 17.67 17.41 17.26 16.8 16.93 18.24 17.25 17.57 17.43 17.68 16.76 16.28 17.09 16.65 17.25 17.78 18.26 P55094 Nr2c2 4 124.6369461 50659 + 124.6369461 124.662015 nuclear receptor subfamily 2 group c member 2 None NIQQPLIREDGTVLLATDSK None 601426 2475 14.3 14.45 15.95 14.36 15.52 15.28 15.72 15.21 16.19 13.84 14.37 15.77 15.41 15.59 16.87 14.76 14.99 15.0 15.63 14.17 16.24 15.89 15.72 15.5 15.51 15.42 15.74 14.71 14.76 14.98 16.14 Q4QR80 Mrps25 4 124.6683221 297459 - 124.6683221 124.680086 28s ribosomal protein s25 None GRFPIRRTLQYLGSGDVVFK None 611987 11207 18.11 15.68 15.99 17.68 16.82 17.57 16.75 16.91 17.19 16.25 17.18 17.1 17.89 18.11 17.84 15.73 15.78 17.76 17.33 17.28 17.41 17.02 17.0 16.63 18.23 18.3 18.1 16.14 18.64 18.19 17.4 D3ZL11 Rbsn 4 124.683971 312562 - 124.683971 124.712578 rabenosyn, rab effector None ANDLRVEVQKVYELIDALSK None None 41477 18.26 15.26 16.57 18.35 16.47 15.88 17.95 17.38 16.93 17.23 17.49 17.38 17.73 18.71 17.33 18.05 17.44 17.33 18.64 17.58 17.95 17.86 17.88 17.48 18.74 19.24 18.24 17.87 16.42 18.35 17.89 F1M0J7 Prickle2 4 124.8695531 312563 - 124.8695531 124.969184 prickle planar cell polarity protein 2 None RPLSSLKYTEDMTPTEQTPR None None 17889 17.3 17.36 16.61 16.64 16.15 17.71 16.43 16.89 17.28 17.03 17.47 17.19 17.34 17.27 16.54 18.49 18.11 17.68 16.98 15.76 17.3 16.92 17.72 17.96 16.38 17.8 16.79 16.8 17.53 16.04 16.24 A0A0G2JZE4 Magi1 4 126.208161 500261 - 126.208161 126.469184 membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 None RGFGFTVVGGDEPDEFLQIK None 602625 31257 18.88 16.7 18.93 19.19 16.85 17.52 18.42 17.29 18.08 18.21 18.03 17.19 18.34 18.04 17.5 17.71 17.61 18.37 17.64 19.3 18.64 18.89 18.13 17.17 18.47 18.25 18.62 18.82 17.41 17.88 18.26 F1M7H7 Magi1 4 126.208161 500261 - 126.208161 126.469184 membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 BAP-1; Baiap1; MAGI-1 None None None None 18.85 16.74 18.77 19.19 16.83 17.52 18.04 17.3 18.07 18.25 18.17 17.16 18.45 18.05 17.09 17.72 17.87 18.41 17.34 19.21 18.62 18.88 18.11 17.45 18.37 18.37 18.63 18.78 17.44 17.97 18.24 Q4L1J4 Magi1 4 126.208161 500261 - 126.208161 126.469184 membrane-associated guanylate kinase, ww and pdz domain-containing protein 1 None DEFLQIKSLVLDGPAALDGK None 602625 31257 18.73 16.59 18.85 19.06 16.78 17.6 18.13 17.3 18.2 18.29 17.93 17.23 18.4 18.13 17.26 17.65 17.9 18.1 17.59 19.22 18.72 18.92 18.31 17.27 18.36 18.23 18.54 18.8 17.47 17.85 18.28 F1LPV8 Suclg2 4 128.0670331 362404 - 128.0670331 128.337146 succinate--coa ligase [gdp-forming] subunit beta None SHNGPVLVGSPQGGVDIEEVAASSPELIFK None None 2854 19.45 18.44 20.67 20.55 18.84 18.4 20.32 20.11 18.58 19.2 19.36 18.88 19.21 18.69 20.0 19.49 18.8 19.6 19.58 18.93 19.13 18.93 18.84 19.25 19.72 19.42 19.94 19.37 17.79 20.06 20.51 Q5NDL0 Eogt 4 129.7189261 494219 - 129.7189261 129.756558 egf domain-specific o-linked n-acetylglucosamine transferase None FEVRVVDYKYRELGFLDQLR None None None 16.23 17.54 16.25 15.51 16.48 15.69 15.87 16.39 15.49 17.85 14.82 15.47 15.84 15.65 15.12 16.89 15.67 16.35 16.51 16.11 14.91 16.48 15.41 16.15 16.35 16.52 16.68 15.31 16.6 15.19 16.53 A0A0G2JZ48 Tmf1 4 129.7631151 114206 - 129.7631151 129.785629 rcg56136, isoform cra_a None QAAARKEDYLRHEISELQQR None 601126 133801 17.73 15.37 16.35 17.57 17.14 16.58 15.99 16.42 16.39 16.76 17.54 16.82 16.81 16.75 16.35 17.58 17.53 17.26 16.03 17.76 16.27 17.12 17.78 17.6 18.59 17.16 17.86 15.98 17.86 17.67 16.77 Q99MI7 Uba3 4 129.7895411 117553 - 129.7895411 129.810584 nedd8-activating enzyme e1 catalytic subunit None GFRQIHVIDMDTIDVSNLNR None None 2951 18.99 20.61 19.48 18.07 20.72 18.63 19.97 19.02 19.33 18.61 19.58 19.18 18.68 19.59 17.93 18.63 18.64 19.51 19.53 20.83 19.22 19.74 18.73 17.7 20.55 18.86 18.88 19.7 20.08 19.17 19.35 Q9ES40 Arl6ip5 4 129.8153771 66028 + 129.8153771 129.838513 pra1 family protein 3 None KTPMGIILDALEQQEDSINK None 605709 4673 18.99 21.19 19.62 17.45 18.74 19.11 17.94 19.08 19.66 20.22 18.85 18.82 18.42 19.3 20.17 19.09 19.05 19.74 18.26 18.09 20.04 19.3 18.23 19.44 17.48 18.5 19.47 19.22 19.46 18.17 19.14 F1LZB7 Frmd4b 4 129.8961061 252858 - 129.8961061 130.083624 ferm domain-containing 4b None LQEHPSLAYCEDRVIEHYLK None None 14916 17.41 15.95 16.11 15.13 15.82 17.24 15.48 15.17 17.47 16.05 15.84 14.97 15.47 15.17 15.17 17.41 15.26 16.25 16.8 16.16 15.51 16.97 15.71 15.03 15.27 15.42 15.94 15.96 17.25 15.69 15.49 A0A0G2K5U8 Mitf 4 130.4090891 25094 + 130.4090891 130.621181 microphthalmia-associated transcription factor None None None None 15.27 16.52 16.56 15.99 16.63 16.19 15.26 15.92 15.41 15.76 17.12 14.83 16.41 15.28 15.96 15.97 15.83 15.34 15.74 15.23 15.58 15.12 15.3 15.02 16.28 15.23 15.9 15.02 17.49 16.21 14.82 O88368 Mitf 4 130.4090891 25094 + 130.4090891 130.621181 microphthalmia-associated transcription factor None EARALAKERQKKDNHNLIER None 156845 4892 15.27 16.52 16.56 15.99 16.63 16.19 15.26 15.92 15.41 15.76 17.12 14.83 16.41 15.28 15.96 15.97 15.83 15.34 15.74 15.23 15.58 15.12 15.3 15.02 16.28 15.23 15.9 15.02 17.49 16.21 14.82 D4A8H5 Ppp4r2 4 133.4546681 297486 + 133.4546681 133.495486 protein phosphatase 4, regulatory subunit 2 None VESEEREVKRLKFDDEGDVR None None 17953 16.55 14.49 16.58 16.3 16.37 16.3 16.81 16.18 18.06 14.95 16.87 16.69 16.99 16.83 16.12 15.7 16.05 16.94 17.45 16.02 18.04 17.09 17.05 15.81 16.93 16.24 16.65 15.58 17.83 17.04 17.31 Q62682 Cntn3 4 134.8422671 54279 - 134.8422671 135.125613 contactin-3 None GPVFVKEPSNSIFPVGSEDK None 601325 7461 16.47 16.65 16.59 17.14 16.12 16.39 15.36 15.63 16.43 16.05 17.37 16.18 16.45 17.34 15.23 15.65 16.52 16.81 17.14 16.42 16.59 17.47 16.74 16.29 16.2 16.93 15.58 17.4 17.63 15.57 15.63 P97528 Cntn6 4 137.2590921 27256 + 137.2590921 137.694247 contactin-6 None VNVTTKKSPPSQPPANIAWK None 607220 8702 15.43 16.21 16.55 15.75 14.55 15.92 17.26 15.46 15.43 16.4 15.1 15.26 16.63 16.47 14.42 15.8 15.8 16.77 16.86 16.49 16.1 17.23 15.58 15.34 16.94 17.2 14.92 16.02 16.26 15.53 15.63 Q62845 Cntn4 4 139.0991181 116658 + 139.0991181 139.621671 contactin-4 None VCMVQTSVDKLSAAADLIVR None 607280 14257 17.9 16.12 17.54 19.01 17.55 17.29 16.52 16.95 18.29 18.81 17.74 17.32 17.99 17.79 17.17 17.18 16.83 18.28 17.92 17.97 18.21 18.05 18.57 17.2 17.64 17.42 17.9 18.43 18.18 17.66 17.77 Q4VBH2 Trnt1 4 139.6900321 312616 + 139.6900321 139.70361 trna nucleotidyl transferase 1 None LFTMKLQSPEFQSLFTEGLK None 610230 9333 18.38 17.98 18.39 17.7 18.72 17.65 18.31 17.59 18.61 18.39 16.98 17.75 18.24 18.77 19.03 17.14 17.14 19.33 18.39 18.47 19.48 18.6 17.48 17.54 18.89 18.52 19.01 18.63 18.13 17.98 19.91 Q56AP7 Crbn 4 139.7011551 297498 - 139.7011551 139.719949 protein cereblon None NLIQKDRTFAVLAYSNVQER None 609262 9461 17.77 15.71 18.18 17.23 16.88 16.88 17.65 16.98 17.39 17.63 19.15 16.97 18.25 18.33 18.89 16.81 17.23 17.79 17.32 17.13 17.96 18.7 18.31 17.73 17.97 17.29 18.69 17.52 16.63 18.28 17.67 Q32Q07 Lrrn1 4 140.5132181 500280 + 140.5132181 140.516268 leucine-rich repeat neuronal protein 1 None IEDSGRYTCVAQNVQGADTR None None 32036 16.62 16.64 14.66 15.26 17.07 16.41 16.26 16.4 15.54 14.86 17.35 15.62 15.14 15.38 14.45 16.06 16.95 15.34 16.18 15.9 14.94 15.37 15.48 15.57 16.77 16.31 15.91 16.21 15.46 15.2 15.7 F1LNT1 Itpr1 4 141.1873971 25262 + 141.1873971 141.510491 inositol 1,4,5-trisphosphate receptor type 1 None FPFSDKEKNKLTFEVVNLAR None 147265 1673 20.65 20.12 20.51 20.4 21.39 20.65 20.69 20.73 21.6 20.43 20.18 21.8 21.49 21.47 22.29 20.56 20.07 20.76 21.63 20.18 21.94 20.79 20.81 20.07 20.86 20.93 21.53 21.83 20.94 21.14 22.18 F1LQX8 Itpr1 4 141.1873971 25262 + 141.1873971 141.510491 inositol 1,4,5-trisphosphate receptor type 1 None ELQTMLKPGGQVDGDEALEFYAK None 147265 1673 20.65 20.12 20.52 20.4 21.39 20.65 20.69 20.73 21.6 20.42 20.18 21.8 21.49 21.47 22.29 20.56 20.07 20.76 21.63 20.18 21.94 20.78 20.81 20.07 20.87 20.94 21.54 21.82 20.95 21.14 22.18 P29994 Itpr1 4 141.1873971 25262 + 141.1873971 141.510491 inositol 1,4,5-trisphosphate receptor type 1 None ILNDINPLGKKRMDLVLELK None 147265 1673 20.65 20.12 20.51 20.4 21.39 20.65 20.7 20.73 21.6 20.43 20.18 21.8 21.49 21.47 22.28 20.56 20.08 20.76 21.64 20.17 21.94 20.79 20.81 20.07 20.86 20.93 21.53 21.84 20.94 21.14 22.18 Q66HA6 Arl8b 4 141.7486571 500282 + 141.7486571 141.792604 adp-ribosylation factor-like protein 8b None WERYCRGVNAIVYMIDAADR None None 10056 21.5 18.88 20.51 21.04 20.19 20.14 20.32 19.58 19.43 20.03 20.84 19.93 20.15 21.21 20.91 18.85 20.66 19.92 20.4 18.74 20.22 20.23 20.61 20.17 21.43 19.38 19.09 20.19 21.08 20.47 20.12 P35400 Grm7 4 144.0317641 81672 + 144.0317641 144.612344 metabotropic glutamate receptor 7 None LASEGSYGEKGVESFTQISK None 604101 20229 17.95 17.65 17.94 17.65 16.55 18.16 16.83 16.41 17.29 17.17 18.1 16.19 16.55 17.32 17.42 18.2 17.85 17.14 18.01 15.67 16.85 17.76 17.58 18.53 17.26 17.77 16.49 18.37 16.33 17.02 16.24 Q6AYF2 Lmcd1 4 145.3931541 494021 + 145.3931541 145.452046 lim and cysteine-rich domains 1 None CDEIIFSEDYQRVEDLAWHR None 604859 22823 16.86 15.59 17.63 16.72 17.47 17.16 18.09 17.75 17.02 15.57 16.44 17.38 17.15 16.83 18.06 16.68 15.59 16.9 18.19 17.08 18.32 16.24 17.59 16.12 17.94 17.62 17.7 16.98 16.77 18.04 17.49 F1M5M9 Srgap3 4 145.8389231 500287 - 145.8389231 146.070518 slit-robo rho gtpase-activating protein 3 None RESRDHATLNDIFMNNVIVR None None None 19.57 16.73 19.53 17.82 18.52 20.39 19.03 18.65 18.83 17.77 18.84 19.28 19.49 19.11 19.16 19.04 19.52 18.93 19.73 17.61 19.55 18.85 19.37 19.22 18.97 19.19 18.94 18.76 18.92 19.19 19.26 D3ZSV7 Thumpd3 4 146.1855191 500288 + 146.1855191 146.208469 similar to thump domain containing 3, isoform cra_a None LASGAADPHILDYYENPAIK None None 7351 16.69 13.96 16.92 16.19 15.57 15.95 17.61 16.02 15.76 15.82 16.68 15.36 16.25 16.39 16.53 15.35 16.53 15.78 16.45 14.97 17.03 15.92 16.28 15.76 16.68 16.17 16.12 16.02 15.16 17.04 16.48 Q7TSY2 Lhfpl4 4 146.3171111 353230 - 146.3171111 146.340073 lhfpl tetraspan subfamily member 4 protein None SFLAFVLGNRQTDLLQEELK None None 14943 16.06 13.59 15.21 15.73 15.51 15.63 15.59 14.22 16.3 14.88 16.14 16.32 16.26 15.9 16.66 15.75 15.06 16.18 16.23 15.06 16.03 17.12 16.51 16.26 15.66 15.99 15.25 15.17 16.74 15.95 16.28 Q5BJS7 Cpne9 4 146.4308411 297516 + 146.4308411 146.454333 copine-9 None ALCNGDYDRTVKIDVYDWDR None None 23266 19.37 18.35 19.05 18.88 20.28 18.05 19.87 19.02 19.96 19.52 17.79 20.22 19.26 19.67 20.63 18.33 18.41 18.91 19.07 19.34 20.35 18.78 19.29 18.22 19.27 18.82 18.7 19.38 19.65 19.44 20.07 D4A411 Brpf1 4 146.4563541 679713 + 146.4563541 146.47275 bromodomain and phd finger-containing, 1 None SWQRLRHDLERARLLVELIR None 602410 31251 15.99 13.78 14.47 16.16 15.92 13.7 14.78 16.22 15.15 15.61 14.24 15.24 15.66 14.84 16.06 15.7 15.15 15.11 14.61 14.71 14.37 14.8 15.3 15.09 15.79 16.82 16.39 16.1 14.6 15.19 16.29 Q63450 Camk1 4 146.4808931 171503 - 146.4808931 146.492073 calcium/calmodulin-dependent protein kinase type 1 None GFYTERDASRLIFQVLDAVK None 604998 117458 19.13 17.73 19.78 19.4 17.54 18.77 19.69 18.62 17.76 19.0 18.59 17.64 19.27 18.4 18.07 17.96 19.03 19.03 18.62 18.82 19.59 19.96 19.4 18.65 19.6 19.52 19.64 17.35 18.24 18.78 19.15 Q4V8F5 Tada3 4 146.5102321 362414 - 146.5102321 146.521676 transcriptional adapter 3 None NVQPKIQEYEFTDDPIDVPR None 602945 4633 15.03 17.31 17.05 16.72 16.48 15.08 15.48 17.18 15.76 15.16 16.26 15.39 15.48 15.24 16.82 16.18 16.05 14.5 15.65 16.75 15.0 15.29 15.41 16.72 16.91 15.5 15.21 16.67 15.44 15.5 16.05 B2RZ72 Arpc4 4 146.5222561 297518 + 146.5222561 146.532783 actin-related protein 2/3 complex subunit 4 None SEMKLSVNARARIVAEEFLK None None 4177 20.14 21.37 20.48 19.76 19.76 21.42 19.55 20.8 20.43 19.86 19.88 20.64 20.78 20.81 19.44 20.59 20.28 21.52 20.57 20.73 20.68 20.76 19.86 21.26 19.81 21.6 21.03 19.75 21.31 19.72 22.53 Q4KM64 Jagn1 4 146.5915921 502872 + 146.5915921 146.596299 protein jagunal homolog 1 None WQLYYSKKLLDSWFTSTQEK None None 41675 15.52 16.76 16.24 17.24 17.34 15.47 15.93 17.52 16.86 17.83 15.73 16.21 17.2 15.76 17.47 17.71 16.8 16.04 17.4 15.53 15.19 16.82 16.71 15.99 16.56 17.8 16.44 17.04 18.23 16.33 17.14 Q4V7F2 Creld1 4 146.6317141 312638 + 146.6317141 146.641491 protein disulfide isomerase creld1 None YECRDCAKACLGCMGAGPGR None 607170 32265 17.6 17.65 18.15 19.07 18.71 18.24 18.32 18.45 19.38 19.46 18.45 19.45 19.71 19.14 19.59 19.25 19.36 18.5 18.35 18.2 19.01 18.39 19.56 18.89 17.26 18.49 17.96 18.24 20.49 18.62 18.53 D3ZWQ0 Prrt3 4 146.6424611 502873 - 146.6424611 146.646433 proline-rich transmembrane protein 3 None TSLPQHVVNPPVGAAAAGTSGSSLDSFSK None None 52099 19.16 17.87 17.49 18.4 17.55 18.58 17.35 18.03 18.5 19.44 18.44 18.64 18.36 18.9 17.68 18.21 18.64 18.62 19.4 17.41 18.53 19.09 19.24 18.99 17.82 18.44 18.39 18.61 18.87 18.06 17.29 Q5U2V8 Emc3 4 146.6630541 312640 - 146.6630541 146.679027 er membrane protein complex subunit 3 None RKVVPPSPMTDPTMLTDMMK None None None 17.27 15.07 16.69 16.87 16.86 15.62 17.54 15.81 17.62 17.19 17.34 16.72 17.59 18.04 17.88 16.39 17.55 16.39 17.29 16.22 16.98 17.24 17.42 16.03 16.99 16.34 16.56 17.3 17.47 17.43 17.5 D3ZUP5 Brk1 4 146.7508221 679934 + 146.7508221 146.76605 brick1 subunit of scar/wave actin nucleating complex None ATLNEKLTALERRIEYIEAR None None None 20.16 18.18 19.22 18.75 18.62 19.11 18.64 19.05 19.71 20.87 18.87 19.4 20.19 20.32 18.63 19.8 19.75 19.86 19.97 19.44 20.35 19.94 19.98 20.21 18.84 20.43 19.17 19.37 21.0 19.63 19.95 Q64259 Vhl 4 146.7724141 24874 + 146.7724141 146.779386 von hippel-lindau disease tumor suppressor None RRLDIVRSLYEDLEDHPNVR None 608537 465 15.66 16.29 16.31 14.78 15.42 14.14 14.22 15.41 14.17 14.9 14.72 14.36 14.08 13.9 14.91 14.87 13.3 14.43 15.41 15.15 14.73 14.36 13.95 14.67 15.06 13.52 15.59 14.49 13.43 14.14 13.89 Q5XFW8 Sec13 4 146.8777471 297522 - 146.8777471 146.89113 protein sec13 homolog None VTLWKESVDGQWVCISDVNK None None 6479 18.88 16.05 17.48 17.84 17.33 18.02 17.58 18.04 17.74 17.44 18.66 17.9 18.74 18.79 19.13 17.29 19.4 17.94 17.97 17.04 19.94 18.99 18.75 18.4 19.7 19.42 18.42 18.18 18.97 18.75 18.84 D4A8B3 Atp2b2 4 146.89461 24215 - 146.89461 147.207984 calcium-transporting atpase None NASLVNGKMQDGSADSSQSK None 108732 56150 22.28 21.82 21.81 22.23 23.03 22.33 21.68 22.2 23.31 22.34 21.95 23.64 23.36 23.38 22.61 22.06 22.09 22.48 23.53 22.15 23.73 22.06 23.01 22.68 22.59 22.32 22.15 23.81 23.04 22.76 23.36 P11506 Atp2b2 4 146.89461 24215 - 146.89461 147.207984 plasma membrane calcium-transporting atpase 2 None NASLVNGKMQDGSADSSQSK None 108732 56150 22.36 21.68 21.81 22.33 23.0 22.32 21.59 22.17 23.33 22.26 21.95 23.68 23.34 23.4 22.58 22.01 22.22 22.54 23.5 21.97 23.72 22.11 23.01 22.69 22.62 22.37 22.25 23.67 23.18 22.82 23.4 P31647 Slc6a11 4 147.2979691 79213 + 147.2979691 147.413443 sodium- and chloride-dependent gaba transporter 3 None AAEEARGSEALGGGGGGAAGTR None 607952 129935 22.19 19.95 21.84 22.15 20.96 21.11 21.79 21.04 20.99 22.36 21.51 20.56 21.69 20.76 21.91 21.11 22.06 20.9 20.75 22.22 21.56 22.36 21.92 21.66 21.83 21.84 21.66 20.96 21.32 21.97 21.73 P23978 Slc6a1 4 147.4669821 79212 + 147.4669821 147.482332 sodium- and chloride-dependent gaba transporter 1 None VADGQISTEVSEAPVASDKPK None 137165 2290 20.22 17.96 21.64 20.36 19.13 19.65 19.96 18.68 19.93 19.69 19.7 19.31 20.51 20.71 20.61 18.91 20.83 19.43 20.19 18.75 20.59 20.32 20.41 19.93 19.66 19.55 20.0 20.36 19.33 20.48 20.27 P31390 Hrh1 4 147.6459081 24448 + 147.6459081 147.647649 histamine h1 receptor None RPCFRLDIMQKQSVAEGDVR None 600167 668 15.34 13.8 14.4 16.04 14.18 14.92 15.8 15.99 15.73 14.8 16.57 15.96 15.34 14.07 15.76 13.96 16.09 14.39 15.95 14.67 15.86 16.02 15.75 14.46 14.83 15.76 14.12 16.01 15.79 16.31 15.01 Q641Y5 Atg7 4 147.7470121 312647 + 147.7470121 147.925622 ubiquitin-like modifier-activating enzyme atg7 None LTVGVYDPCNLTQHPGWPLR None None 4662 18.14 17.16 17.08 17.2 19.13 17.68 17.95 17.13 19.06 17.5 18.69 19.78 17.82 19.04 18.19 19.52 17.15 18.77 18.82 17.0 17.79 17.05 17.95 17.44 17.27 17.57 18.03 19.78 17.08 19.28 18.1 D3ZKT0 Tamm41 4 148.0705531 362419 - 148.0705531 148.103711 phosphatidate cytidylyltransferase None VHFRELYESILQKDPQMVYK None None None 17.04 15.97 16.36 17.56 16.29 16.85 17.14 16.73 16.64 16.16 16.68 17.79 17.74 16.5 17.86 16.7 17.38 16.98 17.03 15.67 16.87 17.24 16.56 17.11 16.65 16.88 16.35 16.3 17.83 16.72 18.51 Q63537 Syn2 4 148.1862711 29179 + 148.1862711 148.344192 synapsin-2 None KQTAASAGLVDAPAPSAASR None 600755 49348 23.24 22.33 23.34 23.21 22.13 24.55 24.16 22.71 23.83 23.98 22.39 23.59 24.2 23.83 22.74 24.31 24.73 23.08 23.26 22.77 23.63 23.68 24.21 22.51 22.31 23.63 23.59 24.21 22.44 23.22 22.92 Q5XI23 Mkrn2 4 148.6616141 297525 + 148.6616141 148.679578 probable e3 ubiquitin-protein ligase makorin-2 None REKKTLVLRDRNLTGLAEDK None 608426 8392 16.84 18.65 16.34 15.7 17.37 17.51 16.38 16.02 18.17 16.82 17.6 16.06 16.25 16.87 16.8 17.85 17.43 16.53 17.37 15.92 17.28 16.79 16.03 17.02 17.12 16.89 17.05 17.1 17.34 16.38 16.58 P11345 Raf1 4 148.6795371 24703 - 148.6795371 148.740195 raf proto-oncogene serine/threonine-protein kinase None VHMVSTTLPVDSRMIEDAIR None 164760 26177 17.09 19.11 16.41 17.72 16.61 16.85 16.77 17.28 16.84 16.57 16.48 17.13 16.9 17.53 18.26 16.43 17.78 17.03 17.81 15.65 18.01 16.75 16.58 18.1 18.31 18.97 17.83 16.74 17.06 16.54 17.29 Q9R0L4 Cand2 4 148.8350541 192226 + 148.8350541 148.863153 cullin-associated nedd8-dissociated protein 2 None CANMRSDKEQLRDIAGIGLK None None 41657 19.44 18.92 18.65 19.7 19.63 17.53 19.31 20.11 18.1 18.56 18.89 18.54 18.97 17.93 19.91 19.47 18.72 19.34 19.48 17.49 17.75 18.77 18.62 18.89 19.89 20.63 20.01 19.08 17.6 18.56 19.84 P62912 Rpl32 4 148.8640491 28298 - 148.8640491 148.867612 60s ribosomal protein l32 None FRKFLVHNVKELEVLLMCNK None None 38347 16.57 17.86 17.34 17.71 17.93 18.28 16.62 18.18 18.41 18.8 17.51 18.87 18.63 18.2 18.58 18.0 18.64 18.05 17.19 17.9 19.04 18.04 18.67 19.09 16.63 18.29 18.76 17.14 18.6 17.58 17.55 A0A0G2JZL6 Ift122 4 148.9049331 312651 + 148.9049331 148.975472 intraflagellar transport protein 122 homolog None KRGESNNDLFLADVFSYQGK None 606045 12819 15.69 15.61 16.9 16.21 15.9 15.43 16.74 15.95 15.08 16.51 16.12 15.1 15.28 14.54 16.12 15.15 16.05 16.11 15.64 14.94 16.41 15.88 15.73 14.85 15.92 15.91 16.0 15.53 15.8 16.26 15.71 Q5PPJ1 Ift122 4 148.9049331 312651 + 148.9049331 148.975472 intraflagellar transport protein 122 homolog None YAYRDSMTDVIVQHLITEQK None 606045 12819 15.62 14.63 16.89 15.45 15.69 15.62 16.83 15.4 15.07 16.5 16.11 15.1 15.74 15.32 14.98 15.47 16.11 16.64 16.16 15.6 15.62 17.13 16.06 15.07 15.91 15.91 16.61 15.43 14.91 16.38 15.97 D4AA77 Plxnd1 4 149.0027851 312652 - 149.0027851 149.042469 plexin d1 None ASAAKNPKLMLRRTESVVEK None 604282 22866 16.75 16.95 17.5 17.02 16.55 17.95 18.09 17.71 17.45 16.73 18.04 17.84 19.02 17.69 17.78 17.76 17.82 17.7 17.95 16.32 18.19 17.63 17.5 17.68 16.81 18.34 17.71 18.35 16.05 16.67 17.51 D3ZH14 Tmcc1 4 149.0699921 312654 - 149.0699921 149.19823 transmembrane and coiled-coil domain family 1 None TNTLDMQSSGFDALLHEVQEIR None None 8995 17.84 16.21 17.68 16.58 18.51 18.34 17.62 17.36 17.58 16.9 19.2 17.56 18.25 17.33 18.19 19.01 17.94 18.18 16.63 17.73 17.15 17.2 18.1 16.59 17.73 17.64 17.37 18.66 18.22 18.3 17.8 A0A0U1RS11 Washc2c 4 149.2679251 297530 + 149.2679251 149.325854 wash complex subunit 2c None NTQFIENRVYDEEVEDQALK None 613631 41686 17.24 15.37 17.7 17.08 16.14 17.71 17.02 17.45 17.74 15.95 17.64 17.09 17.51 17.29 17.54 16.62 16.6 17.66 16.61 18.06 18.03 17.41 17.74 16.79 17.45 16.98 18.04 16.34 17.58 18.26 17.7 F1LPG9 Washc2c 4 149.2679251 297530 + 149.2679251 149.325854 wash complex subunit 2c None AKSMFDDDTDDIFSSGLQAK None 613631 41686 19.46 17.79 18.42 19.75 19.0 19.09 19.77 19.94 20.02 18.03 20.13 19.19 19.84 19.52 18.56 18.13 19.29 19.49 19.38 20.83 20.32 19.46 19.75 18.15 20.72 20.17 19.74 19.13 20.14 20.63 19.9 Q80X08 Washc2c 4 149.2679251 297530 + 149.2679251 149.325854 wash complex subunit 2 None KKRNPFPLLEDEEDLFADQK None 613631 41686 19.62 17.57 18.42 19.76 19.01 19.12 19.77 19.9 20.01 18.03 20.14 19.16 19.81 19.59 18.53 18.08 19.3 19.52 19.38 20.83 20.27 19.45 19.86 18.16 20.75 20.13 19.75 19.03 20.15 20.47 19.92 Q794E4 Hnrnpf 4 151.0832631 64200 + 151.0832631 151.104463 heterogeneous nuclear ribonucleoprotein f None ADSANDGFVRLRGLPFGCTK None None 21032 18.86 19.39 19.6 18.96 19.28 19.06 18.46 19.54 20.16 19.04 17.88 20.15 19.19 19.08 19.53 18.84 19.15 18.81 19.9 19.42 20.73 19.04 18.81 20.02 18.84 19.06 20.08 17.92 20.05 19.23 21.18 D3ZZV7 Rasgef1a 4 151.256961 312664 + 151.256961 151.266492 rasgef domain family, member 1a None ISRQIHEFMTWTRVECPFEK None None 17067 16.62 16.82 16.2 16.06 15.61 16.45 16.05 16.06 16.28 16.07 15.86 15.57 16.64 15.94 16.88 17.98 16.58 16.14 16.44 14.95 15.85 16.13 16.24 16.36 16.47 17.06 16.41 17.26 15.2 15.36 15.4 A0A0G2QC25 Cacna1c 4 151.7641391 24239 - 151.7641391 151.951425 voltage-dependent l-type calcium channel subunit alpha None RTALRIKTEGNLEQANEELR None 114205 55484 16.1 15.34 16.52 16.76 15.46 16.35 15.86 15.73 17.55 17.66 16.36 15.88 17.15 16.52 17.5 16.7 16.8 16.26 17.01 15.0 17.95 16.73 16.9 16.92 16.03 16.39 16.31 17.39 16.44 15.47 17.14 P22002 Cacna1c 4 151.7641391 24239 - 151.7641391 151.951425 voltage-dependent l-type calcium channel subunit alpha-1c None NALSLQAGLRTLHDIGPEIR None 114205 55484 16.08 15.36 16.5 16.8 15.28 16.54 15.87 15.47 17.55 17.58 16.4 15.9 17.06 16.72 17.51 16.65 16.74 16.37 16.95 14.93 17.8 16.97 16.89 17.21 15.85 16.29 16.58 17.4 15.58 15.37 17.19 D3ZZJ7 Dcp1b 4 152.358361 500305 + 152.358361 152.395837 decapping mrna 1b None GVACSLACEDPRKLSLPVEK None 609843 51881 14.84 16.93 14.89 15.86 15.64 14.24 15.02 16.25 15.41 14.08 15.65 14.49 14.69 14.6 14.6 15.71 15.1 14.73 14.8 15.94 14.83 14.0 14.71 15.51 16.64 16.06 15.25 15.27 14.55 14.52 15.25 D3ZPP7 Lrtm2 4 152.4858681 680883 - 152.4858681 152.500451 leucine-rich repeats and transmembrane domains 2 None NLSSLQRLDLSNNFLDQLPR None None 65244 14.22 14.79 14.65 15.62 14.88 15.38 14.78 14.76 15.6 15.41 14.84 14.59 15.75 14.72 14.32 15.01 15.42 16.35 14.97 15.18 16.69 15.93 16.27 15.53 15.98 16.85 14.19 16.23 16.26 14.28 14.94 A0A0G2JYT1 Erc1 4 152.7636511 266806 - 152.7636511 153.055694 elks/rab6-interacting/cast family member 1 None FENAPDSAKTKALQTVIEMK None None None 18.86 19.19 19.36 18.58 19.04 19.1 18.37 19.03 20.17 18.64 17.88 19.86 19.66 19.51 20.12 19.11 18.86 19.06 19.84 18.64 20.2 19.04 18.33 19.28 19.27 19.25 19.4 19.98 19.62 19.21 20.94 Q811U3 Erc1 4 152.7636511 266806 - 152.7636511 153.055694 elks/rab6-interacting/cast family member 1 None LAAISEKDANIALLELSSSK None None None 18.85 19.59 19.33 18.58 19.02 19.13 18.38 19.03 20.15 18.66 17.88 19.87 19.6 19.52 20.05 19.12 18.97 19.05 19.83 18.62 20.21 19.04 18.2 19.27 19.26 19.27 19.31 19.9 19.72 19.1 20.88 A0A0G2K3A0 Wnk1 4 153.1283351 116477 - 153.1283351 153.253948 non-specific serine/threonine protein kinase Hsn2; Prkwnk1 None None None None 19.87 16.96 19.23 18.38 18.91 18.62 17.67 19.08 17.99 18.76 19.45 16.76 18.74 18.16 18.79 18.89 19.23 18.43 17.46 18.34 17.45 18.32 18.57 19.56 18.89 18.42 19.61 17.94 17.96 19.26 17.9 Q9JIH7 Wnk1 4 153.1283351 116477 - 153.1283351 153.253948 serine/threonine-protein kinase wnk1 None NFNISNLQKSISNPPGSNLR None 605232 14253 19.87 16.96 19.23 18.38 18.91 18.62 17.7 19.08 17.99 18.76 19.45 16.76 18.74 18.16 19.0 18.89 19.17 18.48 17.47 18.28 17.45 18.32 18.57 19.53 18.89 18.42 19.64 17.94 17.95 19.26 17.9 M0R697 Tmem121b 4 153.6981951 500307 - 153.6981951 153.699912 transmembrane protein 121b None GHLENEGGPHGYVNTLAVASQN None None None 16.33 16.4 16.37 16.29 15.49 16.15 15.63 15.42 15.74 15.37 16.79 15.94 16.06 17.27 15.87 16.11 15.93 16.25 17.32 14.76 16.94 15.96 16.48 16.56 16.87 16.42 14.77 16.75 17.21 15.73 15.4 D3ZQB6 Hdhd5 4 153.7190341 312680 - 153.7190341 153.753269 cat eye syndrome chromosome region, candidate 5 homolog (human) None QYHNKRMLVSGQGPLVENAR None None None 17.12 15.03 16.5 17.03 17.95 15.1 16.62 17.21 17.54 16.87 16.39 16.3 17.28 16.76 16.54 17.74 15.8 16.87 17.02 18.39 16.99 16.41 17.23 16.48 18.45 17.6 16.8 18.16 16.71 17.45 17.85 Q505J6 Slc25a18 4 154.0009911 681896 + 154.0009911 154.021372 mitochondrial glutamate carrier 2 None DVLKTRIQTLKKGLGEDTYR None 609303 57151 18.82 21.38 19.04 19.65 18.41 18.6 19.34 19.26 19.53 19.89 17.95 18.79 18.88 18.94 20.13 19.18 19.33 18.89 19.73 17.82 18.96 19.11 18.53 19.46 19.01 19.44 18.37 19.89 19.28 18.7 19.19 G3V7L8 Atp6v1e1 4 154.0223481 297566 - 154.0223481 154.044577 atpase, h+ transporting, v1 subunit e isoform 1, isoform cra_a None DVQKQIKHMMAFIEQEANEK None 108746 1282 22.7 22.0 21.84 22.7 22.75 22.99 22.0 22.1 22.37 21.37 21.76 22.58 23.46 22.11 21.54 22.56 22.55 24.2 22.14 22.09 21.4 22.66 21.95 23.06 22.89 22.84 22.61 21.19 23.86 21.89 24.17 Q6PCU2 Atp6v1e1 4 154.0223481 297566 - 154.0223481 154.044577 v-type proton atpase subunit e 1 None RLKVLRARDDLITDLLNEAK None 108746 1282 22.71 21.94 21.84 22.68 22.75 22.99 22.0 22.01 22.37 21.37 21.76 22.58 23.45 22.13 21.56 22.57 22.55 24.2 22.13 22.08 21.43 22.7 22.01 23.06 22.89 22.84 22.61 21.19 23.86 21.91 24.16 D3ZT71 Bcl2l13 4 154.0561381 312682 + 154.0561381 154.107651 bcl2-like 13 None SEERSGRRRKSHTGEAIAAR None None 9111 19.97 17.69 20.54 20.29 18.87 20.15 18.92 18.16 19.36 20.1 19.13 19.64 20.29 19.6 19.88 19.47 18.66 20.06 18.82 20.8 20.55 20.35 20.25 20.31 19.68 19.51 20.0 18.55 20.64 20.06 19.91 Q9JLT6 Bid 4 154.113211 64625 - 154.113211 154.136109 bh3-interacting domain death agonist None RHLAQAGDELDHSIQPTLVR None 601997 923 15.27 14.94 15.89 15.58 15.41 14.81 16.02 15.42 15.16 15.27 16.37 14.06 15.08 14.03 13.66 15.33 14.6 16.58 15.05 15.51 13.46 15.29 14.08 14.82 14.93 14.63 15.72 14.99 13.74 14.32 15.6 D3ZGN7 Mical3 4 154.1557841 362427 - 154.1557841 154.264075 f-actin monooxygenase None IGAGPCGLRTAIDLSLLGAK None 608882 85288 17.9 16.45 18.9 18.86 16.75 17.07 17.89 17.68 18.92 17.24 17.53 18.04 17.92 18.12 18.61 17.49 16.42 17.08 18.82 17.89 18.1 18.3 18.11 17.27 16.96 18.08 17.53 19.01 17.58 18.1 18.41 Q6AY56 Tuba8 4 154.4401061 500377 + 154.4401061 154.457023 tubulin alpha-8 chain None AYHEQLSVAEITSSCFEPNSQMVK None 605742 56766 26.26 23.83 26.44 25.5 24.81 25.49 25.58 25.42 25.01 26.13 25.61 24.61 25.73 26.03 25.51 24.03 25.71 25.54 25.92 23.99 25.25 26.16 26.11 24.89 26.28 25.01 25.11 24.73 26.68 26.07 25.39 P31646 Slc6a13 4 154.5391721 171163 + 154.5391721 154.576341 sodium- and chloride-dependent gaba transporter 2 None ETKPVCPVMEKVEEDGTLER None None 9592 16.36 15.4 17.26 17.72 17.01 15.86 17.88 16.61 16.74 16.2 18.33 16.74 17.96 16.32 17.28 17.12 16.48 17.14 17.48 16.95 16.96 17.28 17.46 17.03 17.88 16.78 17.06 16.88 16.09 17.03 16.81 Q76M68 Iqsec3 4 154.6109321 404781 - 154.6109321 154.70731 iq motif and sec7 domain-containing protein 3 None ISRGFIPDTPIGVAHFLLQR None 612118 46091 18.87 16.52 18.54 19.29 17.85 17.1 16.88 17.66 16.67 18.35 17.57 16.93 17.73 16.81 18.72 17.92 18.55 17.14 17.88 16.55 16.85 18.29 18.16 19.23 18.22 18.67 17.8 17.15 17.79 18.16 17.49 G3V9J1 Mug2 4 155.1757041 + 155.1757041 155.236765 uncharacterized protein None MVIADVKMLSGFIPLKPTVK None None None 20.81 21.75 21.26 21.69 20.88 19.54 21.53 21.32 19.65 20.19 21.37 19.95 19.99 19.99 20.57 20.7 20.67 20.87 19.28 21.04 20.32 19.17 20.66 21.1 20.13 21.23 20.03 19.94 19.74 19.59 19.39 Q6IE52 Mug2 4 155.1757041 408236 + 155.1757041 155.236765 murinoglobulin-2 None TGRKDTVIKVLIVEPEGIKK None None None 21.16 21.17 21.48 21.84 20.62 19.75 21.59 20.94 19.47 20.19 21.42 20.07 19.95 20.18 20.58 20.34 20.67 20.76 19.21 21.04 20.7 19.0 21.04 21.02 20.01 20.85 20.0 19.94 19.58 19.51 19.14 P06238 A2m 4 154.8980771 100911545 + 154.8980771 154.947786 alpha-2-macroglobulin None QLDVHAKIQEEGTGVEETGK None None None 18.05 18.86 19.03 19.66 19.5 18.6 18.77 19.72 18.61 17.65 19.89 18.78 18.43 18.61 18.21 19.27 18.89 19.12 18.04 19.56 18.21 17.35 18.78 18.34 18.86 18.74 19.81 18.58 18.64 18.58 19.38 P14046 A1i3 4 154.8697071 + 154.8697071 155.029309 alpha-1-inhibitor 3 None KQSGVKEEHSFTVMEFVLPR None None None 21.24 21.17 21.73 21.82 20.96 19.93 21.57 21.14 19.99 20.48 21.74 20.02 20.19 20.53 20.78 20.78 20.83 20.95 19.54 21.12 20.8 19.21 21.4 21.23 20.11 20.92 20.22 20.34 19.81 19.72 19.49 A0A0G2JUW7 Mug1 4 154.8697071 497794 + 154.8697071 155.158564 murinoglobulin-1 None GGVDDEITLSAYITMALLESSLPDTDPVVSK None None None 21.5 20.89 21.62 22.03 20.68 19.96 21.73 21.03 19.5 20.31 21.45 20.36 20.31 20.26 20.7 20.34 20.9 20.93 19.25 21.28 21.01 19.23 21.39 21.25 20.22 21.0 20.07 19.9 19.92 19.81 19.14 D4AA52 Mug1 4 154.8697071 297568 + 154.8697071 155.158564 murinoglobulin-1 None SKSQKTPSVTVQSSGSFSQK None None None 21.25 21.17 21.73 21.82 20.96 19.9 21.57 21.15 19.99 20.45 21.78 19.98 20.2 20.53 20.78 20.78 20.82 20.95 19.54 21.12 20.8 19.21 21.39 21.22 20.15 20.93 20.23 20.34 19.79 19.71 19.47 Q03626 Mug1 4 154.8697071 497794 + 154.8697071 155.158564 murinoglobulin-1 None SKSQKTPLVTIQSSGSFSQK None None None 21.51 20.8 21.6 22.05 20.67 19.95 21.77 21.04 19.48 20.3 21.43 20.38 20.38 20.21 20.7 20.33 20.94 20.91 19.22 21.32 20.99 19.24 21.42 21.23 20.24 21.02 20.04 19.84 19.98 19.82 19.13 P01835 Kacb 4 154.980371 + 154.980371 155.032196 ig kappa chain c region, b allele None SLTKADYESHNLYTCEVVHK None None None 21.22 18.81 20.35 21.21 20.99 21.84 21.61 20.9 21.32 20.03 21.98 19.73 21.17 20.07 20.49 20.02 21.29 19.46 20.19 21.33 21.04 18.92 20.6 20.51 19.59 20.5 19.19 20.21 20.94 20.02 21.59 P69682 Necap1 4 156.103881 312694 + 156.103881 156.119057 adaptin ear-binding coat-associated protein 1 None SNRGYRASDWKLDQPDWTGR None 611623 22902 21.5 19.7 21.06 20.52 20.2 21.36 21.3 20.73 21.03 21.95 19.46 20.29 21.02 20.65 19.41 20.71 20.95 20.97 20.58 21.78 20.21 21.45 20.96 19.29 19.67 21.38 20.2 21.23 21.44 20.85 21.02 A0A0G2JVB0 Slc2a3 4 155.9630741 100909595 - 155.9630741 155.97412 solute carrier family 2, facilitated glucose transporter member 3 None GCLMGFAKIAESVEMLILGR None None None 21.11 19.21 19.69 20.45 20.38 21.07 20.32 21.47 21.43 21.91 20.19 20.78 21.43 20.66 20.96 21.62 20.54 20.8 20.45 21.28 19.87 21.22 21.43 21.1 19.59 21.95 19.79 21.76 20.99 21.16 21.06 Q07647 Slc2a3 4 155.9630741 100909595 - 155.9630741 155.97412 solute carrier family 2, facilitated glucose transporter member 3 None GCLMGFAKIAESVEMLILGR None None None 20.95 19.06 19.43 20.23 20.11 20.97 20.15 21.18 21.25 21.67 20.15 20.68 21.25 20.63 20.66 21.49 20.31 20.62 20.33 21.1 19.66 21.24 21.25 20.99 19.39 21.72 19.43 21.7 20.93 20.99 20.88 A0A096P6L7 Pex5 4 157.2706721 103690024 - 157.2706721 157.295692 pts1-bp None YGAADARDLPALLTMFGLPQ None None None 16.44 14.28 16.59 15.95 16.74 15.77 15.75 14.51 16.55 14.94 16.99 15.5 16.68 16.92 15.79 17.17 16.93 15.84 15.34 16.36 15.76 16.34 16.59 15.46 17.08 16.48 16.27 17.41 16.01 16.69 17.03 A0A0H2UHI4 Pex5 4 157.2706721 103690024 - 157.2706721 157.295692 pts1-bp None SLLSDSLFLEVKELFLAAVR None None None 16.77 14.61 17.08 16.31 17.0 16.03 16.09 15.19 16.81 15.25 17.22 15.85 17.02 17.44 15.76 17.47 17.95 16.24 15.57 16.72 15.91 16.52 16.93 15.84 17.44 16.79 16.61 17.55 16.43 17.02 17.36 D3Z9U2 Cd163 4 157.0850831 312701 + 157.0850831 157.11847 cd163 antigen None IHQVQYQEMDSKTDDLDLLK None 605545 128811 13.97 15.52 15.6 15.67 15.4 14.4 16.78 17.07 15.77 14.64 16.77 15.68 15.22 15.19 15.44 16.26 14.8 17.23 15.32 15.02 14.96 15.66 16.12 15.73 15.01 16.08 15.26 14.86 14.91 15.24 15.52 G3V7J1 Clstn3 4 157.3306841 171393 - 157.3306841 157.364886 calsyntenin-3 None LQYSGEKLYKFTVTAYDCGK None None 8814 18.14 15.87 17.71 17.81 18.55 17.36 17.79 17.44 18.19 17.84 17.53 17.28 18.32 17.94 17.92 17.15 18.82 17.34 17.95 17.05 18.26 17.56 18.37 16.94 18.37 17.47 17.37 17.76 18.96 18.57 18.06 Q8R553 Clstn3 4 157.3306841 171393 - 157.3306841 157.364886 calsyntenin-3 None LQYSGEKLYKFTVTAYDCGK None None 8814 18.14 15.87 17.71 17.72 18.7 17.28 18.22 17.61 18.19 17.84 17.53 17.28 18.32 17.9 17.91 17.15 18.74 17.45 18.04 17.02 18.12 17.59 18.37 17.25 18.37 17.47 16.79 17.95 19.01 18.57 18.06 Q5FVN0 Lpcat3 4 157.4683981 362434 + 157.4683981 157.509888 lysophospholipid acyltransferase 5 None FSMNHYMKLVKGQLTDVPGK None 611950 14678 16.86 14.68 17.45 16.4 17.66 14.68 16.12 16.78 16.1 15.39 16.07 15.89 16.63 17.26 16.72 15.47 15.97 16.98 16.88 15.01 15.96 15.42 16.57 16.96 17.38 16.59 16.85 16.79 15.42 16.83 17.05 Q5XIH7 Phb2 4 157.5176631 114766 + 157.5176631 157.52226 prohibitin-2 None NEVLKSVVAKFNASQLITQR None 610704 5263 19.77 21.03 19.02 20.66 20.74 19.43 20.46 20.86 19.49 19.41 19.12 19.68 20.23 19.2 19.86 20.58 20.25 19.67 20.99 19.16 18.52 19.29 19.1 19.04 21.08 21.42 20.04 19.23 21.16 19.09 21.42 P81718 Ptpn6 4 157.5260361 116689 - 157.5260361 157.550783 tyrosine-protein phosphatase non-receptor type 6 None AEYKLRTLQISPLDNGDLVR None 176883 56589 16.73 14.63 16.99 16.59 15.67 15.85 16.46 16.17 16.04 16.15 16.97 15.57 16.86 15.39 16.2 15.98 16.28 15.55 17.1 15.39 17.35 16.81 16.85 15.93 16.59 15.31 16.46 16.24 16.73 16.29 16.6 P07323 Eno2 4 157.5720731 100911625 - 157.5720731 157.580946 gamma-enolase None RLAKYNQLMRIEEELGEEAR None None None 23.74 26.02 24.48 23.55 23.8 24.82 25.1 23.83 23.04 24.25 23.4 23.89 23.49 23.7 21.99 22.21 23.73 24.31 24.19 24.84 23.82 24.71 23.83 22.16 24.35 23.1 23.61 23.97 24.07 23.75 22.97 P48500 Tpi1 4 157.6152881 24849 - 157.6152881 157.618813 triosephosphate isomerase None KMNGRKKCLGELICTLNAAK None 190450 128432 23.42 23.68 23.99 24.36 25.28 24.77 25.81 25.06 24.84 25.3 23.97 25.2 25.39 25.14 22.98 24.12 24.18 25.22 24.28 25.58 23.85 24.15 25.54 23.96 23.17 24.39 23.63 24.13 24.9 24.49 24.43 D3ZVQ0 Usp5 4 157.6196491 297593 - 157.6196491 157.634711 ubiquitin carboxyl-terminal hydrolase None GVEGGFDLTEDKFEYDEDVK None 601447 55758 22.16 19.95 20.71 20.44 21.12 21.15 22.17 22.03 19.91 20.91 21.67 20.34 21.64 20.59 19.52 22.11 21.09 21.35 20.97 22.4 19.72 21.7 21.29 19.7 21.96 22.39 20.59 21.4 20.95 21.4 21.15 P52287 Gnb3 4 157.6392831 60449 - 157.6392831 157.645173 guanine nucleotide-binding protein g(i)/g(s)/g(t) subunit beta-3 Hg2d None None None None 22.89 21.49 21.98 22.95 22.36 21.92 21.44 23.22 22.37 23.21 21.38 22.72 23.0 21.44 22.92 23.67 22.32 22.34 22.19 22.8 21.94 22.39 22.75 22.71 22.01 24.1 21.83 22.79 23.79 22.56 23.39 D4AAS1 Gpr162 4 157.6622011 362436 - 157.6622011 157.668121 g protein-coupled receptor 162 None EEITTFIDETPLPSPTASPGPSPR None None 8400 16.15 14.31 15.28 16.46 14.53 15.36 15.27 14.42 16.75 15.91 15.39 16.25 15.91 16.79 15.2 15.77 15.1 16.94 16.12 14.96 16.73 16.44 16.42 16.9 15.48 16.67 16.18 15.48 15.58 16.29 16.14 P04550 Ptms 4 157.7223871 83801 - 157.7223871 157.726575 parathymosin None EDEGPVRKRTAEEEDEADPK None 168440 136762 20.89 20.85 22.0 21.4 21.62 21.67 22.05 21.07 22.77 20.55 20.7 22.38 21.72 21.94 21.22 20.78 20.4 21.91 22.33 22.38 23.19 21.68 21.87 21.27 21.59 21.02 21.03 21.94 21.87 21.84 22.96 D3ZPN3 Mlf2 4 157.7396781 312709 + 157.7396781 157.74432 myeloid leukemia factor 2 None SYSNTGDGAPKVYQETSEMR None 601401 3968 17.29 16.17 16.24 16.48 16.87 16.29 15.53 16.65 16.88 17.13 16.62 16.61 16.33 16.84 17.31 16.68 17.5 16.15 16.74 15.09 17.32 16.08 17.11 17.41 16.78 16.57 16.56 15.99 17.74 16.34 17.83 F1MAA2 Cops7a 4 157.7666271 312710 - 157.7666271 157.773993 cop9 signalosome subunit 7a None LRGSLDQRNQRLEVDYSIGR None None 22685 19.82 19.04 18.83 19.07 19.87 19.37 19.05 20.06 18.82 19.21 19.54 18.26 20.1 18.24 19.54 19.52 19.65 18.88 18.56 20.48 18.49 19.98 18.72 19.94 20.05 20.19 20.85 19.01 18.32 19.51 20.63 E9PU01 Chd4 4 157.8985151 117535 + 157.8985151 157.931631 dna helicase None LNARGGGNQVSLLNVVMDLK None 603277 68175 18.37 17.11 18.86 17.99 18.32 18.45 17.62 17.82 19.58 17.68 17.68 19.05 18.43 18.96 19.79 17.62 18.26 18.0 18.95 17.46 20.26 18.63 18.52 18.76 18.49 18.02 19.93 18.35 17.62 18.89 19.88 D4ACW1 Nop2 4 157.9330551 314969 + 157.9330551 157.94435 nop2 nucleolar protein None AHLQKELLLSAIDSVNAASK None 164031 None 14.9 15.15 15.41 14.46 14.17 13.61 14.08 14.84 15.55 14.35 15.2 15.47 14.37 14.81 15.07 14.55 16.25 14.3 13.84 15.49 16.8 15.91 14.98 14.63 15.98 14.99 14.89 15.91 15.73 14.79 15.32 E9PTN6 Gapdh 4 157.9623591 - 157.9623591 157.96623 glyceraldehyde-3-phosphate dehydrogenase None None None None 24.05 26.28 25.14 25.96 26.47 25.97 26.53 26.82 26.15 26.69 24.83 26.27 26.26 25.44 24.94 25.87 25.73 26.13 25.68 26.0 24.81 24.74 26.25 25.94 24.49 25.8 26.36 25.4 24.36 25.26 25.26 F1LUV3 Gapdh 4 157.9623591 - 157.9623591 157.96623 gp_dh_n domain-containing protein None None None None 24.3 23.66 23.63 24.28 24.54 24.45 24.55 24.94 24.35 25.15 23.07 24.44 23.82 24.02 23.83 25.78 24.51 25.35 23.37 25.08 23.19 24.58 24.34 23.37 24.36 25.86 25.08 25.94 23.51 24.79 24.79 P04797 Gapdh 4 157.9625581 108351137 - 157.9625581 157.965924 glyceraldehyde-3-phosphate dehydrogenase None RGAAQNIIPASTGAAKAVGK None None None 27.08 24.42 25.81 25.8 26.94 26.17 26.81 26.62 24.22 24.81 25.15 26.4 25.79 25.81 24.67 25.81 25.64 26.14 26.02 25.93 24.33 24.75 26.05 25.37 27.06 26.26 26.37 25.56 24.34 26.94 25.79 Q63666 Vamp1 4 158.0126641 25624 + 158.0126641 158.019349 vesicle-associated membrane protein 1 None DDRADALQAGASVFESSAAK None 185880 40678 23.17 20.97 21.09 21.09 22.02 21.51 21.11 21.59 22.72 22.54 21.35 21.44 21.95 21.53 21.67 22.29 22.06 21.07 20.93 21.59 20.82 20.89 21.11 21.2 19.94 22.08 21.12 22.26 22.18 21.6 21.66 Q68FR8 Tuba3a 4 158.0750841 500319 - 158.0750841 158.084077 tubulin alpha-3 chain None TAIAEAWARLDHKFDLMYAK None None None 24.84 25.63 25.94 25.97 25.22 27.49 26.31 25.93 26.48 27.08 25.93 26.52 26.94 26.48 26.26 25.11 26.49 26.12 26.61 24.66 26.32 27.01 27.25 25.6 24.8 25.56 25.68 25.41 27.42 25.9 25.28 P40241 Cd9 4 158.2563281 24936 - 158.2563281 158.289211 cd9 antigen None LESFQVKSCPDAIDEVFHSK None 143030 20420 22.1 19.9 21.55 21.5 22.33 21.82 21.92 22.83 20.65 22.81 22.23 20.48 22.31 20.89 21.41 22.55 21.53 21.69 20.76 23.09 20.73 21.27 22.25 21.27 21.62 22.14 20.35 21.75 22.86 22.32 21.43 F1M957 Vwf 4 158.3601251 116669 + 158.3601251 158.491537 von willebrand factor None EVGEANFNKSKEFLEEVIQR None 613160 466 15.22 16.13 15.92 15.91 16.11 15.56 15.52 17.6 16.86 15.23 18.05 15.56 15.41 17.09 17.88 16.64 16.18 15.7 15.16 15.89 15.49 15.68 16.24 15.96 15.82 16.69 16.06 17.87 15.17 15.95 16.38 Q62935 Vwf 4 158.3601251 116669 + 158.3601251 158.491537 von willebrand factor None DEIRRLPGDIQVVPIGVGSR None 613160 466 15.54 16.5 15.73 15.37 16.09 15.17 15.24 17.35 16.47 14.95 17.74 15.05 14.44 16.53 17.42 16.54 15.93 15.36 15.09 15.43 14.95 15.21 15.32 15.77 15.5 16.21 15.12 15.95 16.99 15.74 16.49 P19024 Kcna5 4 159.3554891 25470 - 159.3554891 159.357296 potassium voltage-gated channel subfamily a member 5 None DPAKRLHYFDPLRNEYFFDR None 176267 1683 20.53 17.7 18.36 19.74 20.46 18.81 19.5 20.33 19.23 19.52 19.84 19.03 19.61 18.63 19.99 20.02 19.11 18.56 19.12 20.12 18.08 18.29 19.53 18.63 20.61 19.61 18.92 19.17 20.29 19.92 19.61 P10499 Kcna1 4 159.4694031 24520 - 159.4694031 159.471124 potassium voltage-gated channel subfamily a member 1 None NPKKRMRYFDPLRNEYFFDR None 176260 183 20.9 18.25 18.24 19.59 21.04 19.16 19.3 20.43 19.69 19.69 19.96 19.5 19.98 19.35 19.65 20.35 19.39 19.4 19.42 20.71 18.75 18.38 19.76 19.15 20.65 20.14 19.21 19.42 21.33 20.49 19.75 G3V8L6 Kcna6 4 159.5429421 64358 - 159.5429421 159.576189 potassium voltage-gated channel subfamily a member 6 Kv1.6 None None None None 20.8 18.63 18.12 19.7 19.76 18.46 19.81 19.94 18.75 19.61 19.39 18.56 18.88 18.55 18.88 19.37 19.03 19.03 18.8 20.29 17.28 19.03 18.86 18.72 20.36 19.61 18.55 18.68 19.52 19.35 18.61 P17659 Kcna6 4 159.5429421 64358 - 159.5429421 159.576189 potassium voltage-gated channel subfamily a member 6 None PDLKATDNGLGKPDFAEASR None 176257 1684 20.8 18.63 18.12 19.7 19.76 18.46 19.85 19.94 18.75 19.61 19.39 18.56 18.88 18.55 18.88 19.37 19.03 19.03 18.8 20.29 17.28 19.03 18.86 18.84 20.36 19.61 18.64 18.68 19.29 19.35 18.61 Q5BK63 Ndufa9 4 159.6592391 362440 - 159.6592391 159.688026 nadh dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9 None LVKYIFGMTHRTFIPYPLPR None 603834 3666 20.54 23.18 20.42 21.55 21.8 19.73 20.87 21.7 20.39 21.33 19.5 20.73 20.34 20.33 20.65 21.75 20.99 20.98 21.48 20.68 19.88 20.12 20.45 21.53 21.95 22.26 21.54 21.24 19.55 20.6 20.71 D4A770 Rgd1311164 4 159.7727871 297607 + 159.7727871 159.806382 protein c12orf4 homolog None QQDLENKWSNELKQSTAIQK None None 10685 17.12 14.76 16.46 15.89 16.43 17.98 15.29 16.42 17.52 16.83 16.48 18.12 17.28 16.41 16.48 16.0 16.22 17.37 16.78 17.91 18.08 17.68 17.3 17.54 15.57 16.06 16.46 16.67 17.2 17.17 17.32 F1LWG2 Prmt8 4 160.5354781 688502 - 160.5354781 160.617439 protein arginine methyltransferase 8 None DNVITIFKGKVEEVELPVEK None None None 19.18 17.0 18.84 18.22 18.35 20.13 17.98 17.63 18.55 18.83 18.51 19.54 19.33 19.32 19.2 18.56 18.26 18.99 20.17 18.11 20.58 19.16 19.15 19.23 19.06 18.31 18.24 19.4 19.59 19.3 19.33 D3ZPL0 Nrip2 4 161.6748831 689619 + 161.6748831 161.683573 nuclear receptor-interacting protein 2 None QATQFLHKDSADLLPLDSLK None None None 17.8 16.9 17.06 17.55 17.69 16.93 17.29 17.69 17.44 17.52 17.75 16.61 18.11 16.65 16.63 17.18 17.0 18.11 16.87 18.1 16.59 17.43 17.82 17.88 16.41 17.91 17.02 17.18 17.27 17.61 16.42 D4ABB1 Nrip2 4 161.6748831 689619 + 161.6748831 161.683573 nuclear receptor-interacting protein 2 None DSLKRLGTSKDLQPHSVIQR None None None 17.98 16.85 17.29 17.55 17.71 16.5 17.44 17.6 17.05 17.1 17.8 16.04 17.85 16.58 16.47 17.09 17.0 17.93 16.95 17.89 16.24 17.29 17.39 16.81 17.23 17.86 17.87 16.76 17.38 17.82 16.54 Q9QVC8 Fkbp4 4 161.703381 260321 - 161.703381 161.711833 peptidyl-prolyl cis-trans isomerase fkbp4 None VGEVCHITCKPEYAYGSAGSPPK None None 36085 20.43 18.54 20.0 19.8 20.56 19.65 20.98 20.57 20.22 19.81 20.06 20.13 20.56 20.41 20.86 18.73 19.68 19.59 20.29 20.47 20.13 19.59 20.35 19.49 20.46 20.13 20.32 20.76 18.81 20.69 20.97 Q63041 Pzp 4 161.7591671 252922 - 161.7591671 161.805259 alpha-1-macroglobulin None IEHSFEVKEYVLPKFEVQVK None 176420 67167 20.36 20.95 20.7 21.42 20.17 19.75 21.36 21.67 19.72 19.85 22.15 19.65 19.51 20.21 19.82 19.96 20.13 20.22 19.76 21.77 20.51 19.08 20.68 20.73 20.13 20.73 19.83 20.04 19.55 19.92 19.44 M0RDD7 Chtopl1 4 162.8044731 500378 - 162.8044731 162.805411 chromatin target of prmt1-like 1 Chtop None None None None 16.2 16.4 17.63 15.88 15.75 15.4 17.07 16.12 17.64 16.78 16.48 16.92 16.51 17.15 15.55 15.57 16.84 15.77 16.19 18.1 18.36 17.24 16.94 15.8 16.17 15.28 16.36 15.88 17.44 16.66 16.62 Q0VGK0 Gabarapl1 4 162.980311 689161 + 162.980311 162.989444 gamma-aminobutyric acid receptor-associated protein-like 1 None EDHPFEYRKKEGEKIRKKYP None 607420 134420 17.83 17.35 17.79 17.61 18.9 19.71 18.98 17.47 17.03 18.88 16.81 18.28 17.71 18.03 19.36 18.94 18.06 18.25 16.92 18.6 17.59 17.34 18.49 17.71 18.53 18.68 18.03 17.93 17.93 19.39 17.67 D4A0L4 Ybx3 4 165.1297591 83807 - 165.1297591 165.1532 y-box-binding protein 3 Csda; Dbpa; Yb2 None None None None 16.81 14.77 16.05 16.5 16.57 16.02 15.86 16.56 16.08 14.99 17.61 16.17 16.14 16.39 15.81 15.37 15.53 16.85 16.59 16.65 17.09 15.96 15.93 16.54 17.33 15.86 16.45 14.75 17.12 17.32 17.31 Q62764 Ybx3 4 165.1297591 83807 - 165.1297591 165.1532 y-box-binding protein 3 None KGAEAANVTGPDGVPVEGSR None 603437 2708 16.78 14.57 16.0 16.46 16.52 15.97 15.82 16.51 16.03 14.95 17.56 16.12 15.96 16.35 16.06 15.32 15.94 16.39 16.35 16.39 17.04 15.92 16.4 16.5 17.28 15.82 16.4 14.7 17.08 17.39 16.79 B1H257 Borcs5 4 167.4733741 362452 + 167.4733741 167.540991 bloc-1-related complex subunit 5 None TFQPLLKGLLSGQTSPTNAR None None None 17.09 17.76 17.6 16.83 17.48 16.43 17.73 15.62 16.67 17.55 16.75 16.38 16.65 17.76 16.2 17.22 17.88 16.38 16.03 18.09 16.43 17.34 16.75 15.5 17.19 17.63 16.92 17.57 17.25 16.49 17.57 O08769 Cdkn1b 4 167.7601821 83571 + 167.7601821 167.764982 cyclin-dependent kinase inhibitor 1b None EELTRDLEKHCRDMEEASQR None 600778 2999 16.65 14.67 16.16 15.91 17.1 16.44 16.59 16.29 17.17 15.9 15.54 16.99 16.85 17.04 17.14 15.59 17.21 16.54 16.09 15.81 17.81 16.05 16.86 16.66 16.71 16.72 17.12 15.57 16.9 17.13 17.54 B4F7C7 Hebp1 4 167.9742961 362454 - 167.9742961 168.003842 hebp1 protein None FRIPNQFQGSPPTPSDQSVK None 605826 8407 20.37 18.52 19.66 19.87 18.36 20.22 20.28 19.81 19.63 20.41 19.42 20.12 20.49 20.75 19.22 20.66 20.45 20.44 19.02 20.19 19.97 20.16 20.41 20.56 19.29 20.87 19.29 20.66 18.86 19.91 19.9 D3ZWJ9 Fam234b 4 168.0483971 362455 + 168.0483971 168.089654 protein fam234b None RLGSQGGGDLSPLELADVNR None None 12572 17.61 14.91 16.34 17.67 16.15 17.24 17.54 15.59 17.11 16.8 17.8 16.98 17.07 17.46 16.53 16.24 17.82 16.13 16.66 16.8 17.56 17.17 17.35 17.32 16.92 16.42 15.6 16.42 16.94 17.16 16.97 Q5M7W6 Fam234a 4 168.0483971 360502 + 168.0483971 168.089654 protein fam234a None DLEAEIHPLKNEDKKSQENL None None 12932 16.67 16.27 16.43 16.98 16.83 16.39 16.34 16.19 16.47 16.46 18.15 15.52 16.01 17.22 15.54 16.06 15.9 16.84 16.57 17.51 15.98 15.92 16.49 16.54 16.86 16.3 15.76 16.78 16.64 16.71 15.68 M0RB80 Pbp2 4 168.1558281 246145 - 168.1558281 168.157121 phosphatidylethanolamine-binding protein 2 None PSRKEPIYREWHHFLVVNMK None None None 18.94 17.26 17.29 18.73 18.94 16.78 18.51 18.89 17.22 18.27 17.46 17.74 18.07 18.0 16.84 18.45 17.08 18.64 18.29 19.07 17.02 17.23 17.97 16.96 18.88 19.37 18.69 17.52 17.97 18.22 18.43 G3V746 Grin2b 4 168.5999851 24410 - 168.5999851 169.043704 glutamate receptor None VTFEGRNLSFSEDGYQMHPK None 138252 646 18.67 17.98 17.37 17.93 17.54 18.1 17.23 17.69 18.17 18.5 18.21 17.97 18.39 18.51 17.66 19.16 18.34 18.54 18.93 16.91 18.53 17.88 18.69 19.31 18.2 19.07 18.46 17.94 17.91 17.08 17.56 Q00960 Grin2b 4 168.5999851 24410 - 168.5999851 169.043704 glutamate receptor ionotropic, nmda 2b None SDVSDISTHTVTYGNIEGNAAK None 138252 646 18.66 17.87 17.37 17.93 17.54 18.1 17.23 17.69 18.17 18.5 18.21 17.97 18.41 18.51 17.66 19.16 18.34 18.54 18.93 16.91 18.53 17.88 18.72 19.31 18.2 19.07 18.46 17.94 17.91 17.11 17.6 Q5PQQ2 Wbp11 4 169.6809511 103689936 - 169.6809511 169.713665 ww domain-binding protein 11 None RETFERILRLYEKENPDIYK None None None 16.46 16.83 17.51 16.98 17.26 16.15 16.22 16.78 17.36 15.98 15.98 17.94 17.21 17.41 17.27 16.08 16.37 17.61 16.6 18.19 18.65 17.13 16.59 17.71 18.03 17.23 18.17 16.65 17.25 17.22 18.62 Q5M860 Arhgdib 4 169.8229551 362456 - 169.8229551 169.841662 rho gdp dissociation inhibitor beta None LSLVCDSAPGPITMDLTGDLK None 602843 20318 18.87 16.51 18.7 18.35 19.25 19.19 18.75 19.55 19.07 18.37 20.12 18.19 19.07 18.08 19.69 17.44 18.05 19.18 18.99 18.64 19.35 19.6 19.26 18.75 18.37 17.92 18.88 19.12 17.8 18.99 19.32 Q62797 Ptpro 4 170.1640071 50677 + 170.1640071 170.374898 protein-tyrosine-phosphatase None LQHIRDHEFVDILGLVSEMR None 600579 21564 16.34 14.29 15.83 16.1 17.06 18.37 15.9 14.8 15.17 16.45 15.81 16.52 16.8 16.43 15.92 16.44 16.0 16.27 17.28 15.83 16.76 16.06 16.39 16.55 17.55 16.69 17.02 16.18 15.72 17.2 16.24 F1M3L7 Eps8 4 170.3887911 312812 - 170.3887911 170.507296 epidermal growth factor receptor kinase substrate 8 None QDMILQVDDRAVSLIDLESK None 600206 3272 16.74 16.29 18.72 17.48 16.36 16.89 18.12 16.44 17.52 17.73 17.41 17.06 18.18 18.14 16.28 16.93 18.46 16.68 18.36 17.78 18.11 18.16 16.51 17.77 16.86 17.03 18.27 17.52 15.65 18.46 18.63 Q5XIG8 Strap 4 170.6460491 297699 + 170.6460491 170.656319 serine-threonine kinase receptor-associated protein None GIKKALWCSEDKQILSADDK None 605986 43881 20.68 19.85 20.25 18.39 20.33 19.16 20.67 19.36 18.66 20.65 20.1 19.42 19.99 20.55 19.32 19.57 19.36 18.66 20.42 21.17 20.21 20.2 19.8 20.69 20.42 19.37 19.65 19.04 19.69 20.36 19.86 F1M1H0 Dera 4 170.6636881 690945 + 170.6636881 170.742464 2-deoxy-d-ribose 5-phosphate aldolase None CRIPVASVATGFPAGQTHLK None None 14562 15.97 14.22 14.56 15.36 16.23 15.03 15.37 16.35 13.77 14.32 15.21 15.31 14.78 13.95 14.52 15.48 14.48 15.72 15.4 14.77 14.6 14.14 14.65 14.45 16.31 15.98 14.91 15.1 15.8 15.26 15.82 P08011 Mgst1 4 171.0296161 171341 + 171.0296161 171.044891 microsomal glutathione s-transferase 1 None FQRLTNKVFANPEDCAGFGK None 138330 10544 15.26 15.77 15.89 16.45 17.04 16.91 17.4 17.14 17.02 16.91 16.7 17.06 16.9 15.77 17.03 16.44 16.02 16.57 16.65 15.81 16.11 16.12 17.03 15.98 15.16 15.93 16.1 15.83 16.93 16.34 16.53 M0RCV0 Strap 4 170.6461791 100910575 + 170.6461791 170.655616 serine-threonine kinase receptor-associated protein-like None VKTVDFTQDSNYLLTGGQDK None None None 20.52 21.94 20.11 18.47 20.27 19.17 20.7 19.25 18.41 20.45 19.84 19.6 19.42 20.44 19.64 19.57 19.18 19.06 19.56 20.46 20.08 20.07 19.12 20.24 20.4 19.62 20.3 19.11 19.21 19.69 19.25 E9PTG5 Plekha5 4 173.3340691 246237 + 173.3340691 173.503547 pleckstrin homology domain-containing a5 None AFKAAHPNMRTYYFCTDTGK None None 10377 17.92 18.02 16.57 18.13 17.85 16.94 16.73 17.1 18.68 18.19 17.52 17.47 17.25 17.83 17.75 17.75 18.83 17.67 17.59 16.02 18.16 17.65 18.42 18.46 17.54 18.27 17.8 17.06 18.19 16.62 17.68 G3V795 Slco1c1 4 174.4666491 84511 + 174.4666491 174.513349 solute carrier organic anion transporter family member Bsat1; Oatp14; Slc21a14 None None None None 17.99 17.81 17.03 17.18 16.83 17.15 15.7 16.33 17.04 17.75 18.07 16.72 16.99 17.72 17.76 17.46 17.7 17.15 17.25 15.54 17.11 16.73 17.59 17.79 16.44 17.32 16.89 17.23 18.13 15.9 15.71 Q9EPZ7 Slco1c1 4 174.4666491 84511 + 174.4666491 174.513349 solute carrier organic anion transporter family member 1c1 None ENAHLFHKNSAQPAGGPSFK None 613389 23008 17.99 17.81 17.03 17.18 16.83 17.15 15.66 16.33 17.04 17.75 18.07 16.72 16.99 17.72 17.76 17.46 17.7 17.15 17.25 15.54 17.11 16.73 17.59 17.88 16.44 17.32 16.91 16.94 18.2 15.9 15.71 P42123 Ldhb 4 175.4283861 24534 - 175.4283861 175.446416 l-lactate dehydrogenase b chain None GLTSVINQKLKDDEVAQLRK None 150100 55647 25.27 25.42 25.15 23.92 25.92 23.76 24.81 25.25 24.6 24.92 22.83 23.32 23.57 23.44 22.67 23.61 23.74 24.7 24.48 25.45 23.91 24.05 23.84 23.35 24.59 24.7 23.44 24.38 25.2 24.0 25.01 Q63563 Abcc9 4 175.5318431 25560 - 175.5318431 175.649038 atp-binding cassette sub-family c member 9 Sur2 None None None None 15.81 16.79 14.74 15.83 15.85 16.64 15.88 15.14 16.65 16.26 16.17 16.14 15.36 16.36 16.74 16.54 15.64 16.47 15.38 15.79 16.63 15.9 16.27 16.08 15.75 16.65 14.92 16.35 17.29 16.03 15.91 P69060 Cmas 4 175.7188091 312826 + 175.7188091 175.737127 n-acylneuraminate cytidylyltransferase None SEIQKGVREVTEPLNLNPAK None 603316 7670 18.19 18.08 18.12 19.34 18.65 18.1 18.82 19.13 17.94 17.88 17.84 18.58 19.41 17.99 19.92 18.61 18.85 18.77 17.97 19.02 17.94 18.42 18.1 18.4 19.44 19.94 19.56 18.96 17.3 18.32 20.49 Q5M963 Cmas 4 175.7188091 312826 + 175.7188091 175.737127 cmp-n-acetylneuraminic acid synthase None LCWKEVAYLGNEVSDEECLK None 603316 7670 18.19 18.08 18.12 19.31 18.64 18.11 18.8 19.1 17.94 17.88 17.84 18.58 19.41 17.99 19.95 18.6 18.74 18.83 17.78 19.07 18.0 18.42 18.1 18.57 19.44 19.94 19.58 19.05 17.16 18.32 20.49 A0A0G2K543 C2cd5 4 175.9695451 362461 - 175.9695451 176.055599 c2 calcium-dependent domain-containing 5 None WNSFNSDEPETRDAWWAEIR None None None 17.6 17.62 17.61 17.95 16.33 18.49 17.6 18.15 17.01 18.24 17.84 17.22 18.07 16.97 18.39 18.28 18.76 17.6 17.49 16.22 17.48 18.1 17.88 17.97 16.79 18.67 18.22 18.24 16.49 17.55 17.7 D4A5B3 C2cd5 4 175.9695451 362461 - 175.9695451 176.055599 c2 calcium-dependent domain-containing 5 None AVLSPRFLQEGTVEGCLEQR None None None 17.63 18.12 17.63 18.02 16.4 18.5 17.67 18.2 17.14 18.3 17.77 17.25 17.96 17.02 18.53 18.32 18.9 17.54 17.43 16.36 17.55 18.22 17.79 18.11 16.85 18.83 18.21 18.27 16.53 17.5 17.62 D3ZXB8 Etnk1 4 176.1261811 312828 + 176.1261811 176.170306 ethanolamine kinase 1 None RSYLEAYKEYKGFGSDVTEK None 609858 10240 17.5 15.91 16.76 18.11 16.22 17.23 18.15 15.6 16.53 16.66 18.06 17.73 17.87 17.77 17.06 16.38 17.82 16.44 16.08 18.33 17.53 16.78 17.88 16.73 17.17 16.62 16.28 17.68 16.37 17.14 16.49 P54690 Bcat1 4 177.9648381 29592 - 177.9648381 178.123944 branched-chain-amino-acid aminotransferase, cytosolic None EMFGSGTACVVCPVASILYK None 113520 20320 22.33 19.56 21.41 21.2 21.7 21.43 22.32 21.2 20.23 21.19 22.77 20.31 21.41 20.8 20.18 21.26 21.44 21.64 20.49 22.37 20.53 21.26 21.51 20.53 21.67 21.19 20.92 21.0 21.0 21.92 20.59 P08644 Kras 4 178.1889661 24525 - 178.1889661 178.218443 gtpase kras None SALTIQLIQNHFVDEYDPTIEDSYRK None 190070 37990 19.58 19.16 20.06 19.87 18.86 18.65 19.54 19.73 19.97 20.76 18.04 19.7 20.26 19.68 19.24 19.57 19.71 20.2 19.18 20.21 20.27 20.11 19.91 19.19 18.83 20.33 18.81 19.61 21.03 20.13 19.87 F1LQR8 Itpr2 4 179.143141 81678 - 179.143141 179.327286 inositol 1,4,5-trisphosphate receptor type 2 None None None None 19.05 19.83 18.92 19.11 20.21 19.5 19.21 19.57 20.48 19.26 18.87 20.67 20.08 20.15 20.98 19.39 18.99 19.54 20.42 18.64 20.69 19.47 19.35 19.01 19.39 19.87 20.19 20.72 19.75 19.52 20.8 P29995 Itpr2 4 179.143141 81678 - 179.143141 179.327286 inositol 1,4,5-trisphosphate receptor type 2 None GPESYVAQMITEKNLDWFPR None 600144 37593 19.53 20.0 19.27 19.33 20.38 19.74 19.5 19.83 20.75 19.58 19.2 20.92 20.24 20.44 21.29 19.64 19.17 19.84 20.66 18.96 21.0 19.83 19.53 19.17 19.61 20.0 20.49 20.99 19.96 19.72 21.27 D4A6N9 Ints13 4 179.4605591 690728 - 179.4605591 179.491472 integrator complex subunit 13 None RLKGILERGKEELAEAEVIK None None None 16.07 13.46 16.09 15.45 15.24 15.85 15.34 16.31 15.1 13.87 16.22 15.1 15.69 15.62 14.32 16.77 15.55 16.65 15.84 15.26 15.37 14.97 15.28 14.6 16.71 15.87 15.6 15.24 17.03 16.57 16.36 Q6TA25 Fgfr1op2 4 179.4916051 362463 + 179.4916051 179.512622 fgfr1 oncogene partner 2 homolog None ENKGLREILQITRESFLNLR None None 9222 18.14 16.88 16.16 17.72 17.03 17.08 17.03 17.0 16.76 17.11 17.83 16.9 17.9 17.42 16.7 17.8 18.2 17.15 16.88 17.49 17.07 17.14 17.49 17.13 18.06 18.39 17.02 16.68 18.72 17.77 16.21 A4GW50 Stk38l 4 179.6347181 691337 + 179.6347181 179.693182 rcg29601 None GLDDFESLKVIGRGAFGEVR None None 56299 19.79 17.19 18.78 17.77 18.52 18.09 18.86 19.02 17.99 17.73 19.41 17.14 17.84 17.24 18.35 19.26 18.92 18.29 18.47 17.63 17.43 18.4 18.31 18.48 19.61 18.23 18.91 18.74 16.51 18.82 18.18 A0A0G2K781 Ppfibp1 4 179.8088561 312855 + 179.8088561 179.951428 ppfia-binding protein 1 None LVCKTKGEGVEILDRDENIK None None 2685 16.24 13.93 16.21 16.08 14.58 15.11 16.59 16.64 15.66 15.18 17.86 16.0 16.59 16.39 16.28 15.43 16.45 16.09 16.33 14.86 16.46 16.75 16.15 14.89 16.19 15.57 15.72 15.78 16.31 16.24 16.61 D4A9Z6 Mrps35 4 179.9580841 297727 + 179.9580841 179.988752 mitochondrial ribosomal protein s35 None ARAVTLRVKLSSLNLDNHAK None 611990 11048 18.35 16.07 16.93 18.3 18.84 17.15 18.08 16.93 18.34 17.69 17.67 17.63 18.63 18.29 19.1 17.23 18.0 17.57 17.91 18.4 19.3 16.96 17.08 17.04 18.48 18.65 17.92 16.93 19.62 19.06 18.54 Q6AY97 Ccdc91 4 180.4023771 312863 + 180.4023771 180.574364 coiled-coil domain-containing protein 91 None ISSPDDTRADSSLVNQTISK None None 10131 17.97 18.95 17.75 17.46 18.39 17.67 17.6 18.2 16.67 16.71 18.93 17.47 17.7 16.24 16.64 17.88 18.35 18.22 17.42 18.0 17.85 16.79 16.54 17.12 17.85 17.39 17.73 16.9 18.13 17.53 16.91 A0A0G2JYN4 Ergic2 4 181.0920291 297728 - 181.0920291 181.12306 ergic and golgi 2 None IMEFSVYQDTWMKYEYEVDK None None None 17.01 16.32 15.77 16.95 15.4 15.82 16.38 15.32 16.65 16.29 17.66 16.19 16.23 16.12 17.11 17.39 16.35 16.68 16.34 16.18 16.05 17.52 16.42 16.51 16.22 16.19 16.34 16.51 16.05 17.57 14.89 D3ZX01 Rps4y2 4 181.2695081 690845 + 181.2695081 181.27044 40s ribosomal protein s4 None None None None 19.05 21.45 20.08 20.04 18.27 19.28 18.39 20.95 19.93 21.21 19.44 19.27 19.33 19.11 21.14 19.98 20.68 18.88 19.61 19.18 20.0 19.4 19.28 20.61 18.67 20.72 20.44 18.8 20.7 19.08 20.21 A0A0G2K6J6 Ipo8 4 181.7356651 - 181.7356651 181.792949 importin 8 None NFAPSLLRIIVSDHVEFPVR None None None 15.27 16.29 15.89 15.16 14.77 15.16 15.72 14.54 14.47 15.43 15.04 15.02 15.57 14.83 14.52 16.4 14.22 15.89 16.1 15.05 14.92 16.09 15.51 14.64 15.58 14.73 15.55 15.28 14.95 14.98 15.08 M0R5A9 Dennd5b 4 181.9619681 - 181.9619681 182.029466 dENN domain containing 5b None SETIARLQALAKRTGVTVGK None None None 16.65 16.64 18.21 18.33 16.38 15.12 17.35 16.98 17.71 17.0 16.33 16.61 15.95 17.29 17.48 16.97 16.88 17.81 17.96 15.57 17.9 17.48 17.59 17.51 17.42 17.84 17.36 17.73 16.17 17.36 18.42 D4ADZ2 Bicd1 4 182.4790711 362466 + 182.4790711 182.627434 bicd cargo adaptor 1 None QNELKQSRAVVTNVQAENER None None None 15.55 17.21 15.46 15.86 16.08 16.42 15.79 15.44 14.85 14.9 15.61 17.24 15.58 16.76 14.9 14.86 15.26 17.42 15.57 16.63 16.34 17.02 15.19 16.67 16.67 16.71 16.95 15.9 14.44 15.44 16.3 D4A5X7 Gdap1 5 1.9325641 312890 - 1.9325641 1.951666 ganglioside-induced differentiation-associated-protein 1 None CEEHDVSLPLSEHNEPWFMR None 606598 40713 20.04 21.8 19.35 19.87 20.61 19.86 19.85 19.09 20.42 21.35 18.97 19.03 19.65 19.85 19.49 20.4 19.9 19.52 19.45 21.01 18.84 19.56 19.25 19.65 19.4 20.81 19.13 19.7 21.09 19.17 19.75 D3ZQ55 Jph1 5 2.0302821 297748 + 2.0302821 2.125284 junctophilin None EGAQRAAAMARTKVEIANSR None 605266 10761 16.53 16.65 16.48 16.69 16.92 17.33 16.05 16.5 17.42 16.09 16.9 17.2 16.91 16.78 17.97 18.09 17.13 16.74 16.82 15.58 16.92 15.49 17.58 17.34 17.07 16.94 17.01 17.56 16.92 15.9 16.37 P83941 Eloc 5 2.6615281 64525 + 2.6615281 2.677887 elongin-c None AMLSGPGQFAENETNEVNFR None 600788 38083 19.25 17.18 19.11 17.52 18.19 18.42 18.36 18.45 18.34 19.02 19.51 18.43 18.64 19.14 18.54 17.19 18.73 18.67 17.91 19.31 19.39 18.82 18.42 18.63 18.59 16.86 18.89 18.09 18.23 18.96 19.12 Q68SB1 Stau2 5 2.8490331 171500 + 2.8490331 3.084451 double-stranded rna-binding protein staufen homolog 2 None KRNMPVSFEVIKESGPPHMK None 605920 8666 17.8 15.23 15.78 17.86 16.66 16.2 15.17 14.7 16.36 15.62 17.42 17.14 17.12 16.49 17.28 16.42 17.73 16.2 16.29 14.99 16.96 16.59 16.69 17.64 18.19 16.25 16.83 16.05 17.15 16.82 16.3 A0A0G2K703 Stau2 5 2.8676471 + 2.8676471 2.988841 staufen double-stranded RNA binding protein 2 None SPTPPCSSVQPSKQLEYLAR None None None 17.91 15.43 15.87 18.22 17.01 16.35 15.17 15.4 16.37 15.53 17.1 17.15 16.82 16.2 17.47 16.89 17.29 16.06 16.59 15.07 16.06 15.87 16.56 17.63 18.23 16.48 17.05 15.68 17.1 16.78 16.66 P05426 Rpl7 5 3.216381 297755 + 3.216381 3.223688 60s ribosomal protein l7 None RGGMKKKTTHFVEGGDAGNR None 604166 87772 20.85 21.44 20.61 20.76 20.17 20.69 18.94 19.44 20.42 21.63 20.27 20.22 19.52 20.41 21.5 20.35 20.82 20.19 19.78 20.08 21.58 20.91 20.44 21.5 20.26 20.76 21.01 19.47 20.92 19.87 20.34 Q6TXJ0 Rps8 5 3.3892111 297756 - 3.3892111 3.3935 40s ribosomal protein s8 None RKPYHKKRKYELGRPAANTK None None None 19.2 18.15 19.55 19.2 18.75 19.18 17.79 17.6 19.25 19.32 20.12 19.57 19.38 19.29 20.2 18.82 20.04 17.98 19.05 18.43 20.26 19.93 19.71 20.02 18.47 18.4 19.05 18.14 20.14 19.15 18.75 Q63099 Kcnb2 5 1.0 + 1.0 1.0 potassium voltage-gated channel subfamily b member 2 None SFTEIDTGEDEDFLDLQRPRPDK None None None 15.68 13.43 16.09 16.3 14.74 15.49 14.81 15.38 15.18 14.73 15.43 16.32 15.57 15.43 15.14 14.75 15.4 15.9 16.46 14.58 16.48 15.85 15.86 14.59 14.89 15.62 15.59 15.61 16.41 15.3 16.23 Q561R9 Lactb2 5 5.5690811 297768 + 5.5690811 5.591841 endoribonuclease lactb2 None IITVFRDNLEESFSVSELRK None None 9349 18.35 15.53 18.63 17.74 18.27 17.95 18.81 17.85 17.3 16.81 18.4 17.28 18.32 17.46 16.81 17.61 17.7 17.73 17.77 19.44 17.53 17.79 18.21 16.82 19.06 17.72 18.42 17.61 17.37 18.42 18.42 Q9WUI9 Ncoa2 5 5.9879741 83724 + 5.9879741 6.065865 nuclear receptor coactivator 2 None KHKILHRLLQDSSSPVDLAK None 601993 4768 15.8 13.33 15.52 14.62 15.0 15.57 14.84 14.97 15.77 15.23 14.91 15.58 15.1 14.74 15.08 14.92 15.49 15.02 15.1 14.7 16.8 15.24 14.92 15.22 14.22 14.4 15.33 16.24 13.68 15.17 16.19 A0A0G2KA11 Prex2 5 7.9046641 312912 - 7.9046641 8.265422 phosphatidylinositol-3,4,5-trisphosphate-dependent rac exchange factor 2 None TEMLMCGVLMKISSGNIQER None 612139 None 16.9 16.7 16.95 17.43 17.06 17.65 18.19 16.85 18.46 17.27 16.52 18.7 18.3 19.08 18.76 16.63 17.8 16.37 18.39 16.76 18.04 17.96 17.77 17.16 17.96 16.98 17.86 18.39 16.27 17.62 18.76 D4A631 Arfgef1 5 8.9820621 312915 + 8.9820621 9.076326 brefeldin a-inhibited guanine nucleotide-exchange protein 1 None ETKELTIPTKSTKQNVASEK None 604141 4687 19.43 18.43 19.44 18.74 18.32 17.97 18.42 18.92 19.15 18.03 19.32 17.94 18.63 18.55 19.56 18.19 19.07 18.91 19.26 17.02 20.39 18.48 18.72 19.07 19.11 19.07 19.0 18.92 18.5 18.34 19.34 F7EUU4 Cops5 5 9.1921951 312916 + 9.1921951 9.210495 cop9 signalosome subunit 5 None QSEAQLGRGSFMLGLETHDR None None 55992 20.56 19.47 19.46 19.04 18.81 20.83 20.02 19.83 17.92 18.9 19.79 18.97 19.3 19.09 18.55 19.27 19.32 19.59 18.33 20.85 19.26 19.34 19.17 18.98 19.53 20.1 19.7 18.12 19.04 19.75 19.02 Q8CF97 Vcpip1 5 9.5340521 286761 + 9.5340521 9.561002 deubiquitinating protein vcpip1 None MDKHLRDQSTEQTPSDLSQR None None 11814 18.9 16.46 17.73 17.53 17.68 19.94 18.09 16.6 18.21 17.91 18.27 19.07 18.71 18.37 18.77 18.43 18.87 17.89 18.8 16.68 18.89 19.4 18.71 18.4 17.54 18.03 18.5 18.47 17.76 18.67 18.38 Q4QQW3 Adhfe1 5 9.7059691 362474 - 9.7059691 9.732635 hydroxyacid-oxoacid transhydrogenase None AANLYACSPHSEFLDYVNAPIGK None 611083 5865 18.76 16.75 18.18 17.98 17.89 17.58 17.23 18.71 16.68 17.56 19.11 17.0 17.05 17.25 17.4 17.89 16.43 19.35 17.49 18.1 17.45 16.99 19.0 18.6 18.38 18.32 17.92 16.32 18.6 18.64 16.91 D3ZHK4 Rb1cc1 5 13.1616491 312927 - 13.1616491 13.22556 rb1-inducible coiled-coil 1 None AVEIRNIIDKVKCSLEITLK None 606837 7659 17.91 16.49 17.97 19.16 17.13 18.2 17.63 17.73 18.19 17.54 17.85 18.15 18.84 18.64 19.53 18.67 19.19 17.89 17.83 17.05 18.14 19.3 18.81 18.97 19.47 19.34 18.62 18.73 17.42 18.47 18.66 A0A0G2K9J2 Atp6v1h 5 14.3790291 297797 - 14.3790291 14.484703 v-type proton atpase subunit h None GEYVRHYPRGKRVIEQLGGK None None 7139 21.96 22.43 20.94 20.78 19.78 21.26 20.51 21.09 21.04 21.89 20.09 20.94 21.31 22.45 21.36 20.9 20.92 22.36 21.27 19.97 21.16 21.4 21.39 21.75 21.61 22.47 22.51 20.19 21.29 20.84 20.88 G3V716 Rgs20 5 14.535931 362477 + 14.535931 14.615025 regulator of g-protein-signaling 20 None None None None 17.32 17.18 16.99 17.4 16.89 16.73 17.99 15.41 17.68 18.43 17.4 16.33 17.29 17.71 17.03 16.63 16.59 16.62 18.6 16.57 18.18 17.29 17.64 16.28 15.63 17.53 16.76 16.56 17.06 16.78 16.61 Q4KLL0 Tcea1 5 14.6314551 362479 - 14.6314551 14.668704 transcription elongation factor a protein 1 None NPNLRKNVLCGNIPPDLFAR None 601425 55984 18.0 17.08 18.42 17.89 18.14 16.9 18.16 17.83 18.2 18.08 17.29 17.63 18.21 18.68 17.25 16.74 17.54 18.06 18.3 19.14 19.57 18.01 18.23 17.94 19.16 17.74 18.23 17.68 18.35 18.36 19.49 P70470 Lypla1 5 14.6796111 25514 - 14.6796111 14.708698 acyl-protein thioesterase 1 None GSLTVERLKGLVNPANVTFK None 605599 100781 17.53 19.84 17.69 18.56 18.28 17.28 18.39 19.34 18.67 19.16 16.93 18.0 17.45 17.28 17.37 17.87 16.76 18.4 17.68 19.01 16.52 17.24 17.19 16.95 16.81 17.94 17.17 18.21 18.26 17.12 18.01 A0A0G2K9B4 Mrpl15 5 14.7299861 297799 + 14.7299861 14.741276 39s ribosomal protein l15 None WIVNMADKKILKPTDENLLK None 611828 32210 17.72 15.36 16.82 17.61 17.07 17.75 15.37 18.27 17.63 16.0 16.92 17.38 16.43 15.8 17.48 17.47 16.19 16.77 17.4 16.64 15.83 16.29 17.31 17.04 17.95 15.96 18.25 17.62 16.72 17.73 17.18 Q5GH59 Xkr4 5 15.8963511 297801 - 15.8963511 16.281359 xk-related protein 4 None PTAPPTPSSRPPRIEESVIK None None 45848 17.77 17.13 17.32 18.23 17.02 17.48 17.73 18.11 18.03 18.03 17.03 17.84 18.39 17.69 17.79 17.74 18.25 16.8 18.48 16.86 18.14 17.26 18.22 18.55 16.91 18.45 17.42 18.66 16.04 17.16 17.39 D3ZF19 Tmem68 5 16.4940551 312946 - 16.4940551 16.524825 transmembrane protein 68 None TFLGDPIPYDPEVTAEELAEK None None 12440 16.4 14.09 15.3 17.18 16.58 15.1 16.59 16.22 15.7 15.74 15.65 16.63 16.67 16.2 16.28 17.05 16.18 17.41 15.66 15.09 14.59 15.75 17.12 15.97 17.74 17.13 15.66 16.22 16.46 16.82 16.56 Q07014 Lyn 5 16.6395131 81515 + 16.6395131 16.755501 tyrosine-protein kinase lyn None KAKSLSSKREGFIPSNYVAK None 165120 55649 17.74 16.41 18.84 17.4 18.03 16.81 17.39 17.22 18.72 18.43 18.26 17.47 18.46 18.42 19.11 17.16 17.5 17.88 18.32 16.82 19.88 18.07 18.08 17.79 17.77 16.71 18.68 19.51 16.69 17.98 19.24 P60868 Rps20 5 16.8193441 100359951 - 16.8193441 16.82017 40s ribosomal protein s20 None TPVEPEVAIHRIRITLTSRN None None None 18.67 18.05 17.78 19.48 19.68 18.33 17.31 19.16 17.96 17.7 17.77 19.04 18.97 17.95 19.77 19.67 18.8 18.29 18.29 18.54 17.24 17.98 18.23 19.99 19.87 19.93 19.12 17.93 19.1 18.13 20.38 P04094 Penk 5 17.1838071 29237 - 17.1838071 17.189224 proenkephalin-a None LVRPGDINFLACTLECEGQLPSFK None None None 18.95 17.19 18.25 18.84 17.11 17.38 18.77 18.0 16.57 17.61 18.43 16.37 17.27 17.15 18.43 17.47 18.22 16.19 16.85 17.83 16.18 18.49 17.12 16.7 17.16 17.91 17.36 17.23 17.5 17.95 17.47 Q5BJX5 Fam110b 5 18.9268691 500400 + 18.9268691 18.928501 protein fam110b None VAAMKSPDADQVEPACGVSR None None 17518 15.99 16.54 16.23 15.95 15.87 16.62 15.91 16.12 15.81 16.65 16.48 15.35 16.25 15.32 15.57 17.74 17.05 16.95 15.25 15.59 15.61 16.13 15.82 16.81 15.11 17.1 15.45 16.18 16.28 15.15 16.07 P0C627 Ubxn2b 5 19.3028351 312965 + 19.3028351 19.329374 ubx domain-containing protein 2b None TNAQFLESVKRGEIPLELQR None None None 15.39 16.32 15.65 17.12 14.62 16.13 17.68 16.53 16.66 15.45 14.63 15.94 15.29 16.98 16.03 15.49 16.58 14.04 16.47 16.55 15.38 15.36 17.68 15.54 16.99 16.52 15.13 15.76 15.06 15.04 15.15 Q9JI92 Sdcbp 5 19.4900021 83841 + 19.4900021 19.517169 syntenin-1 None NGLLTDHHICEINGQNVIGLK None None 4110 16.32 17.45 15.35 16.68 17.52 15.6 15.57 17.02 15.37 15.57 16.57 16.58 16.13 16.18 17.32 16.57 16.44 16.89 14.92 16.2 15.18 15.79 15.68 16.49 16.72 17.61 16.99 16.03 16.79 15.83 16.2 D4A1U5 Tox 5 19.8749951 362481 - 19.8749951 20.171272 thymocyte selection-associated hmg box gene, isoform cra_b None DTQAAIKGQNPNATFGEVSK None 606863 8822 16.04 17.9 16.81 16.81 16.76 15.47 15.27 16.32 17.1 16.54 14.87 16.41 15.84 16.55 16.5 17.12 16.76 15.57 15.91 17.21 15.79 15.86 15.68 16.52 15.52 17.04 16.58 16.14 17.04 16.62 16.74 Q5PPN4 Ca8 5 21.3053821 297814 - 21.3053821 21.413373 carbonic anhydrase-related protein None TWILFRYPLTISQLQIEEFR None None 20861 17.91 17.47 17.65 17.92 18.64 18.34 18.81 18.31 19.12 17.79 17.87 19.37 19.03 18.87 18.65 17.66 16.67 18.44 19.4 18.97 19.37 18.26 18.41 17.37 17.95 18.22 18.7 18.6 18.46 18.51 19.37 F1LP82 Rab2a 5 21.6762381 65158 + 21.6762381 21.738833 ras-related protein rab-2a None TRSYYRGAAGALLVYDITRR None 179509 20628 22.25 22.1 21.54 21.04 20.23 21.53 21.94 20.94 21.09 22.18 20.03 21.22 21.57 21.83 21.25 21.14 21.34 20.65 20.43 21.71 21.3 21.39 20.27 20.51 21.09 21.22 19.95 21.81 21.9 21.05 21.29 P05712 Rab2a 5 21.6762381 65158 + 21.6762381 21.738833 ras-related protein rab-2a None EEGEAFAREHGLIFMETSAK None 179509 20628 22.16 22.23 21.5 20.93 20.37 21.41 21.56 20.74 21.08 22.16 20.02 21.22 21.52 21.69 21.59 21.61 21.73 20.27 20.61 21.22 21.4 21.36 20.28 20.72 21.08 21.25 19.96 22.14 21.89 21.09 21.32 D3ZAP7 Chd7 5 21.8738751 312974 + 21.8738751 21.994016 dna helicase None FVASGNRTDISLDDPNFWQK None 608892 19067 16.33 14.64 16.75 14.96 17.04 16.66 17.26 16.85 16.81 14.96 16.66 16.47 16.56 16.61 18.09 15.6 16.15 15.84 16.71 15.87 17.23 16.78 16.81 15.6 17.18 16.95 15.54 17.15 16.68 17.09 17.41 A6JFQ6 Clvs1 5 22.4083511 366311 + 22.4083511 22.602187 clavesin-1 None LLLFAANWDQSRNSFTDILR None None None 18.68 17.07 18.75 18.11 18.18 17.67 18.19 17.39 18.82 19.0 17.1 17.17 18.04 18.23 19.22 17.67 18.14 17.43 18.03 17.22 19.47 18.59 17.85 17.91 17.98 17.81 18.64 19.21 16.92 17.49 19.84 A0A096MKE0 Asph 5 22.6015661 312981 - 22.6015661 22.814132 aspartate-beta-hydroxylase None None None None 17.19 15.74 17.26 16.7 16.93 17.07 17.25 17.2 17.6 16.33 17.01 17.8 17.69 17.81 17.93 16.19 15.74 17.38 17.47 17.45 18.58 17.22 17.17 16.78 17.32 16.7 17.94 17.62 16.26 17.75 18.38 A0A0G2K2B5 Asph 5 22.6015661 312981 - 22.6015661 22.814132 aspartate-beta-hydroxylase None SAKKVYEEVLNVTPNDGFAK None 600582 20910 17.32 16.15 17.43 16.85 17.09 17.29 17.26 17.35 17.61 16.37 17.18 17.92 17.81 17.96 18.12 16.34 15.88 17.55 17.61 17.57 18.73 17.38 17.13 16.97 17.72 16.95 18.08 17.77 16.56 17.85 18.66 Q6AY71 Mgc94199 5 23.9967541 362483 + 23.9967541 24.015563 protein c8orf37 homolog None KEDDLDSLINEIFEEPNFDK None None 18641 17.28 17.4 18.37 19.08 16.81 17.23 18.21 17.61 17.49 16.49 17.33 16.37 17.21 17.02 16.76 17.69 17.48 17.06 17.83 18.39 17.05 18.25 18.25 15.85 18.15 18.44 18.3 17.46 17.44 16.68 17.2 F1M1I3 Rgd1559441 5 24.722691 500410 + 24.722691 24.772155 similar to mic2l1 None LEEAYMKGENLEAVVCEEPR None None 135743 17.61 17.15 18.08 19.03 17.81 19.37 20.08 18.29 19.12 19.24 18.69 18.64 19.22 18.83 19.55 18.71 17.46 17.48 19.56 18.04 18.13 18.03 19.68 17.6 16.75 18.24 18.55 17.94 17.78 18.42 17.96 D3ZKC9 Virma 5 24.9611471 313061 + 24.9611471 25.023525 vir-like m6a methyltransferase-associated None GAIEASLKLTELLDLYHEDR None None 41043 15.22 15.24 16.07 15.83 14.93 15.94 16.29 14.84 16.41 14.86 14.94 15.81 14.65 16.1 14.91 14.61 16.29 15.12 15.57 15.94 17.18 16.08 15.8 15.99 15.69 14.95 15.89 15.13 14.59 16.26 15.97 A0A0G2QC17 Pdp1 5 25.448221 54705 - 25.448221 25.455057 protein phosphatase 2c, magnesium dependent, catalytic subunit, isoform cra_a None NVSSILGFDSNQLPANAPIEDR None 605993 None 18.51 19.7 17.55 17.75 18.33 18.21 18.11 16.79 18.46 18.78 17.79 17.37 17.44 18.18 16.74 18.55 18.61 17.66 17.74 19.17 17.91 19.25 17.54 18.26 19.09 18.7 18.15 17.05 19.06 17.35 17.61 O88483 Pdp1 5 25.448221 54705 - 25.448221 25.455057 [pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1 None THLIRHAVGNNEFGAVDHER None 605993 None 18.28 19.75 17.52 17.57 18.17 18.44 18.42 16.68 18.51 18.72 17.52 17.29 17.28 18.12 16.56 18.44 18.54 17.63 17.69 18.97 17.83 19.09 17.36 17.8 18.68 18.44 17.89 17.1 19.12 17.25 17.6 D3ZP87 Fam92a 5 25.6141811 297903 - 25.6141811 25.632362 family with sequence similarity 92 member a None TAAYQNIQKIDEDEDLEVFR None None 12234 15.64 14.57 16.11 15.44 15.32 16.17 16.81 15.33 15.32 15.6 16.6 15.73 16.87 15.98 16.81 15.33 16.28 15.0 15.96 16.29 16.2 16.22 16.28 16.51 16.07 15.63 15.49 14.47 15.88 16.79 15.43 D3ZGY2 Otud6b 5 28.1973241 297911 - 28.1973241 28.214187 ubiquitinyl hydrolase 1 None KIDSVAVNVSNLVLDSQPPR None None None 18.68 16.13 19.16 18.45 17.64 19.5 19.33 18.83 18.42 17.6 18.02 17.73 18.67 17.43 17.23 19.17 17.7 18.14 17.59 19.53 16.54 18.53 18.52 18.45 17.72 17.02 18.02 17.35 17.5 18.25 18.33 Q4V888 Pip4p2 5 28.2596011 362490 + 28.2596011 28.307225 type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase None GKLHQHVVKCTVCNEATPIK None 609864 23117 14.78 14.94 15.6 15.57 15.12 17.09 16.06 15.66 16.44 16.98 15.51 16.54 16.81 16.12 15.51 15.68 16.16 16.18 16.98 15.31 17.26 16.36 16.96 17.27 14.81 15.44 15.19 16.65 15.3 15.89 15.43 Q9ESB5 Necab1 5 28.3548221 64169 - 28.3548221 28.578805 n-terminal ef-hand calcium-binding protein 1 None ETLNQLQSLQNSLECAMETTEEQTR None None 11172 17.95 17.33 18.66 18.3 17.03 18.88 19.38 16.97 18.4 18.57 17.84 17.23 18.25 18.58 17.42 18.17 18.21 17.67 17.48 19.13 17.73 19.14 19.31 18.03 17.02 17.52 18.29 16.9 17.23 17.22 17.0 P07171 Calb1 5 29.375661 83839 + 29.375661 29.400052 calbindin None MLKLFDSNNDGKLELTEMAR None 114050 21026 22.04 20.46 21.76 21.4 22.44 21.48 22.43 22.05 22.29 21.28 21.12 22.45 22.31 22.07 21.29 21.36 20.35 22.7 22.67 22.52 22.63 21.6 21.51 20.85 21.97 22.0 22.05 22.46 21.64 22.3 23.33 Q64591 Decr1 5 29.4111781 117543 - 29.4111781 29.439028 2,4-dienoyl-coa reductase None VIASRNIDVLKATAEEITSK None 222745 68178 18.16 17.45 19.6 19.67 17.74 19.63 19.61 17.61 18.71 17.57 17.65 17.64 19.42 17.63 19.07 19.81 17.3 17.71 19.31 19.85 17.84 19.38 19.64 18.19 20.01 18.31 19.86 17.45 17.88 18.61 18.52 G3V783 Ripk2 5 29.6308411 362491 - 29.6308411 29.663002 receptor-interacting serine/threonine-protein kinase 2 None LLHHDLKTQNILLDNEFHVK None None 37856 17.82 15.19 17.68 17.53 16.58 15.72 17.33 18.39 17.78 16.08 18.95 16.94 17.88 17.97 18.72 16.31 16.29 16.96 17.67 16.43 17.57 17.44 17.35 17.4 17.31 16.73 17.38 16.88 16.97 17.99 17.46 Q3B7U1 Maged2 5 19.7335971 113947 - 19.7335971 19.741769 mage family member d2 None KEYTDVYPEIIERAGYSLEK None 300470 12750 17.25 16.08 18.38 18.58 17.29 17.22 18.07 17.93 17.31 17.9 18.17 16.53 17.65 16.43 18.05 17.23 16.5 17.5 17.96 16.79 17.36 17.22 16.25 17.71 16.6 16.92 17.81 17.27 15.95 17.78 18.43 D3ZLA3 Cpne3 5 33.0175061 313087 - 33.0175061 33.063953 copine 3 None YCNGIQGIIEAYRTCLPQIR None 604207 20839 19.42 18.43 19.79 19.17 19.6 17.09 19.24 19.11 18.79 19.18 18.75 18.0 19.44 18.71 19.86 19.36 18.3 18.37 19.69 18.83 18.94 19.04 19.08 19.22 19.12 19.76 18.92 18.63 18.94 18.46 19.57 Q4G069 Rmdn1 5 33.0703041 500419 + 33.0703041 33.127526 regulator of microtubule dynamics protein 1 None KVEEILEQADYLYESGETEK None None None 17.31 15.54 17.96 17.33 17.3 16.82 17.63 15.89 16.69 16.49 18.76 17.94 17.87 18.05 18.42 16.35 17.37 17.17 17.21 16.78 18.63 17.9 17.64 16.84 17.32 16.42 18.17 17.74 15.93 18.11 17.65 Q4V8H7 Wwp1 5 33.0984951 297930 - 33.0984951 33.153795 e3 ubiquitin-protein ligase None CIEKVGKDTWLPRSHTCFNR None 602307 21385 18.14 15.58 18.31 17.89 16.98 19.05 17.95 18.73 18.69 16.21 17.53 17.39 18.08 16.59 18.67 17.84 16.15 17.25 18.35 18.05 17.51 17.83 18.22 17.0 18.53 17.46 18.34 16.86 18.82 18.28 18.46 G3V8W9 Tstd3 5 35.2946071 500420 - 35.2946071 35.304131 similar to cg12279-pa None SKDIMLIDVRNTWEILEHGK None None None 18.54 18.57 18.18 18.43 18.49 19.14 19.25 18.06 18.47 18.44 17.88 17.39 18.25 17.7 18.91 19.31 16.63 18.35 18.91 18.72 17.19 17.91 19.49 17.87 20.08 17.93 19.12 17.6 17.41 18.16 17.89 F1MAQ8 Pnisr 5 35.3959661 297942 + 35.3959661 35.422844 pnn-interacting serine and arginine-rich protein None DTVNEKKRTPNEAPSVLEPK None None 32802 14.18 14.61 15.36 16.01 15.38 14.47 13.84 14.98 15.87 14.3 14.08 15.46 15.11 14.73 15.0 14.77 14.08 15.52 16.32 15.3 15.81 15.11 15.88 15.92 15.69 15.5 15.72 14.64 16.17 15.28 16.88 Q63159 Coq3 5 35.4295511 29309 + 35.4295511 35.460618 ubiquinone biosynthesis o-methyltransferase None VAENIKIAQHHKSFDPVLDK None None 9683 16.93 18.56 18.04 16.68 16.89 17.03 17.23 16.22 17.15 17.56 16.54 16.19 16.43 17.61 17.85 16.74 16.2 16.34 18.24 17.16 18.81 18.26 15.99 18.1 17.67 17.53 17.82 16.79 15.7 16.82 18.16 D3ZAT9 Faxc 5 35.4804031 366333 + 35.4804031 35.539741 failed axon connections homolog None SFYSRTETFEDEGAENSFSR None None None 15.82 13.2 14.93 16.35 15.91 14.62 15.42 14.15 15.45 15.73 13.89 14.34 14.95 14.18 14.98 15.78 15.62 14.97 14.42 15.56 14.57 14.42 15.21 14.69 15.71 16.18 13.97 15.29 15.4 15.22 16.26 B1WBR8 Fbxl4 5 35.9558471 313101 + 35.9558471 36.030215 f-box and leucine-rich repeat protein 4 None LEVNSSLLDYYTELDAVVLHGTK None 605654 8128 15.9 17.44 16.33 15.84 15.6 14.91 16.17 14.22 15.92 16.4 14.55 14.33 15.02 16.42 15.42 15.33 16.02 15.3 15.34 16.73 15.22 16.88 14.97 15.03 16.3 15.93 15.66 15.71 15.58 15.08 15.24 Q9NQR8 Ndufaf4 5 38.6051371 362495 + 38.6051371 38.611311 nadh dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 4 None DIPKGKITVVEALTLLNNHK None 611776 None 19.19 16.64 17.95 17.77 19.31 18.39 16.73 16.85 17.83 18.74 16.32 18.51 18.64 18.23 17.01 19.11 18.87 18.81 17.79 18.51 17.7 17.8 18.26 18.33 18.86 19.19 17.68 19.0 19.46 18.59 18.67 B2GV24 Ufl1 5 38.9614531 313115 - 38.9614531 38.995289 e3 ufm1-protein ligase 1 None NKIPEDQHTLLVKYQGLVVK None None None 18.17 16.31 19.16 16.53 17.52 17.73 17.45 17.11 17.83 18.04 18.98 17.24 18.24 18.4 18.33 16.99 18.42 17.59 18.4 16.28 19.02 18.5 16.96 18.92 16.7 16.65 18.05 18.22 16.53 18.07 19.32 Q99JB3 Fut9 5 39.3518191 84597 - 39.3518191 39.56513 4-galactosyl-n-acetylglucosaminide 3-alpha-l-fucosyltransferase 9 None ENYENYIPADSFIHVEDFNSPSELAK None 606865 4800 17.4 15.11 16.58 17.98 17.5 17.55 17.06 16.47 17.24 17.08 17.78 17.16 17.24 16.8 17.54 15.81 17.44 17.01 16.72 16.19 16.78 16.99 17.62 17.21 16.82 16.22 16.72 16.85 16.3 17.8 17.34 P54759 Epha7 5 42.9756191 171287 + 42.9756191 43.125054 ephrin type-a receptor 7 None EVCSGRLKLPGKRDVAVAIK None None 20935 16.77 17.34 17.63 17.66 17.66 19.21 17.01 16.95 18.32 18.24 17.78 18.83 18.73 18.13 17.8 18.9 18.4 18.49 18.05 16.91 18.67 17.42 19.0 18.78 17.1 17.64 17.41 18.5 18.41 17.21 17.24 A0A0G2K9L9 Mdn1 5 47.0554391 + 47.0554391 47.186565 midasin AAA ATPase 1 None RAWSHFLLTYRPKCLGEDGK None None None 15.52 15.49 15.22 15.56 15.65 16.98 15.0 15.33 16.58 16.48 15.76 16.55 15.39 16.76 16.7 16.63 16.28 14.98 14.94 16.85 15.4 16.33 15.8 14.76 14.41 15.7 16.76 16.5 16.68 16.19 16.76 B2RZ38 Rragd 5 47.3739031 297960 + 47.3739031 47.409363 ras-related gtp-binding protein None EVFIHKVDGLSDDHKIETQR None 608268 49667 18.14 16.75 18.0 18.2 17.26 18.58 18.21 17.08 17.81 17.66 18.73 17.97 18.3 18.5 18.36 17.17 18.11 17.56 18.33 16.57 18.34 18.92 18.27 18.83 16.92 17.4 16.71 16.94 18.42 18.21 18.07 D4ABY4 Ube2j1 5 47.4226361 297961 + 47.4226361 47.439435 ubiquitin-conjugating enzyme e2, j1 None RALAKKSQDFCCEGCGSAMK None None 41090 16.8 14.43 16.71 16.73 15.91 17.56 16.62 15.77 16.7 16.28 17.67 15.97 16.89 16.54 16.76 15.68 16.72 15.88 15.26 17.53 16.49 16.92 17.01 17.54 15.7 15.59 16.14 16.25 15.56 17.04 16.61 D4AAB5 Pm20d2 5 47.5698281 313130 - 47.5698281 47.585996 peptidase m20 domain-containing protein 2 None SELLYYFRAPSMKELHVLTK None None 19025 14.64 15.56 16.69 15.86 15.51 15.4 15.89 14.65 15.73 15.74 15.31 14.19 15.17 15.77 16.54 15.06 16.0 14.99 14.47 16.62 16.49 16.21 15.15 16.02 17.14 15.57 16.27 15.21 14.77 15.77 17.37 A0A0G2K2F4 Srsf12 5 47.6067071 297962 + 47.6067071 47.631516 serine and arginine-rich-splicing factor 12 None NRKWVCGRQIEIQFAQGDRK None None None 17.38 15.45 16.69 17.78 16.56 16.93 16.53 16.87 17.93 17.45 16.16 17.96 17.43 17.39 18.58 17.06 17.22 16.64 17.05 17.1 18.44 17.26 17.5 17.62 16.47 16.88 18.48 16.04 17.3 17.61 18.11 P20272 Cnr1 5 48.4120211 25248 + 48.4120211 48.434046 cannabinoid receptor 1 None IIIHTSEDGKVQVTRPDQAR None 114610 7273 17.45 18.52 17.98 18.24 18.58 18.61 18.31 18.37 19.01 19.36 16.78 18.79 18.6 18.39 19.77 18.53 18.65 17.99 18.65 16.97 18.49 18.24 18.38 18.53 17.76 18.49 18.66 19.22 17.74 17.6 18.96 Q66HC3 Rgd1359108 5 49.7679371 313155 - 49.7679371 49.784007 guanine nucleotide exchange c9orf72 homolog None GLFVQGLLKDATGSFVLPFR None None 10137 16.73 14.28 17.89 15.91 15.18 16.91 16.9 15.86 16.56 15.61 17.04 15.91 16.47 16.14 15.7 16.55 15.89 17.07 16.59 16.12 17.5 17.22 16.35 16.13 16.04 17.02 15.71 15.75 16.86 17.43 16.74 R9PXU1 Rgd1359108 5 49.7679371 313155 - 49.7679371 49.784007 similar to riken cdna 3110043o21 None FLTPAERKCSRLCEAESSFK None None 10137 16.61 14.03 17.89 15.91 15.18 16.91 16.9 15.86 16.56 15.61 17.04 15.91 16.73 16.14 15.7 16.55 15.89 17.07 16.59 16.12 17.5 17.22 16.5 16.13 16.04 17.02 15.71 15.75 16.86 17.15 16.86 M0R752 Lingo2 5 50.3714841 - 50.3714841 50.373541 leucine rich repeat and Ig domain containing 2 None VWSRGKGKHKNSIDLEYVPR None None None 15.82 16.0 15.93 16.15 14.98 16.34 15.04 16.12 16.33 15.19 16.47 15.98 15.43 15.63 15.71 14.96 14.67 16.2 15.4 16.35 15.3 16.34 14.89 16.17 14.8 14.31 15.21 15.37 16.45 15.02 14.78 Q66H11 Rgd1306195 5 54.4560051 313163 - 54.4560051 54.457376 gtp-binding nuclear protein ran None WHRDLVRVCENIPIVLCGNK None None 128450 22.42 21.68 21.08 21.43 21.75 20.7 21.85 22.53 20.6 21.29 20.37 21.21 20.94 20.66 21.57 22.23 20.65 22.18 21.09 22.1 20.25 21.33 20.48 21.59 21.84 22.99 21.61 21.56 20.75 20.84 22.87 G3V6S2 Aco1 5 55.2598451 50655 + 55.2598451 55.315868 citrate hydro-lyase None NPFAHLAEPLDPAQPGKKFF None 100880 856 20.04 21.56 18.37 20.61 20.01 19.85 20.47 20.57 19.68 19.1 19.33 20.35 19.28 20.47 19.03 19.79 18.8 21.07 19.49 20.93 18.96 19.43 19.47 20.72 21.62 20.42 20.61 18.88 18.92 19.08 20.53 Q63270 Aco1 5 55.2598451 50655 + 55.2598451 55.315868 cytoplasmic aconitate hydratase None MKNPFAHLAEPLDPAQPGKK None 100880 856 20.3 20.94 18.37 20.54 20.03 19.79 20.28 20.53 19.6 19.02 19.44 20.28 19.4 20.38 19.01 19.73 18.81 21.1 19.46 20.85 19.09 19.42 19.6 20.77 21.68 20.41 20.68 18.88 18.93 19.16 20.87 D4ADT5 Ddx58 5 55.3352941 297989 - 55.3352941 55.369816 dead (asp-glu-ala-asp) box polypeptide 58 None NSHSPLKPRNYQLELALPAK None None 32215 17.83 14.65 17.44 15.76 16.02 17.52 15.89 16.44 15.74 16.08 18.18 15.72 16.83 15.64 16.62 16.23 16.84 16.58 17.64 14.96 17.92 17.03 16.39 17.01 16.14 16.36 16.28 17.43 15.78 16.98 17.25 D3ZZ21 Ndufb6 5 55.4005441 297990 - 55.4005441 55.41011 complex i-b17 None PVLPPRRMWPLERFWNNFLR None None 1864 19.64 17.81 18.95 19.39 20.34 20.42 19.83 18.06 18.71 20.12 18.17 19.71 19.56 19.47 19.31 20.56 19.64 19.5 20.19 18.58 18.71 19.19 20.15 18.25 20.61 20.17 19.1 19.34 20.66 20.37 19.73 P63036 Dnaja1 5 55.8424151 65028 + 55.8424151 55.853326 dnaj homolog subfamily a member 1 None QERRRHYNGEAYEDDEHHPR None None 55588 20.77 18.06 20.37 20.32 19.83 19.93 20.16 20.44 18.72 20.49 20.96 18.75 20.39 19.96 19.2 19.73 21.13 19.8 19.34 19.74 18.67 20.07 20.72 19.52 20.15 19.87 19.07 19.3 21.34 20.57 19.31 Q99M63 Smu1 5 55.8566541 117541 - 55.8566541 55.875314 wd40 repeat-containing protein smu1 None NLLARSYFDPREAYPDGSSK None None 10079 16.84 16.13 17.37 16.58 16.88 17.89 15.95 16.57 18.0 17.32 17.14 17.91 17.54 17.63 18.06 16.2 16.58 17.22 17.1 17.97 19.04 17.87 17.4 18.11 16.28 16.17 18.18 16.24 17.84 17.65 18.56 B0K019 Bag1 5 56.0684951 297994 - 56.0684951 56.081075 bag family molecular chaperone regulator 1 None LKDLEVSVEKTANHLEELNK None 601497 3190 16.45 16.68 17.56 16.09 17.17 17.13 16.58 16.49 17.19 15.93 17.93 16.52 16.61 17.56 16.44 15.88 18.09 16.97 15.91 16.96 17.86 17.08 16.16 17.03 17.59 16.75 16.58 17.29 17.06 17.92 17.57 Q4QQV8 Chmp5 5 56.0813861 297995 + 56.0813861 56.098522 charged multivesicular body protein 5 None DNLAQQSFNMEQANYTIQSLK None 610900 5757 19.7 20.36 19.66 19.45 19.96 19.41 19.7 19.77 19.24 19.09 18.15 18.49 18.82 19.36 18.4 18.58 19.31 19.46 19.28 20.35 19.49 18.67 18.61 18.92 20.54 20.64 19.27 18.86 20.55 19.05 19.65 D4AE50 Nfx1 5 56.1052351 313166 + 56.1052351 56.162912 nuclear transcription factor, x-box-binding 1 None NCGQHRCAELCHAGQCQPCR None None 1875 15.44 15.36 15.95 15.36 14.78 15.44 14.0 14.41 15.96 14.89 15.65 15.1 14.44 15.27 15.23 15.98 14.41 15.17 15.29 15.1 16.02 15.23 15.09 16.0 14.91 14.05 14.84 15.28 15.88 16.61 14.6 A0A0G2QC27 Nol6 5 56.2608111 313167 - 56.2608111 56.270484 nucleolar protein 6 None IQGPRETSSTGEEALALAVR None 611532 41505 15.49 13.16 14.66 15.23 14.69 16.63 15.91 14.01 14.99 14.89 15.86 15.6 15.65 16.36 15.68 14.47 15.87 14.76 14.58 16.81 16.54 16.15 15.42 15.87 16.23 15.11 14.17 15.27 15.94 16.31 16.17 B2RZ96 Ube2r2 5 56.2866051 689226 + 56.2866051 56.345174 loc689226 protein None QKALMLELKSLQEEPVEGFR None None 3210 17.18 15.86 17.86 16.92 16.56 17.66 18.17 17.28 16.92 17.55 19.18 16.21 17.78 17.83 16.82 16.8 16.97 18.08 17.09 18.61 17.74 18.3 17.5 17.85 17.55 16.91 18.0 16.1 16.58 17.3 17.38 A0A0G2JYI7 Ubap2 5 56.3482461 313169 - 56.3482461 56.437049 ubiquitin-associated protein 2 None AINTLLEGSSDTTSWETVGGK None None 73649 17.3 15.63 17.25 15.86 16.2 17.09 15.81 15.73 17.26 17.31 17.06 15.44 16.9 16.82 15.57 16.34 17.08 16.53 15.89 16.92 18.02 15.62 16.93 16.66 16.18 15.16 15.97 16.32 18.03 16.77 16.88 A0A0U1RRQ3 Ubap2 5 56.3482461 313169 - 56.3482461 56.437049 ubiquitin-associated protein 2 None None None None 17.3 15.63 17.25 15.86 16.2 17.09 15.66 15.73 17.26 17.31 17.06 15.44 16.9 16.82 15.57 16.34 17.08 16.53 15.89 16.92 18.02 15.62 16.93 16.8 16.18 15.16 16.01 16.28 18.02 16.77 16.88 Q5XIS7 Ubap1 5 56.5207441 362502 + 56.5207441 56.561152 ubiquitin-associated protein 1 None AIEWAEDIRLIQEAQQEAER None 609787 9554 16.43 13.66 15.25 15.11 15.43 14.88 15.28 15.26 14.97 15.04 17.29 15.66 14.91 14.04 14.25 15.68 15.34 14.81 16.05 15.09 14.6 16.27 15.48 14.19 14.21 14.87 14.8 16.01 15.84 15.46 14.67 A0A0G2K7J8 Nudt2 5 56.6282661 + 56.6282661 56.643104 bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] None None None None 18.14 15.54 18.69 17.72 18.56 16.95 18.94 17.72 17.37 17.64 17.83 16.8 17.89 17.23 17.82 16.91 17.29 18.01 18.46 17.55 17.68 18.04 18.05 16.49 18.72 17.19 17.7 17.79 17.05 18.33 18.05 D3ZH27 Nudt2 5 56.6282661 100910067 + 56.6282661 56.643104 bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] None ACGLIIFRRHLIPKMDNSTI None None None 15.71 17.16 16.67 16.58 17.44 17.14 18.03 18.14 17.68 17.94 16.71 17.66 17.81 17.56 18.07 17.12 16.04 17.6 17.02 17.75 17.25 16.95 17.94 16.83 15.91 17.3 17.51 17.46 15.81 16.77 16.62 Q6PEC0 Nudt2 5 56.6282661 297998 + 56.6282661 56.643104 bis(5'-nucleosyl)-tetraphosphatase [asymmetrical] None KPKTVIYWLAEVKDYDVEIR None 602852 896 19.35 16.86 20.03 18.35 19.45 18.65 19.99 19.22 18.27 18.77 19.7 17.89 19.07 18.87 18.48 18.14 18.03 19.38 18.93 19.66 19.52 19.09 19.4 18.29 19.82 18.32 19.48 19.14 17.38 19.64 19.25 D4AE63 Myorg 5 56.6589461 366360 - 56.6589461 56.664391 myogenesis-regulating glycosidase None VAPVLEPGKQERDVYLPAGK None None 19853 16.84 14.59 16.73 16.77 16.0 17.18 16.28 17.11 17.02 17.35 16.24 17.28 16.63 16.16 17.75 16.56 16.89 17.2 15.27 16.76 16.14 17.03 17.26 17.29 15.92 16.7 16.43 16.23 17.06 16.98 17.47 D4AAI7 Fam219a 5 56.6798171 691024 - 56.6798171 56.729566 family with sequence similarity 219, member a None DGYRLDEIPDDEDLDLIPPK None None None 16.24 13.5 15.96 15.77 15.4 15.87 14.42 14.77 15.64 15.51 16.98 16.12 16.07 16.72 15.21 15.68 15.83 16.81 15.54 15.51 16.33 16.23 16.26 15.87 15.51 14.92 16.42 14.96 16.86 16.09 15.98 Q08406 Cntfr 5 56.8234811 313173 - 56.8234811 56.860919 ciliary neurotrophic factor receptor subunit alpha None RHQVLLHVGLPPREPVLSCR None 118946 9619 18.75 16.19 18.55 18.22 17.96 17.76 18.84 17.01 18.28 17.56 17.04 18.06 17.82 19.28 18.3 17.9 17.98 17.28 18.63 18.63 18.67 18.7 18.54 17.25 18.16 19.19 17.35 18.86 18.66 19.36 18.49 D4A1B8 Dctn3 5 56.8810861 362504 - 56.8810861 56.889041 dynactin subunit 3 None TEESKALLEEYNKTTMLLSK None 607387 5233 19.23 21.19 18.49 19.28 19.33 19.95 18.34 19.58 19.12 20.05 17.96 19.37 18.83 19.11 19.41 20.37 20.42 19.04 18.49 20.3 18.84 18.81 18.77 19.97 19.22 20.77 19.6 18.51 20.52 18.82 19.2 P43424 Galt 5 56.927041 298003 + 56.927041 56.930265 galactose-1-phosphate uridylyltransferase None GYEMLAQAQRDLTPEQAAER None 606999 126 16.45 15.14 16.2 16.4 17.12 17.28 16.24 17.56 16.92 17.18 16.01 17.16 17.21 16.06 15.34 15.64 16.74 16.93 17.49 17.34 17.18 16.8 17.32 15.92 15.4 16.81 16.84 17.61 16.66 17.07 17.06 D3ZB78 Phf24 5 57.1431781 500446 + 57.1431781 57.166672 phd finger protein 24 None IRPTRKLDDDKPPDICLEPR None None 18208 20.76 22.48 19.92 20.93 19.37 20.54 21.11 20.35 21.34 21.38 20.28 20.84 20.2 21.35 19.79 20.85 20.31 21.71 20.28 20.6 21.08 20.56 20.55 21.25 19.43 21.07 19.58 21.12 19.94 19.61 19.8 A0A0G2K9H9 Dnajb5 5 57.1768461 313811 + 57.1768461 57.185483 dnaj heat shock protein family (hsp40) member b5 None EGLPFPKVPTQRGDLIVEFK None None 8176 16.58 15.08 15.33 16.9 16.3 16.77 15.36 16.18 16.45 15.17 16.12 17.44 17.28 16.34 16.92 16.21 17.3 16.49 16.78 14.96 17.43 15.94 16.96 17.43 17.04 17.3 16.52 16.6 16.45 16.09 17.78 P46462 Vcp 5 57.2101691 116643 - 57.2101691 57.229571 transitional endoplasmic reticulum atpase None AVTMDDFRWALSQSNPSALR None 601023 5168 21.09 21.95 22.82 22.48 22.05 21.21 22.26 23.3 21.78 23.46 22.7 21.27 23.23 22.48 21.26 21.65 21.75 22.66 21.93 23.83 22.98 21.76 23.06 21.7 22.42 22.24 22.15 21.83 23.31 22.07 21.94 Q4FZT0 Stoml2 5 57.2562171 298203 - 57.2562171 57.259917 stomatin-like protein 2 None AINVAEGKKQAQILASEAEK None 608292 8389 18.75 16.93 17.07 18.75 18.01 17.38 17.49 17.79 18.1 19.07 19.78 17.83 18.79 19.49 17.75 17.58 18.03 19.11 17.55 18.63 17.55 18.37 18.67 18.05 18.85 17.48 18.25 17.59 19.9 18.7 18.59 A0A0G2K511 Unc13b 5 57.2892791 64830 + 57.2892791 57.504106 protein unc-13 homolog b Munc13-2; Unc13h2 None None None None 17.97 17.75 17.45 17.76 17.08 18.44 17.4 17.5 18.92 17.62 17.2 19.04 18.76 18.2 19.11 18.15 18.2 18.01 18.07 16.4 18.89 17.83 17.86 18.63 17.23 17.91 18.3 18.04 17.6 17.27 18.42 D3Z9Y2 Unc13b 5 57.2892791 64830 + 57.2892791 57.504106 protein unc-13 homolog b None LQAKDKTGSSDPYVTVQVGK None None 31376 17.97 17.75 17.45 17.76 17.08 18.44 17.4 17.5 18.92 17.62 17.2 19.04 18.76 18.2 19.11 18.15 18.2 18.01 18.07 16.4 18.89 17.83 17.86 18.63 17.23 17.91 18.3 18.04 17.6 17.27 18.42 Q62769 Unc13b 5 57.2892791 64830 + 57.2892791 57.504106 protein unc-13 homolog b None HPGTGEHKVTVKVVAANDLK None None 31376 17.97 17.75 17.45 17.76 17.08 18.44 17.45 17.5 18.92 17.62 17.2 19.04 18.76 18.2 19.19 18.15 18.17 18.0 18.04 16.45 18.89 17.83 17.86 18.67 17.23 17.91 18.13 18.05 17.68 17.27 18.42 P58775 Tpm2 5 57.7709261 500450 - 57.7709261 57.779938 tropomyosin beta chain None ASLNRRIQLVEEELDRAQER None 190990 39294 23.69 21.4 23.76 21.96 21.89 21.9 23.44 23.95 22.47 22.56 24.35 21.66 23.03 23.46 23.42 22.78 22.23 22.71 21.53 23.45 22.06 23.01 22.58 23.46 22.51 22.37 21.93 22.85 21.83 23.15 23.02 G3V852 Tln1 5 57.7879441 313494 - 57.7879441 57.8179 rcg55135, isoform cra_b None GVAALTTDPAVQAIVLDTASDALDK None 186745 21267 21.13 19.64 19.75 20.41 20.41 19.42 21.01 21.53 20.16 19.62 22.03 19.72 20.25 20.3 19.62 20.02 20.03 21.22 19.74 20.6 19.34 19.84 19.62 20.38 20.47 20.18 20.99 20.05 18.64 19.73 21.3 D4A6U0 Gba2 5 57.822391 298399 - 57.822391 57.834028 non-lysosomal glucosylceramidase None None None None 16.79 13.95 13.88 16.63 17.06 15.49 16.19 16.89 16.51 16.38 16.58 16.52 16.66 15.47 15.95 16.56 16.06 16.41 16.16 17.36 16.15 15.96 16.35 15.88 16.84 17.12 15.46 16.14 17.69 16.9 17.0 Q5M868 Gba2 5 57.822391 298399 - 57.822391 57.834028 non-lysosomal glucosylceramidase None KRRNVIPHDIGDPDDEPWLR None None 10859 16.79 13.95 13.88 16.63 17.06 15.49 16.5 16.89 16.51 16.38 16.58 16.52 16.66 15.47 15.97 16.56 16.13 16.46 16.06 17.26 16.15 15.96 16.35 15.8 16.84 17.12 15.89 15.86 17.43 16.9 17.0 D4AB01 Hint2 5 57.9046151 313491 - 57.9046151 57.906868 histidine triad nucleotide binding protein 2, isoform cra_a None QLLGHLLLVAKKIAQAEGLK None 609997 13072 20.75 20.09 19.61 20.68 19.97 18.66 20.96 20.36 19.56 21.33 19.39 19.89 19.92 20.36 19.2 18.05 19.23 19.78 18.9 21.26 19.07 19.89 19.0 18.52 19.85 19.16 19.66 18.98 20.14 19.84 20.06 A0A0G2JZ40 Reck 5 58.1029871 313488 + 58.1029871 58.169482 rcg54895, isoform cra_a None IARCVGLQDHQFEFGPCISK None 605227 9622 14.27 13.67 15.09 15.42 14.71 14.86 15.52 15.7 15.83 15.38 15.28 15.86 15.94 15.58 15.8 14.32 14.62 16.21 15.57 14.41 15.98 15.5 16.03 14.9 13.67 14.84 14.33 16.51 14.69 15.16 15.56 A0A0G2JYW3 Clta 5 58.2454361 83800 + 58.2454361 58.263479 clathrin light chain LCA1; LCA2; LCA3 None None None None 22.5 24.04 21.73 21.65 21.73 21.99 21.06 22.33 22.61 23.44 21.35 22.27 21.91 22.33 23.24 22.62 22.31 21.74 21.84 21.58 22.08 22.22 21.53 22.26 21.07 23.07 22.06 22.56 23.28 21.09 22.08 P08081 Clta 5 58.2454361 83800 + 58.2454361 58.263479 clathrin light chain a None ESSPGTEWERVARLCDFNPK None 118960 1384 22.5 24.04 21.73 21.65 21.73 21.99 21.06 22.33 22.61 23.44 21.35 22.27 21.91 22.33 23.24 22.62 22.31 21.74 21.84 21.58 22.08 22.22 21.53 22.26 21.07 23.07 22.06 22.56 23.28 21.09 22.08 O35826 Gne 5 58.2672141 114711 - 58.2672141 58.307391 bifunctional udp-n-acetylglucosamine 2-epimerase/n-acetylmannosamine kinase None INLGTRQIGRETGENVLHVR None 603824 3996 14.7 14.63 16.85 14.55 15.99 14.94 15.64 16.08 15.74 14.42 16.04 15.66 15.33 14.33 16.72 15.55 15.48 14.69 15.42 15.06 16.48 15.59 14.79 14.45 15.84 14.25 14.44 16.71 15.86 16.08 16.44 B0BN46 Grhpr 5 59.2341961 680021 + 59.2341961 59.243579 glyoxylate and hydroxypyruvate reductase None PIPSKDLEQGVAGAYGLLCR None 604296 49088 18.92 17.18 17.59 19.81 18.78 18.99 20.0 18.24 17.95 17.65 18.05 19.0 19.06 18.65 18.53 19.62 17.6 19.42 17.6 19.95 17.01 18.47 19.03 18.64 19.88 19.63 18.91 18.04 17.52 18.88 19.72 D3ZVN3 Fbxo10 5 59.2981591 362511 - 59.2981591 59.365215 f-box protein 10 None IRENQWGGVDIRRGGVPILR None 609092 19544 16.51 14.58 16.42 16.56 15.42 16.82 16.35 15.0 15.43 14.71 17.27 15.09 16.46 16.64 16.41 14.52 16.73 15.54 16.2 14.52 16.69 16.45 15.76 16.12 15.97 16.4 14.78 16.42 16.05 16.56 15.91 A0A1B0GWY3 Tomm5 5 59.3620311 680080 - 59.3620311 59.365186 rcg54790, isoform cra_c None IEGLAPKLDPEEMKRKMRED None None 104342 19.18 21.79 18.92 19.08 19.49 20.04 19.9 18.22 20.54 20.3 19.73 20.09 19.35 20.88 20.73 19.8 19.93 18.08 20.03 19.92 20.44 20.4 19.07 20.14 18.73 19.56 19.07 20.86 18.73 18.94 20.37 Q66HF8 Aldh1b1 5 60.0633711 298079 + 60.0633711 60.068377 aldehyde dehydrogenase x None PFGGFKESGNGRELGEDGLK None 100670 115470 20.75 20.27 20.59 20.21 19.91 19.66 19.8 20.33 19.44 21.24 20.25 18.66 19.95 19.57 19.78 20.89 20.85 20.6 18.73 20.61 18.66 20.85 20.28 20.55 19.71 20.99 20.74 20.23 19.02 19.33 19.59 Q9R1R4 Tdrd7 5 60.24571 85425 + 60.24571 60.312544 tudor domain-containing protein 7 None HQKDVFLSAVSAAASSPGNR None None 8618 19.43 17.33 19.94 20.04 19.2 19.69 19.49 19.32 19.7 19.38 17.57 17.83 19.11 17.81 19.43 19.53 18.24 18.77 19.65 18.16 18.31 18.08 19.77 19.29 18.76 18.69 19.57 18.12 17.76 18.94 19.19 P70567 Tmod1 5 60.3385131 25566 + 60.3385131 60.393956 tropomodulin-1 None PELEEVNLNNIRNIPIPTLK None None 20701 20.63 19.03 19.17 19.99 20.25 19.93 19.55 19.81 20.3 19.41 19.9 20.35 19.73 20.23 20.99 20.15 19.03 19.94 19.73 19.54 19.93 19.27 20.17 19.79 19.91 20.16 20.28 20.2 19.39 19.64 19.99 Q6IMZ5 Tmod1 5 60.3385131 25566 + 60.3385131 60.393956 tropomodulin-1 None PELEEVNLNNIRNIPIPTLK None None 20701 21.04 19.1 19.54 20.36 20.62 20.3 19.72 20.2 20.67 19.78 20.26 20.72 20.22 20.62 21.36 20.5 19.47 20.25 20.06 19.97 20.28 19.64 20.63 20.5 20.28 20.53 20.9 20.47 19.51 20.25 20.45 Q56A27 Ncbp1 5 60.4160241 298075 + 60.4160241 60.448387 nuclear cap-binding protein subunit 1 None CLSVAFKSKATNDEIFSILK None None 1859 17.15 16.19 17.71 17.28 17.25 17.32 16.19 16.89 18.2 16.31 17.12 17.51 17.35 17.67 19.26 16.56 16.81 17.31 17.2 17.03 19.36 17.63 17.55 17.7 18.2 16.81 18.38 17.25 17.6 17.68 18.84 Q9EST6 Anp32b 5 60.7432851 170724 + 60.7432851 60.765722 acidic leucine-rich nuclear phosphoprotein 32 family member b None SVSDLPKLPKLKKLELSENR None None 21286 20.71 20.41 20.57 20.69 20.74 20.6 20.52 20.44 21.9 20.47 20.2 21.94 21.12 21.45 21.54 20.06 19.71 20.66 21.65 21.31 22.72 20.96 20.56 20.84 20.41 20.48 21.03 21.29 21.29 20.86 22.55 B1WC26 Nans 5 60.7804181 298071 + 60.7804181 60.797585 n-acetylneuraminate synthase None VLVTIEEDDTVMEESVESQSK None 605202 10343 19.08 17.91 20.26 19.8 20.39 17.87 20.31 19.33 18.53 18.99 18.64 18.0 19.13 19.24 18.96 19.44 18.09 20.03 18.47 20.66 18.86 18.65 19.88 19.12 20.44 19.7 19.57 18.39 18.37 19.14 20.02 A0A0G2QC56 Coro2a 5 60.8279361 313235 - 60.8279361 60.859035 coronin None SESYQEDIYPPTAAAQPSLTAHEWLSGMNR None 602159 2546 19.68 19.47 17.49 19.15 17.88 18.36 18.95 18.06 18.49 18.14 18.14 19.49 18.08 20.55 19.86 18.21 17.25 18.27 18.66 18.79 17.86 18.98 18.02 18.3 18.66 18.87 17.85 18.68 19.3 18.34 18.76 A0A0A0MXV8 Gabbr2 5 60.9475271 83633 - 60.9475271 61.288104 gamma-aminobutyric acid type b receptor subunit 2 Gpr51 None None None None 18.87 17.51 17.51 18.9 18.3 18.48 17.9 17.83 19.58 19.25 18.53 19.96 19.82 19.37 19.39 18.77 19.37 18.82 19.7 17.27 20.03 18.93 19.06 19.67 18.25 19.45 18.76 19.73 18.85 19.24 19.31 O88871 Gabbr2 5 60.9475271 83633 - 60.9475271 61.288104 gamma-aminobutyric acid type b receptor subunit 2 None GAPRPPPSSPPLSIMGLMPLTK None 607340 55902 18.87 17.55 17.51 18.94 18.37 18.45 17.85 17.87 19.58 19.25 18.53 19.96 19.8 19.35 19.36 18.82 19.37 18.82 19.7 17.27 19.96 18.87 19.04 19.62 18.25 19.45 18.74 19.74 18.92 19.31 19.32 G3V6U3 Alg2 5 61.7687411 313231 - 61.7687411 61.773297 gdp-man:man(1)glcnac(2)-pp-dol alpha-1,3-mannosyltransferase None CQVKIWTAHYDPNHCFIETR None 607905 5930 19.83 21.18 19.96 19.71 19.9 19.0 19.91 19.6 18.84 20.13 19.01 18.51 19.17 19.26 20.53 19.22 19.92 19.53 20.04 18.16 19.98 19.21 18.57 19.72 20.56 20.5 19.89 19.41 19.24 19.89 19.59 B2RZD1 Sec61b 5 61.7735711 298068 + 61.7735711 61.78178 protein transport protein sec61 subunit beta None SCGTRSAGRTTSAGTGGMWR None None 38229 17.62 16.28 16.9 16.29 16.33 17.66 15.94 15.92 17.28 18.43 17.55 16.76 17.26 16.78 18.01 17.11 17.46 16.62 17.46 15.7 17.46 17.96 16.94 17.94 16.14 15.98 17.1 16.79 17.11 16.33 18.09 Q9Z158 Stx17 5 62.4502811 252853 + 62.4502811 62.502562 syntaxin-17 None KYQRCRIWDKLHEEHINAGR None 604204 9917 17.9 17.97 16.24 16.03 17.69 16.31 16.46 18.04 16.18 16.46 17.71 16.61 17.59 15.82 16.26 18.23 18.53 16.66 18.14 16.2 16.89 17.85 17.01 16.26 18.51 18.46 16.41 18.49 18.28 17.12 16.98 Q5VLR5 Erp44 5 62.5176171 298066 - 62.5176171 62.610738 bwk4 None DEVTNLDRSKRNIIGYFEQK None None None 20.58 17.51 19.65 20.19 19.69 18.8 19.3 19.19 19.68 19.45 21.11 19.92 19.78 20.73 19.74 18.16 18.91 20.25 18.67 21.18 20.3 18.75 19.64 20.29 19.92 18.71 20.33 18.66 19.99 20.41 20.1 D4A401 Tex10 5 62.7622311 298065 - 62.7622311 62.808373 testis expressed gene 10 None NPELSTQLIDIIHTAASQANK None None 32361 15.55 14.92 15.07 15.82 15.29 14.93 14.37 14.64 14.24 14.24 15.35 14.43 14.2 15.32 14.82 14.97 16.19 14.78 15.42 13.98 15.59 14.93 15.1 15.81 16.51 15.97 15.52 15.08 14.85 15.0 16.59 Q9QYV1 Tmeff1 5 62.9107411 63845 + 62.9107411 62.996493 tomoregulin-1 None YTGQHCEKTDFSILYVVPSR None 603421 128529 16.75 15.95 16.88 15.51 15.24 16.39 16.69 16.5 15.9 16.09 16.55 15.58 16.09 16.35 15.85 16.0 16.02 16.59 15.24 16.69 16.01 16.78 16.11 14.86 15.55 17.1 15.62 16.46 16.12 15.43 15.49 M0R9M6 Rstk 5 61.6927421 103690035 + 61.6927421 61.702885 receptor protein serine/threonine kinase None YQTVMLRHENILGFIAADNK None None None 15.6 18.01 15.93 16.77 16.98 16.74 15.63 17.78 18.49 17.0 16.96 16.78 17.74 16.07 17.71 18.03 16.63 17.75 15.97 16.16 16.15 17.0 16.14 17.58 17.17 16.33 17.09 18.01 16.68 16.48 16.26 D3ZYL4 Mrpl50 5 63.8674441 362517 - 63.8674441 63.872591 39s ribosomal protein l50 None VQDRSKFDELIASNLPPNLK None 611854 32436 16.41 14.18 15.97 16.67 16.34 16.77 15.08 15.74 15.85 15.31 15.69 16.4 16.21 15.99 16.42 16.42 14.57 15.9 17.19 15.86 15.65 16.57 16.73 15.26 18.04 16.1 17.24 16.55 16.9 16.87 16.74 P00884 Aldob 5 63.8890471 24190 - 63.8890471 63.902097 fructose-bisphosphate aldolase b None SQGKLFRNILKEKGIVVGIK None 612724 20060 20.85 19.15 20.19 21.65 21.82 19.72 21.43 22.11 20.91 20.32 20.45 21.24 21.76 20.16 20.33 22.08 20.49 21.61 20.63 22.7 19.84 20.35 21.48 20.95 21.86 22.96 21.45 20.38 20.89 21.91 21.55 D3ZYQ9 Rnf20 5 63.9758531 313216 + 63.9758531 64.001747 e3 ubiquitin protein ligase None RIILKRYDLDQGLGDLLTER None None 5571 16.34 15.46 17.3 16.77 17.27 16.35 16.1 16.76 17.72 15.49 16.71 17.66 17.13 17.04 17.8 16.52 16.22 16.79 16.65 17.6 18.07 16.76 16.97 16.89 17.33 16.38 17.22 16.88 17.86 17.44 18.34 P28470 Ppp3r2 5 64.0269041 29749 - 64.0269041 64.0279 calcineurin subunit b type 2 None FISNGELFQVLKMMVGNNLK None None 133815 17.4 15.75 15.91 17.39 17.3 17.05 17.52 17.37 16.79 16.1 17.87 17.62 17.65 16.63 17.07 17.99 17.59 16.92 18.12 16.48 16.14 17.18 17.6 17.42 18.28 17.79 16.13 17.24 17.64 17.58 18.1 Q5M949 Nipsnap3b 5 67.6559791 313211 + 67.6559791 67.664198 nipsnap homolog 3a (c. elegans) None FGGKINRVFHIWKYDNFAHR None None 75044 18.22 15.9 18.39 18.38 17.85 16.34 17.74 18.42 17.02 17.81 16.63 16.25 17.69 16.46 16.73 17.94 17.73 17.81 16.34 18.48 16.23 16.54 17.51 18.49 17.85 17.94 17.78 15.71 17.07 17.11 17.6 F1LNL3 Abca1 5 67.6783221 313210 - 67.6783221 67.801146 atp-binding cassette subfamily a member 1 None PEGGGLKIKSLNWYEDNNYK None 600046 21130 16.39 16.54 18.41 18.51 16.16 17.08 17.48 16.32 17.17 16.8 17.05 16.49 16.28 17.37 18.24 16.27 16.73 17.83 15.4 16.84 17.81 17.01 16.91 17.92 17.33 17.09 18.04 16.39 15.52 17.17 18.48 A0A0G2K0P8 Slc44a1 5 68.0636191 85254 + 68.0636191 68.241909 cdw92 antigen, isoform cra_b Cdw92; Ctl1 None None None None 19.68 17.21 17.59 18.13 20.02 19.07 18.7 19.42 18.67 19.48 18.69 18.77 18.53 17.84 17.21 18.43 19.15 17.97 19.41 19.43 18.12 18.42 19.11 18.03 17.62 18.63 17.83 17.94 20.42 19.72 17.84 Q8VII6 Slc44a1 5 68.0636191 85254 + 68.0636191 68.241909 choline transporter-like protein 1 None YNIKPSEYTLTAKSSAFCPK None 606105 None 19.68 17.21 17.59 18.13 20.02 19.07 18.62 19.42 18.67 19.48 18.69 18.77 18.53 17.84 17.21 18.43 19.15 17.97 19.41 19.43 18.12 18.42 19.11 17.98 17.62 18.63 17.78 18.09 20.43 19.72 17.84 A0A0G2JZ60 Fsd1l 5 68.2589211 313208 + 68.2589211 68.329459 fibronectin type iii and spry domain-containing 1-like None FEGLPRVKDERCWEVIDNIK None None None 19.67 17.46 19.38 18.39 17.95 19.66 19.25 18.18 17.55 18.11 19.17 17.39 18.91 17.98 19.26 19.64 18.33 19.43 16.98 18.81 17.43 18.89 18.41 18.66 19.45 18.46 19.22 18.58 16.61 18.75 17.76 Q68FV1 Tmem38b 5 68.4603051 362521 + 68.4603051 68.496025 trimeric intracellular cation channel type b None TACEQLLKGDWKPEGDEWLK None None 10010 15.09 14.92 16.94 15.91 14.43 15.61 16.75 15.14 16.81 15.15 15.7 16.09 15.63 16.07 16.53 16.4 15.71 16.24 14.47 15.11 16.01 16.29 15.44 14.52 15.48 14.31 15.42 16.15 15.73 16.33 16.78 D3ZFG7 Zfp462 5 69.7320011 362522 + 69.7320011 69.809791 zinc finger protein 462 None LDTHLRDEHKVSRNFELVGR None None 41430 16.83 15.34 17.1 17.92 17.17 16.97 16.17 15.98 17.55 16.1 17.58 18.05 17.8 17.86 15.63 17.05 17.16 17.55 17.05 17.63 17.4 16.66 17.68 18.27 16.95 17.16 17.68 16.91 16.67 17.37 17.76 F1M1J6 Klhl7 5 69.9863531 - 69.9863531 69.986744 kelch-like family member 7 None GSQIEFMWIIRKRIQLPSEK None None None 19.25 18.27 18.87 18.51 20.44 17.43 19.24 18.94 19.79 18.79 17.3 18.7 18.52 19.3 19.47 18.94 18.52 18.29 17.96 20.12 18.15 17.71 18.3 17.76 19.17 19.3 19.68 19.69 17.71 19.88 19.27 Q4KMA2 Rad23b 5 70.0902331 298012 + 70.0902331 70.128339 uv excision repair protein rad23 homolog b None RQIIQQNPSLLPALLQQIGR None 600062 37704 21.78 20.39 20.5 20.95 20.81 20.33 21.08 22.07 19.95 21.38 20.64 19.82 21.31 20.09 19.69 21.0 21.14 21.46 20.43 21.46 19.86 21.13 20.78 20.51 21.21 22.42 20.18 21.16 21.34 20.87 21.15 F1LP76 Elp1 5 71.4562981 140934 - 71.4562981 71.505688 elongator complex protein 1 None KPQCFCLRAEQGTVLIGSER None 603722 2699 19.04 17.13 19.51 18.92 17.37 18.43 19.96 18.04 18.19 19.55 19.32 17.94 19.08 18.59 20.01 18.12 19.14 18.41 18.83 17.29 19.58 19.76 18.81 18.75 18.11 18.59 18.49 18.43 17.87 19.12 19.16 Q8VHU4 Elp1 5 71.4562981 140934 - 71.4562981 71.505688 elongator complex protein 1 None TFIKQIDSVNHLNLFFTELK None 603722 2699 19.07 17.2 19.63 18.99 17.37 18.27 19.94 18.26 18.24 19.51 19.35 17.98 19.08 18.48 20.01 18.23 19.17 18.45 18.76 17.29 19.46 19.66 18.68 18.84 18.05 18.49 18.58 18.39 17.75 19.07 19.17 D4A739 Ctnnal1 5 71.5143411 298019 - 71.5143411 71.567675 catenin (cadherin associated protein), alpha-like 1 None IKELKLNMEALRENVYFESK None 604785 2815 16.35 14.04 15.92 16.58 16.39 15.07 15.8 15.06 14.78 15.34 17.3 15.67 16.09 16.27 16.39 16.08 15.27 15.43 16.72 15.21 15.64 16.02 16.61 14.84 16.35 15.35 15.41 16.26 16.68 16.75 15.77 D3ZXD8 Tmem245 5 71.5806671 298020 - 71.5806671 71.647686 transmembrane protein 245 None PTDKGEPPPAPSASSSSSSR None None None 17.12 15.23 15.89 17.54 16.02 16.75 17.51 18.27 16.71 17.46 17.42 17.56 17.66 17.52 16.28 16.42 16.07 17.69 18.02 17.16 17.41 16.99 17.21 17.04 16.02 17.95 16.63 16.33 17.6 17.58 16.55 D3ZE85 Frrs1l 5 71.6615521 366376 - 71.6615521 71.689994 domon domain-containing protein frrs1l None YLSEEGYPFPTAPPVDPFAK None None None 17.71 15.8 17.49 17.42 17.22 18.5 16.47 16.68 18.81 17.17 17.18 18.57 18.18 18.56 17.56 18.07 17.45 17.46 18.34 17.52 18.58 17.64 18.35 17.63 17.19 17.98 17.76 19.07 17.99 18.14 18.21 A0A0G2K3H4 Epb41l4b 5 71.6916391 500464 - 71.6916391 71.85199 band 4.1-like protein 4b None LVVVEDDDQGREQEHTFVFR None None None 15.6 13.53 15.76 16.2 14.41 14.74 15.37 15.01 15.26 14.61 15.7 15.13 16.62 16.65 15.01 15.39 15.21 15.41 16.64 15.12 15.89 15.31 15.1 15.96 16.63 16.32 14.27 16.96 15.47 16.1 15.77 F1LQQ5 Ptpn3 5 71.9085211 362524 - 71.9085211 72.027411 tyrosine-protein phosphatase non-receptor type None VTEKEYFGLQHGDDPVDSPR None None 74451 14.67 17.27 13.61 14.77 15.58 14.69 14.78 14.49 15.62 16.85 15.45 15.32 15.25 15.35 15.33 15.9 16.14 14.71 15.76 13.96 15.4 14.84 15.04 15.5 14.82 15.03 15.06 15.15 15.83 14.41 14.88 A0A096MIZ1 Palm2 5 72.3136471 103692368 + 72.3136471 72.451078 paralemmin 2 None RRQSEEDEFKVKQLEDNIQR None None None 20.27 19.95 19.01 19.58 19.15 20.35 19.46 18.83 19.26 21.08 20.3 19.25 19.55 19.39 19.84 19.53 21.08 19.38 19.93 18.14 19.97 21.19 20.81 20.57 19.55 20.07 19.66 18.67 20.64 19.51 18.03 A0A096MK80 Ac134204.1 5 72.391061 + 72.391061 72.617314 paralemmin a kinase anchor protein None RRQSEEDEFKVKQLEDNIQR None None None 18.76 18.06 18.22 18.0 17.63 19.02 18.08 17.52 17.65 19.44 18.54 17.63 18.33 18.01 19.01 18.14 19.33 17.83 17.32 17.95 18.33 19.58 19.4 19.43 18.12 18.59 19.41 17.63 17.01 18.32 17.17 F1LPQ9 Akap2 5 72.5370481 298024 + 72.5370481 72.645136 a-kinase anchor protein 2 AKAP-2 None None None None 17.03 19.53 18.04 17.7 17.57 17.85 18.57 17.36 18.74 19.05 18.05 17.72 17.99 18.45 17.96 17.88 17.13 18.35 18.67 19.61 19.21 18.87 17.9 18.43 18.32 18.36 19.03 18.8 16.77 18.23 19.19 Q5U301 Akap2 5 72.5370481 298024 + 72.5370481 72.645136 a-kinase anchor protein 2 None VKPPPSPTTEGPSLQPDLAPEEAAGAQRPK None 604582 100376 17.03 19.53 18.04 17.7 17.57 17.85 18.57 17.36 18.74 19.05 18.05 17.72 17.99 18.45 18.02 17.88 17.08 18.36 18.66 19.61 19.21 18.87 17.9 18.43 18.32 18.36 19.04 18.81 16.77 18.23 19.19 P11232 Txn1 5 72.7123471 116484 - 72.7123471 72.720351 thioredoxin None VKLIESKEAFQEALAAAGDK None None 128202 21.98 20.34 21.76 22.25 21.94 22.38 23.22 22.73 21.67 20.89 22.07 21.95 22.25 21.16 20.34 21.67 21.29 22.93 21.58 22.77 20.85 21.86 21.98 21.52 22.12 21.55 21.45 21.58 21.08 22.41 22.24 F1M446 Ecpas 5 73.6045291 313196 - 73.6045291 73.713015 ecm29 proteasome adaptor and scaffold None EIQSAFVSVLSENDELSQDVASK None None None 18.27 19.1 20.14 18.67 17.23 17.99 19.19 18.8 18.21 17.96 18.68 17.36 18.01 18.42 18.63 17.91 18.34 18.71 19.16 17.09 19.5 18.45 17.23 18.27 18.59 18.71 18.57 18.76 17.48 18.23 18.86 Q99PJ8 Zfp483 5 73.7655451 170955 + 73.7655451 73.775849 zinc finger protein 483 None KESESRSELDAFMEELTLEK None None 26419 16.01 17.78 17.1 16.68 15.19 16.57 15.84 15.75 16.57 17.2 17.11 14.97 15.41 16.92 16.69 16.51 17.55 15.21 16.76 15.25 16.72 17.25 15.85 16.45 15.34 16.93 17.13 16.23 16.37 16.1 16.19 P97584 Ptgr1 5 73.7839981 192227 - 73.7839981 73.802704 prostaglandin reductase 1 None LGFDVAFNYKTVKSLEEALR None None 40820 16.87 16.03 18.03 16.41 17.79 17.37 17.61 18.32 17.22 15.85 17.16 17.18 16.54 16.66 16.73 17.19 15.93 18.0 16.34 18.34 17.24 16.14 16.52 16.71 17.26 16.49 17.55 17.24 16.01 17.45 18.31 Q3KRE3 Gng10 5 73.8561251 114119 + 73.8561251 73.863016 guanine nucleotide-binding protein subunit gamma None CKDALLLGVPAGSNPFREPR None None 20874 18.24 18.13 16.69 17.6 16.22 17.17 17.33 17.42 17.56 17.25 16.66 18.04 18.04 18.45 18.79 17.19 17.23 16.7 17.79 17.27 18.63 17.88 16.9 18.79 17.35 18.88 16.91 17.56 17.35 17.11 18.01 Q9Z118 Ptbp3 5 74.3172841 83515 - 74.3172841 74.399445 polypyrimidine tract-binding protein 3 None AEVISLGLPFGKVTNLLMLK None 607527 40232 17.9 16.74 18.29 18.45 17.87 17.65 17.03 19.58 17.84 17.32 19.14 17.47 17.88 17.34 18.55 17.48 17.65 17.89 18.04 17.25 17.02 17.19 18.22 18.92 17.38 17.09 18.9 16.7 17.31 18.22 18.67 E9PSU5 Magi3 2 191.518511 + 191.518511 191.716725 membrane associated guanylate kinase, WW and PDZ domain containing 3 None None None None 20.36 21.37 22.04 21.07 21.13 20.64 20.01 20.74 21.53 20.39 20.33 21.8 21.15 21.62 22.58 20.52 21.19 20.13 21.89 20.47 22.82 21.31 20.82 22.0 21.77 20.6 22.37 20.17 21.52 21.71 22.47 Q4V8F9 Hsdl2 5 74.4439341 313200 + 74.4439341 74.4791 hydroxysteroid dehydrogenase-like protein 2 None GKAIALKAAKDGANIVIAAK None None 75204 19.92 18.4 19.12 19.64 20.63 18.58 19.78 19.38 18.73 18.34 19.54 19.8 19.51 19.11 19.68 19.78 19.55 19.46 19.02 19.31 18.34 18.79 18.95 19.63 20.36 19.52 20.33 19.07 17.94 20.02 20.32 A0A0G2JUF2 Snx30 5 74.6840211 298033 + 74.6840211 74.792631 sorting nexin-30 None YRITTKSTRVEFDLPEYSVR None None None 18.27 19.37 18.87 18.48 17.24 18.81 19.21 17.74 18.82 17.86 18.08 18.16 18.31 19.23 18.61 18.14 18.8 18.98 18.21 17.67 19.2 18.81 17.33 17.88 18.13 18.69 19.26 18.89 17.0 18.66 19.44 D4A060 Snx30 5 74.6840211 298033 + 74.6840211 74.792631 sorting nexin-30 RGD1311367 None None None None 18.27 19.37 18.87 18.48 17.24 18.81 19.11 17.74 18.82 17.86 18.08 18.16 18.31 19.23 18.61 18.14 18.8 18.98 18.21 17.67 19.2 18.81 17.33 17.98 18.13 18.69 19.3 18.84 17.04 18.66 19.44 O88553 Zfp37 5 75.634731 115768 - 75.634731 75.638598 zinc finger protein 37 None TFRKKSSNSKKSSECTLLEK None 602951 40682 14.18 14.53 16.49 14.8 15.05 15.58 14.81 15.11 15.22 15.5 16.08 16.12 16.04 16.14 15.62 14.99 15.83 15.49 15.46 14.63 17.45 16.4 16.28 15.52 16.08 15.02 16.46 15.27 15.83 15.82 15.68 D4AE06 Fkbp15 5 75.7513161 362528 - 75.7513161 75.801109 peptidylprolyl isomerase None LEKSSRIEEQNDKISDLIER None None 28743 17.96 15.84 16.96 17.2 18.49 17.42 16.87 18.5 16.25 17.09 19.1 18.06 17.95 16.35 17.68 17.78 18.93 16.41 17.49 17.23 16.57 17.31 18.1 17.15 18.04 17.11 17.51 16.8 18.79 18.32 17.68 Q6YDN7 Cdc26 5 75.8460821 366381 - 75.8460821 75.859749 anaphase-promoting complex subunit cdc26 None RKPTRLELKLDDIEEFENIR None None 16410 15.46 13.16 14.49 14.52 14.91 14.8 14.51 14.66 16.34 14.76 15.38 15.28 15.93 15.2 14.57 14.99 15.96 15.9 14.26 15.54 16.42 16.55 15.81 15.82 15.59 15.99 15.5 14.56 16.73 15.83 15.8 D4A7J8 Prpf4 5 75.8599351 298095 + 75.8599351 75.873858 prp4 pre-mrna processing factor 4 homolog (yeast) None VSLDQKDVNLASCAADGSVK None 607795 3446 16.87 16.32 17.51 17.59 17.42 16.94 16.16 17.12 17.56 16.52 16.63 17.98 17.3 17.61 18.74 16.72 17.53 16.84 17.04 16.68 19.01 17.61 17.36 18.33 18.45 17.39 18.45 16.92 17.47 18.1 18.9 Q6P6S3 Bspry 5 75.9274061 64027 + 75.9274061 75.949583 b box and spry domain-containing protein None DVLIDERTVGPLLNLSEDRK None None 9781 16.09 16.32 14.58 15.83 17.01 15.91 17.17 15.84 15.47 15.54 16.14 15.19 15.14 14.84 15.24 16.1 16.89 15.02 14.89 15.8 14.36 14.83 15.29 14.76 17.32 15.28 14.92 15.36 16.12 15.89 14.84 B2RYT7 Hdhd3 5 75.9513291 688746 - 75.9513291 75.954772 haloacid dehalogenase-like hydrolase domain-containing protein 3 None EHFDFVLTSEAVGCPKPDPR None None 16 18.42 16.84 17.08 17.79 17.64 18.71 17.82 17.61 16.73 16.76 18.48 18.16 18.0 17.2 17.22 18.44 17.02 18.64 17.28 18.66 17.4 17.56 17.28 17.08 18.71 18.02 17.16 18.37 18.14 17.78 17.48 P06214 Alad 5 75.9619941 25374 - 75.9619941 75.972474 delta-aminolevulinic acid dehydratase None CFYGPFRDAAQSSPAFGDRR None 125270 16 18.34 16.16 17.82 17.71 18.23 17.66 17.72 17.97 16.39 16.04 18.91 17.09 17.61 17.06 16.78 17.09 17.39 17.76 16.81 19.23 17.36 17.41 18.01 17.3 17.92 18.15 18.68 16.27 17.11 18.66 17.0 A0A0G2K1B5 Rgs3 5 76.021841 54293 + 76.021841 76.161903 regulator of g-protein-signaling 3 SRB-RGS None None None None 17.01 15.62 17.56 16.68 16.67 16.32 17.29 16.35 16.88 16.44 16.53 15.91 16.1 16.11 15.54 16.06 15.56 17.77 17.06 17.02 17.08 17.35 16.67 15.65 16.62 16.07 17.52 16.48 15.87 16.92 17.72 P49797 Rgs3 5 76.021841 54293 + 76.021841 76.161903 regulator of g-protein signaling 3 None VQNSLRRRTHSEGSLLQEAR None 602189 32440 17.01 15.62 17.56 16.68 16.67 16.32 17.29 16.35 16.88 16.44 16.53 15.91 16.1 16.11 15.54 16.06 15.56 17.77 17.06 17.02 17.08 17.35 16.67 15.65 16.62 16.07 17.52 16.48 15.87 16.92 17.72 Q64240 Ambp 5 76.5680831 25377 - 76.5680831 76.578395 protein ambp None LQTCRTIAACNLPIVQGPCR None 176870 1234 15.11 14.93 15.73 17.23 16.26 16.24 17.1 17.05 16.58 16.41 16.36 17.18 16.97 15.63 16.48 16.19 15.72 16.47 15.34 17.01 16.62 14.87 17.06 16.68 14.74 16.06 15.35 15.54 16.24 15.96 15.85 P02764 Orm1 5 76.7727461 24614 + 76.7727461 76.776148 alpha-1-acid glycoprotein None QAVKDVGMDESEIVFVDWTK None 138600 57032 19.32 18.21 17.71 18.16 17.81 20.22 17.85 18.57 17.97 18.17 17.92 17.02 17.79 17.45 18.11 17.37 18.03 17.14 18.02 18.76 18.37 17.37 17.94 17.99 17.87 18.47 17.75 17.94 18.6 16.54 18.14 Q810W9 Whrn 5 76.8282781 313255 - 76.8282781 76.911127 whirlin None QILEVNGRSFLSILHDEAVK None 607928 None 15.68 15.43 15.13 16.39 16.38 15.25 15.92 15.81 14.88 14.58 15.02 15.0 13.93 14.86 14.62 15.57 14.98 16.4 15.02 16.54 14.25 14.88 16.37 16.12 17.09 16.78 15.7 15.13 15.24 15.37 16.58 B2GUV5 Atp6v1g1 5 76.9614631 298103 + 76.9614631 76.967642 v-type proton atpase subunit g None KNRRLKQAKEEAQAEIEQYR None 607296 31272 18.0 17.43 18.65 17.69 16.69 17.45 17.48 17.77 18.16 18.53 17.76 17.8 19.29 18.44 17.56 17.09 17.35 19.36 17.98 18.09 18.27 18.85 18.21 17.75 17.67 17.83 18.7 16.81 18.84 18.11 16.83 A0A0G2K1L0 Tnc 5 77.3758371 116640 - 77.3758371 77.460844 tenascin c None CSQRRCPNDCHNRGHCVQGK None 187380 55636 18.46 18.34 19.55 18.99 18.84 19.24 18.71 18.96 20.24 18.7 18.41 18.82 19.37 20.24 20.23 19.37 18.39 19.72 18.03 20.2 20.52 18.58 19.47 19.48 20.14 19.09 19.59 20.21 18.44 19.77 20.67 A0A0G2JYU3 Astn2 5 78.7581341 100361323 - 78.7581341 79.743873 astrotactin 2 None KITCEEKMVSMARNTYGETK None None None 16.42 15.39 16.26 17.61 16.79 15.72 16.04 15.68 18.18 17.33 17.54 17.25 17.24 17.39 16.03 15.96 16.49 17.38 18.16 16.85 18.44 17.03 17.66 16.62 16.92 16.57 17.06 16.92 18.21 17.86 17.5 Q66H79 Trim32 5 79.0051691 313264 + 79.0051691 79.016019 tripartite motif protein 32 None VLKIIDTAGLSEAVGLLMCR None 602290 36327 18.81 18.08 17.69 18.29 17.74 17.64 17.92 18.19 19.22 18.55 18.51 17.05 18.26 19.28 17.32 17.56 17.89 19.01 18.56 17.7 19.46 17.8 18.13 18.34 18.2 19.39 17.26 18.6 19.13 18.55 18.53 G3V6Q9 Brinp1 5 82.3484511 140610 - 82.3484511 82.550315 bmp/retinoic acid-inducible neural-specific protein 1 None YVHTTFISNEIRLDTFFDPR None 602865 8754 17.44 16.71 16.81 17.61 17.25 17.75 16.55 16.32 18.0 18.11 17.97 17.67 17.63 18.02 17.44 17.71 17.31 18.11 17.61 17.31 18.61 17.89 18.73 18.67 17.4 18.41 17.52 18.02 17.67 17.33 17.82 Q925T8 Brinp1 5 82.3484511 140610 - 82.3484511 82.550315 bmp/retinoic acid-inducible neural-specific protein 1 None NKGYKLYRGRCEPQNVDSER None 602865 8754 17.44 16.71 16.6 17.63 17.29 17.75 16.92 16.22 18.05 18.05 17.72 17.62 17.63 18.06 17.66 17.64 17.21 18.21 17.63 17.28 18.61 17.91 18.73 18.62 17.69 18.63 16.9 18.33 17.42 17.33 17.82 D4A3L3 Megf9 5 83.9935661 313270 - 83.9935661 84.105622 egf-like-domain, multiple 5 None KGEHCEECKEGFYQSPDAAR None None None 14.09 14.51 14.57 15.39 15.4 15.42 15.86 15.08 16.19 15.93 15.15 16.44 16.32 15.84 14.69 15.37 14.58 15.95 15.89 16.48 16.74 15.19 16.3 14.22 14.16 15.23 15.95 15.67 15.71 15.46 15.4 D3ZCM7 Tle1 5 85.8517891 362533 - 85.8517891 85.934576 tle family member 1, transcriptional corepressor None VYTGGKGCVKVWDISHPGNK None 600189 21058 16.34 17.57 15.17 15.71 16.14 17.73 15.27 14.36 16.86 17.51 15.05 16.43 14.82 16.35 16.56 16.29 15.64 16.43 15.39 17.21 17.81 16.42 15.72 16.41 15.35 16.23 16.13 15.69 17.74 15.62 16.81 D4AEL3 Dmac1 5 89.2426621 298147 - 89.2426621 89.243757 distal membrane arm assembly complex 1 None SNPPAKAAVSASSAQDPVLK None None None 15.45 13.34 15.38 15.73 15.33 14.45 15.44 14.41 16.33 16.54 14.11 16.13 15.52 15.51 17.05 16.05 15.02 15.53 14.94 14.99 16.61 15.05 15.91 15.82 14.57 15.53 16.06 16.43 13.91 15.66 16.21 M0RB22 Ptprd 5 90.0470321 313278 - 90.0470321 90.421237 protein-tyrosine-phosphatase None LLSWTPPRSDTIASYELVYR None None None 19.67 17.42 17.82 18.94 19.01 19.81 18.84 18.38 18.76 18.77 20.45 19.35 19.61 19.74 18.47 19.1 20.51 18.51 18.65 19.55 19.23 19.13 19.78 19.02 19.05 19.69 18.15 19.76 19.92 19.41 19.09 M0R8M9 Hspa8-ps14 5 155.9348191 - 155.9348191 155.936912 heat shock protein family A (Hsp70) member 8, pseudogene 14 None QTQTFTTYSDNQPGVLIQVYEGER None None None 25.76 25.77 24.49 24.93 26.13 23.9 24.52 25.94 24.23 25.17 24.8 24.1 24.9 24.64 23.93 25.19 25.23 25.18 23.78 26.28 23.17 24.03 25.16 25.09 25.97 25.54 23.92 25.04 25.46 24.93 24.69 A0A0G2K2Y8 Mpdz 5 95.7661161 29365 - 95.7661161 95.9205 multiple pdz domain protein None None None None 17.55 17.67 17.45 17.42 16.51 17.24 18.68 17.85 16.52 17.94 18.79 16.34 17.45 17.55 17.68 18.51 18.09 17.63 15.64 17.6 16.5 17.16 16.78 17.46 17.99 18.07 17.68 17.82 15.7 16.69 17.49 O55164 Mpdz 5 95.7661161 29365 - 95.7661161 95.9205 multiple pdz domain protein None DTGVFVSDIVKGGIADADGR None 603785 2841 17.69 17.71 17.53 17.46 16.76 17.35 18.68 17.78 16.53 17.92 18.77 16.33 17.23 17.51 17.77 18.29 18.07 17.67 15.68 17.46 16.45 17.05 16.72 17.46 18.02 18.11 17.68 17.82 15.7 16.8 17.54 O70185 Nfib 5 96.7650231 29227 - 96.7650231 96.97341 nuclear factor 1 None GYLEDSFVKSGVFNVSELVR None 600728 4087 16.34 16.08 17.08 16.26 16.74 16.72 15.91 16.72 17.4 15.54 15.98 17.59 17.05 16.94 16.44 16.53 15.5 16.91 18.18 16.68 18.07 16.28 16.28 16.65 17.08 16.43 16.57 17.13 17.82 17.18 18.23 D3ZC96 Ttc39b 5 97.6093931 298186 - 97.6093931 97.70807 tetratricopeptide repeat protein 39b None SMLPEEEVAVTKENVVSLFR None 613574 25228 17.18 14.94 17.93 17.87 17.25 15.3 15.87 17.57 16.94 17.01 17.2 15.77 17.69 16.64 16.58 16.06 16.52 17.2 18.13 16.27 16.7 16.96 17.49 16.83 18.03 16.95 17.64 17.11 17.29 17.35 17.09 F1SW39 Psip1 5 97.8470141 313323 - 97.8470141 97.879257 pc4 and sfrs1 interacting protein 1 None KQVDTEEAGVVTAATASNVK None 603620 13242 20.01 19.26 21.03 20.09 20.14 19.95 19.74 19.85 21.08 19.28 19.16 20.55 20.25 20.29 21.33 19.53 19.68 19.71 19.82 20.88 21.97 20.45 20.22 19.99 20.78 19.99 21.46 21.04 19.21 20.65 21.66 Q812D1 Psip1 5 97.8470141 313323 - 97.8470141 97.879257 pc4 and sfrs1-interacting protein None DFKPGDLIFAKMKGYPHWPA None 603620 13242 20.01 19.26 21.03 20.09 20.14 19.95 19.74 19.85 21.08 19.28 19.16 20.55 20.25 20.29 21.33 19.53 19.68 19.71 19.82 20.88 21.97 20.45 20.22 19.99 20.78 19.99 21.46 21.04 19.21 20.65 21.66 O35179 Sh3gl2 5 99.653191 116743 + 99.653191 99.8275 endophilin-a1 None GTKLDDDFKEMERKVDVTSR None 604465 20652 22.52 22.34 21.61 21.34 21.82 22.48 21.84 21.93 22.59 22.82 20.68 22.57 22.33 22.92 20.89 22.15 22.73 22.26 22.12 23.03 23.01 21.6 22.44 21.77 22.09 22.51 21.69 23.13 22.47 22.12 22.82 Q63486 Rraga 5 101.1133411 117044 + 101.1133411 101.114936 ras-related gtp-binding protein a None DLVQEDQRDLIFKEREEDLR None 612194 68522 17.61 17.29 17.79 17.71 16.53 18.17 17.73 18.6 17.76 17.64 16.38 17.79 17.89 16.66 17.65 18.38 17.93 18.07 17.55 16.44 17.12 17.82 17.04 17.94 16.57 18.91 16.39 17.36 19.06 16.6 18.81 A0A0G2K089 Dennd4c 5 101.2866461 313340 + 101.2866461 101.367883 denn domain-containing 4c None SYTVESSDEIKKTSDVQSVK None None 23057 15.96 17.49 17.06 17.28 16.59 14.93 15.84 16.12 15.98 16.05 15.71 15.32 15.25 14.62 15.09 16.68 16.31 16.07 15.9 16.76 15.67 16.36 15.21 16.01 16.87 16.09 16.98 16.62 14.95 15.61 15.88 P62755 Rps6 5 101.3717531 100911372 - 101.3717531 101.374043 40s ribosomal protein s6 None DALGEEWKGYVVRISGGNDK None None None 20.52 18.48 20.64 19.78 19.57 20.55 18.72 19.11 20.58 20.84 21.29 20.52 20.42 20.74 19.75 20.43 20.15 21.03 20.44 20.17 21.29 21.01 20.81 20.69 19.02 19.91 20.89 19.31 21.27 20.48 20.22 O54701 Slc24a2 5 101.4995121 84550 - 101.4995121 101.741753 sodium/potassium/calcium exchanger 2 None QAKASTAGDKEEPTLPNKPR None 609838 10669 20.39 19.67 17.83 19.0 19.7 20.26 18.39 18.48 19.58 20.16 19.66 19.75 18.85 19.52 19.48 19.64 18.9 18.97 20.09 18.78 19.71 18.61 20.31 19.24 19.03 19.42 18.65 19.8 20.61 19.43 18.84 F1LU27 Focad 5 102.5645811 313346 + 102.5645811 102.887959 focadhesin None YKRSTAWLWVRDMLTDEITK None None None 18.36 16.4 16.41 17.23 17.98 16.97 16.53 17.28 16.8 16.18 18.76 16.51 17.57 15.59 17.06 17.4 17.34 16.89 17.63 15.42 15.4 17.41 16.88 16.69 17.82 16.05 17.23 17.28 16.67 17.16 16.29 B5DEL5 Klhl9 5 103.3337471 313348 + 103.3337471 103.33793 kelch-like 9 (drosophila) None VNNFILKNFPALLSTGEFLK None None 23125 15.97 13.97 14.8 15.78 14.95 16.14 14.35 15.71 15.69 15.37 16.23 14.98 16.09 14.63 15.34 15.76 15.26 15.71 15.52 14.61 15.62 15.26 15.93 15.12 15.13 14.29 15.83 14.66 16.72 15.55 15.52 A0A0G2K583 Mtap 5 103.8730211 298227 + 103.8730211 103.939406 s-methyl-5'-thioadenosine phosphorylase None KKLGLRCHSKGTIVTIEGPR None 156540 1838 17.56 16.2 19.0 17.49 19.38 17.82 18.56 18.67 17.72 17.45 18.99 16.82 18.62 17.48 17.24 17.76 17.23 18.13 18.08 19.57 17.61 17.28 18.8 16.51 18.41 17.29 17.74 18.39 18.61 18.2 18.19 Q7TP15 Mtap 5 103.8730211 298227 + 103.8730211 103.939406 s-methyl-5'-thioadenosine phosphorylase None SHCSARGVCHIPMAEPFCPK None 156540 1838 17.82 15.93 18.91 17.32 19.46 17.69 18.82 18.63 17.63 17.36 18.9 16.73 18.45 17.39 17.77 17.68 17.13 17.78 17.94 19.32 17.37 17.17 18.64 16.65 18.32 17.2 17.25 18.13 18.51 18.26 18.15 G3V6U4 Elavl2 5 105.9608711 286973 - 105.9608711 106.109617 elav-like protein None SKTNLIVNYLPQNMTQEELK None 601673 20930 19.31 19.86 19.22 19.91 20.13 17.53 17.99 20.39 19.05 20.31 19.39 18.61 19.23 18.69 20.19 19.38 20.09 19.06 18.97 18.85 18.46 18.35 18.71 20.01 19.74 19.22 20.23 18.29 19.79 19.18 19.57 Q8CH84 Elavl2 5 105.9608711 286973 - 105.9608711 106.109617 elav-like protein 2 None RDKITGQSLGYGFVNYIDPK None 601673 20930 19.5 19.97 19.38 19.9 20.14 17.6 17.96 20.43 19.26 20.28 19.06 18.57 18.89 18.69 20.28 19.36 19.83 19.01 19.33 18.71 18.51 18.32 18.44 19.98 19.7 19.13 20.24 18.33 19.77 19.25 20.14 G3V6Y7 Caap1 5 109.3619131 500501 - 109.3619131 109.414243 caspase activity and apoptosis inhibitor 1 None ERDIEKSVNEILGLVESSPK None None None 15.7 14.12 15.94 16.09 16.0 15.42 15.6 15.72 16.8 15.43 15.1 17.27 16.19 16.3 15.48 15.21 15.96 15.68 16.37 15.72 17.03 16.28 16.64 15.85 15.97 15.16 15.93 14.82 17.49 16.31 16.97 P54319 Plaa 5 109.4302821 116645 - 109.4302821 109.460289 phospholipase a-2-activating protein None GQTLGLGNTSFSDPFTGGGR None None 3138 19.85 17.54 20.11 17.95 18.69 20.12 19.78 18.76 18.86 19.13 20.21 18.29 19.78 19.43 19.45 18.7 19.34 19.21 20.01 18.38 20.92 20.17 19.75 19.17 19.42 19.08 19.57 20.08 17.8 19.77 19.74 Q5XIR2 Ift74 5 109.4742811 313365 + 109.4742811 109.563838 intraflagellar transport 74 None ENSVYLSYEKRAETLAVEIK None None 11831 16.11 16.18 17.43 17.03 15.9 16.85 16.24 15.67 16.56 16.15 17.09 15.81 15.87 17.15 15.59 15.7 16.1 17.06 15.98 17.35 17.11 16.65 15.77 15.72 16.46 15.49 16.69 16.22 17.03 16.92 16.49 F1LSP9 Fggy 5 110.3988721 298250 + 110.3988721 110.786014 fggy carbohydrate kinase domain-containing None FLSWKATGVTARSLCSLVCK None None 49535 16.07 17.3 15.21 16.5 15.76 15.9 16.89 16.7 17.78 16.47 15.2 15.66 15.27 16.36 16.57 15.81 14.86 15.8 15.14 17.5 15.53 15.47 15.39 15.14 15.58 15.72 15.65 17.02 14.72 15.25 15.75 D3ZB48 Hook1 5 110.8245021 313370 + 110.8245021 110.887787 hook homolog 1 (drosophila) None QPDISQNAQKISELEAALQK None 607820 9289 17.57 15.38 17.42 17.29 16.18 18.09 16.9 16.13 18.63 16.42 18.35 16.52 18.28 17.57 16.91 17.87 18.53 17.98 18.08 15.82 17.8 18.72 18.17 17.29 16.52 18.16 17.39 16.5 18.75 17.77 17.03 F1M032 Cyp2j10 5 110.9082741 313373 - 110.9082741 111.244789 cytochrome p450, family 2, subfamily j, polypeptide 10 None NHRRDWDPDEPRDFIDAFLK None None 133195 16.9 14.46 17.37 16.82 17.26 16.31 16.19 16.96 16.53 15.1 16.62 16.07 16.97 15.77 15.6 16.53 16.6 17.24 17.87 15.86 15.8 16.59 16.85 15.79 17.29 16.09 16.28 15.88 18.15 17.39 17.05 P09414 Nfia 5 112.4457831 25492 + 112.4457831 112.775903 nuclear factor 1 a-type None MSPGAMRRSLPSTSSTSSTK None 600727 4086 16.9 15.14 16.99 16.38 17.01 16.76 15.99 16.79 17.17 15.81 16.14 17.81 17.27 17.03 17.15 16.6 15.77 16.93 17.81 17.02 18.07 16.32 16.95 17.57 17.24 16.68 17.13 16.72 17.19 17.52 17.99 F1MAD2 Patj 5 113.0757481 140581 + 113.0757481 113.371704 inad-like protein None DEAQYRDEENLEVFLVDLQK None None None 16.93 16.39 17.42 16.42 17.4 17.13 17.89 16.76 17.15 16.84 16.52 18.2 16.97 17.87 18.41 16.49 16.13 16.91 16.33 18.15 18.73 16.78 16.57 17.34 17.05 16.63 18.12 16.67 15.84 17.49 18.89 D4A6X3 Kank4 5 113.401491 313385 - 113.401491 113.465303 kn motif and ankyrin repeat domains 4 None DHQNKAGYTAVMITPLASPK None None 18244 18.16 17.4 16.95 16.71 17.55 17.43 17.4 17.09 16.67 16.96 18.58 15.92 16.38 16.8 17.26 17.9 17.86 16.47 16.7 17.15 16.3 16.48 16.91 17.13 17.71 17.21 17.26 16.8 16.25 16.9 16.6 A0A0G2K3H2 Dock7 5 113.6001991 313388 - 113.6001991 113.782785 dedicator of cytokinesis 7 None MAERRAFAQKISRTVAAEVR None None 23566 18.6 16.65 19.56 19.13 17.63 18.33 18.96 18.43 18.31 18.59 19.42 17.77 18.82 18.41 19.32 18.06 19.25 18.09 18.86 17.5 19.56 18.75 18.35 18.92 18.73 18.32 19.27 18.37 17.66 19.2 19.82 F1M3M0 Atg4c 5 113.8815441 313391 + 113.8815441 113.934307 cysteine protease None LVPVRLGGERTNIDYLEFVK None None 56296 14.66 16.36 14.56 15.6 15.44 16.16 16.78 15.06 15.38 16.7 14.55 15.29 14.48 14.89 14.25 14.88 14.94 15.97 16.03 14.8 15.87 14.35 14.57 14.26 14.4 14.68 15.72 15.06 14.65 14.9 15.15 P38652 Pgm1 5 114.5952991 24645 + 114.5952991 114.654728 phosphoglucomutase-1 None FGIKFNISNGGPAPEAITDK None 171900 1979 20.32 19.57 21.79 19.68 20.79 19.46 20.84 19.5 20.06 19.4 19.44 20.29 19.97 20.65 18.57 19.06 19.66 20.69 20.47 21.42 20.98 20.42 20.17 20.13 19.46 20.09 20.01 19.91 19.65 20.18 21.56 Q499Q4 Pgm1 5 114.5952991 24645 + 114.5952991 114.654728 phosphoglucomutase-1 None ANKMMKDLEALMLDRSFVGK None 171900 1979 20.57 20.34 21.81 19.85 21.06 19.44 21.08 19.88 20.2 19.83 19.31 20.41 20.01 20.67 18.85 19.33 19.85 20.97 20.6 21.7 21.1 20.65 20.17 20.45 19.83 20.67 20.21 20.06 19.89 20.21 21.89 D4ADK4 Cachd1 5 115.5318661 298267 + 115.5318661 115.63662 cache domain-containing 1 None ITHKEPLVANDILNHPNFVK None None 10854 15.87 14.41 16.84 16.18 15.38 16.27 17.38 15.28 15.38 15.93 16.32 15.12 16.26 15.93 15.46 16.01 15.84 16.59 14.81 16.98 16.15 16.26 16.11 15.86 16.27 16.84 16.17 15.75 14.93 16.74 16.57 G3V9W2 Jak1 5 115.7806891 84598 - 115.7806891 115.8814 tyrosine-protein kinase None LKRCCQPKPREISNLLVATK None 147795 1678 16.11 15.85 16.09 16.14 16.34 16.53 16.59 16.0 16.02 16.12 16.3 16.2 16.12 17.02 17.13 16.09 16.87 16.28 16.72 15.41 18.36 16.05 16.0 17.04 17.83 17.99 16.94 16.15 16.02 16.85 17.88 Q9WUS0 Ak4 5 116.0396341 29223 + 116.0396341 116.095808 adenylate kinase 4 None SGHLLRENLKTNTEVGDVAK None None None 18.98 18.97 18.2 19.32 19.6 18.38 19.28 19.47 18.59 18.21 18.02 19.36 19.56 18.67 19.6 19.45 19.05 18.78 19.62 18.03 18.08 18.19 17.9 19.28 19.93 19.8 19.63 19.51 17.52 18.6 20.81 A0A0G2JY26 Dnajc6 5 116.1305881 313409 + 116.1305881 116.28342 dnaj heat shock protein family (hsp40) member c6 None EMAKEMDPEKLKILEWIEGK None 608375 8865 19.4 21.94 20.31 21.19 20.41 20.72 21.14 21.22 21.24 22.24 19.63 21.08 21.38 20.28 20.8 21.34 21.27 20.98 21.65 19.35 20.5 20.89 21.52 20.21 20.05 21.5 21.16 21.78 20.13 19.98 20.07 P14646 Pde4b 5 117.1861171 24626 + 117.1861171 117.367683 camp-specific 3',5'-cyclic phosphodiesterase 4b None DRIQVLRNMVHCADLSNPTK None 600127 1953 18.31 15.84 16.91 16.66 17.62 18.02 16.93 17.54 17.86 17.43 16.81 18.51 18.12 18.29 17.45 17.19 18.63 17.89 18.72 16.38 17.98 18.58 18.07 17.81 18.06 17.56 17.63 17.81 18.48 18.23 18.26 P0DJJ3 Sgip1 5 117.6266221 313413 + 117.6266221 117.727313 sh3-containing grb2-like protein 3-interacting protein 1 None LEHVLPNPQLLCCDNTQNDANTK None 611540 13001 20.56 21.57 20.07 19.91 19.57 20.89 20.41 19.33 20.68 21.36 19.84 20.54 20.55 21.18 19.58 20.29 19.88 20.9 20.0 21.54 21.08 20.84 20.54 19.28 19.38 20.96 20.57 21.24 20.19 20.16 20.0 Q8CJH2 Dab1 5 119.1410541 266729 + 119.1410541 119.51457 disabled homolog 1 None HRFVAIKTAQAAEPVILDLR None 603448 32084 15.11 17.57 16.86 17.45 17.47 16.12 15.91 17.79 16.87 16.43 14.88 18.29 17.4 16.06 15.6 17.42 17.12 16.67 17.37 16.33 15.53 16.21 16.42 17.92 16.28 17.26 17.76 16.56 15.55 16.2 16.8 P55314 C8b 5 119.5350761 313421 + 119.5350761 119.572563 complement component c8 beta chain None MEVSSCRCAPCRNNGVPILK None 120960 48 16.71 13.7 15.68 16.85 15.56 15.63 16.97 16.08 16.55 16.71 16.02 14.63 16.24 15.01 16.05 14.98 15.44 15.68 15.08 16.72 16.61 14.82 16.02 15.36 14.88 15.37 15.19 15.6 15.51 15.32 15.7 D3ZWD6 C8a 5 119.58311 298288 - 119.58311 119.637753 complement c8 alpha chain None GDGNQDKRKKDLAVEDIISR None 120950 472 17.27 15.27 15.74 16.08 15.68 15.34 16.72 16.31 15.01 15.37 17.28 15.54 15.47 15.46 15.97 14.62 15.14 15.74 15.08 16.27 16.4 14.55 15.86 16.06 15.44 15.67 14.39 15.26 15.69 14.99 14.81 Q09137 Prkaa2 5 119.8132271 78975 - 119.8132271 119.87937 5'-amp-activated protein kinase catalytic subunit alpha-2 None GGELFDYICKHGRVEEVEAR None 600497 4551 17.86 16.78 17.27 17.51 16.84 18.34 17.75 17.3 17.6 18.32 18.06 17.04 17.96 17.74 18.25 17.5 17.69 17.35 18.37 16.05 18.51 17.53 18.37 17.92 17.29 17.97 18.23 17.53 16.62 17.38 17.44 P97544 Plpp3 5 119.9270861 192270 + 119.9270861 120.002205 phospholipid phosphatase 3 None ETSTIKPYRRGFYCNDESIK None None 15410 18.03 19.67 20.26 19.59 19.08 19.39 20.12 19.34 19.66 19.34 18.75 20.21 19.46 20.66 20.44 19.4 19.51 19.14 19.47 20.3 20.87 19.04 20.02 19.65 19.72 19.64 19.3 19.7 19.56 20.75 20.71 D4A412 Rpl32 5 120.6315411 - 120.6315411 120.631923 ribosomal protein L32 None VRRRFKGQILMPNIGYGSNK None None None 15.95 17.24 16.74 16.96 17.19 17.73 16.04 17.39 17.7 18.23 16.68 18.1 18.02 17.83 17.42 17.25 18.19 17.47 16.61 17.68 18.62 17.47 18.05 18.45 16.18 17.91 18.22 16.51 17.92 16.97 16.94 F1LWX2 Rpl29 5 121.0467491 - 121.0467491 121.047171 60s ribosomal protein l29 None KAEATAPAKAQAKAPAQAPK None None None 16.69 18.41 16.79 16.97 17.5 16.72 15.34 17.62 16.25 18.08 17.6 16.26 16.33 16.58 17.26 17.32 17.97 16.93 15.46 17.03 16.35 16.16 16.25 17.68 17.16 17.16 17.3 16.34 18.03 16.66 16.54 F1LSM0 Usp24 5 121.0807631 313427 + 121.0807631 121.210311 ubiquitin-specific peptidase 24 None LLAGHLRLIKTLLSLCGAEK None 610569 35420 18.39 17.32 17.74 17.56 17.75 17.48 18.42 17.84 17.72 17.08 17.1 18.06 18.69 17.85 18.47 17.79 18.01 18.12 18.71 16.52 18.16 18.91 16.38 18.13 18.75 19.61 18.36 18.52 16.91 18.33 19.12 Q5M7W7 Pars2 5 121.4340971 313429 + 121.4340971 121.439154 probable proline--trna ligase None YDDVTEALPQLRGEVLLDDR None None None 17.66 15.99 16.18 16.76 18.4 18.22 17.15 15.87 17.72 16.59 17.81 18.16 18.36 16.92 17.64 16.86 18.25 18.01 17.54 15.76 17.56 18.29 17.7 16.65 16.37 17.31 16.25 18.31 18.54 16.64 18.68 A0A140UHY1 Ttc4 5 121.444061 362556 - 121.444061 121.462339 tetratricopeptide repeat domain 4 None LKHFAEAVNWCDEGLQIDAK None None None 16.17 13.67 15.18 15.91 15.36 15.59 16.56 15.49 14.81 14.6 16.85 15.22 16.15 16.16 13.98 15.14 16.06 15.7 15.54 16.53 14.9 15.73 16.1 15.9 16.48 15.68 14.74 15.37 15.04 16.19 15.61 F1LX28 Acot11 5 121.5273931 100363074 - 121.5273931 121.575702 acyl-coa thioesterase 11 None SVSHPESGDASAMAEGEGYR None None None 18.58 18.62 17.2 18.49 18.7 17.61 18.53 17.84 17.58 17.53 18.57 18.09 18.13 17.57 18.69 17.78 17.84 17.11 18.83 18.08 18.16 17.6 16.93 18.76 18.44 18.83 17.97 18.39 16.66 18.8 18.08 Q6AXT0 Mrpl37 5 121.8298341 56281 - 121.8298341 121.846164 39s ribosomal protein l37 None GWIDPRFHRAAPIHEQPLYK None 611843 9536 15.63 17.05 16.44 16.9 15.79 16.59 15.17 16.67 15.95 15.34 15.76 15.89 16.07 16.81 17.38 15.85 15.85 16.53 16.64 15.14 16.6 15.79 16.15 17.05 17.45 17.12 17.51 17.14 15.68 15.91 18.0 A0A0G2K664 Hspb11 5 122.0362151 685284 + 122.0362151 122.062421 heat shock protein family b (small), member 11 None VEKDLVHTEGQLQNEEIMAR None None 22947 15.99 14.16 17.25 15.93 15.43 15.92 16.06 15.14 15.42 15.58 16.5 15.17 15.84 15.89 14.38 15.43 15.78 16.41 16.36 16.57 16.15 16.85 16.5 15.68 16.75 15.78 15.5 15.99 16.33 16.57 16.19 D3ZE75 Lrp8 5 122.5636411 362558 + 122.5636411 122.635439 ldl receptor-related protein 8 None HIYWTDSGNKTVSVATTDGR None None None 15.81 17.22 15.49 15.94 15.72 15.97 16.13 14.77 17.04 15.42 15.36 17.08 15.24 16.01 16.34 16.73 15.06 16.13 15.75 16.29 17.65 15.55 15.33 14.6 15.81 16.02 15.37 16.84 16.84 15.36 16.61 Q27W02 Magoh 5 122.6392841 298385 + 122.6392841 122.646636 protein mago nashi homolog None VHKSVMEELKRIIDDSEITK None 602603 1776 17.07 15.4 17.72 16.77 17.93 17.7 16.06 16.67 18.03 16.4 17.3 17.66 17.26 17.05 17.83 15.7 16.39 16.84 17.14 17.6 18.04 17.56 17.24 17.17 16.39 16.16 18.45 15.93 17.77 17.22 18.64 Q498R7 Czib 5 122.6484521 298384 + 122.6484521 122.656326 cxxc motif containing zinc binding protein None GTVFSDINLQEKDWTDYDEK None None 41206 20.17 18.11 19.92 19.7 20.49 19.32 18.93 19.62 18.69 18.15 21.04 19.68 20.15 18.17 18.34 19.63 19.8 20.58 19.77 19.98 18.5 21.04 20.08 20.08 19.82 19.97 19.64 19.99 19.38 20.0 19.94 G3V7N5 Cpt2 5 122.6646491 25413 - 122.6646491 122.682119 carnitine o-palmitoyltransferase 2 None CSKYHGQLTKEAAMGQGFDR None 600650 77 19.97 18.8 20.37 20.01 20.37 17.9 18.56 19.64 19.2 18.34 19.55 20.06 19.68 18.67 18.68 19.68 19.09 20.39 19.41 19.98 19.23 19.22 18.89 20.75 19.62 19.17 20.15 18.59 19.25 19.29 20.6 P18886 Cpt2 5 122.6646491 25413 - 122.6646491 122.682119 carnitine o-palmitoyltransferase 2 None YILSDSSPVPEFPVAYLTSENR None 600650 77 19.97 18.8 20.38 20.01 20.37 17.9 18.56 19.64 19.26 18.26 19.58 20.09 19.68 18.67 18.68 19.68 19.09 20.39 19.41 19.98 19.23 19.22 18.89 20.75 19.53 19.23 20.15 18.59 19.25 19.29 20.6 P11915 Scp2 5 122.7793761 25541 - 122.7793761 122.881295 non-specific lipid-transfer protein None KADCTITMADSDLLALMTGK None 608661 17803 21.11 20.52 21.14 20.73 21.3 19.85 21.09 20.25 20.98 21.79 19.98 20.06 20.19 20.42 19.8 19.98 19.72 21.26 21.15 21.99 21.08 21.31 19.49 20.28 20.73 20.54 21.87 20.32 20.34 21.89 21.62 Q6QI48 Scp2 5 122.7793761 25541 - 122.7793761 122.881295 lrrgt00160 NSLIPTR; SCPx None None None None 20.08 21.19 20.71 19.6 20.34 18.47 20.15 20.09 20.34 20.24 19.07 19.78 19.73 18.93 18.4 20.06 19.78 21.32 20.31 19.63 19.86 20.52 18.83 20.04 19.65 19.72 20.11 20.06 19.06 19.41 20.29 F1M8P2 Zyg11b 5 122.9920961 362559 - 122.9920961 123.022798 zyg-11 family member b, cell cycle regulator None ILDVVRELKHLNHLDISDDK None None 14600 18.12 16.14 17.87 17.63 16.89 18.92 18.02 17.09 17.93 16.95 17.28 18.55 18.13 18.58 18.42 16.81 17.89 17.64 18.08 16.2 19.02 18.27 18.14 17.53 18.34 17.37 17.67 18.52 16.88 18.31 18.3 D4AC65 Coa7 5 123.0693721 298377 + 123.0693721 123.080199 cytochrome c oxidase assembly factor 7 None EKYGHGDSCYKLGGYYVTGK None None None 18.46 20.03 18.52 17.9 18.07 16.73 16.89 17.78 18.18 18.07 19.0 17.73 17.58 18.34 17.05 18.69 18.72 18.2 17.53 19.0 17.56 19.68 17.72 18.91 17.77 19.24 18.15 19.07 18.03 17.22 17.94 A0A0G2JZ04 Tut4 5 123.2222241 313481 + 123.2222241 123.305946 terminal uridylyl transferase 4 None LSPPCSEQHNREQILIGLEK None 613692 35279 16.76 14.25 15.72 17.02 17.1 16.42 17.09 17.35 16.01 15.17 15.94 15.72 16.21 15.66 16.99 15.79 15.62 15.84 16.79 16.15 14.72 15.29 15.98 14.67 17.86 16.84 16.21 17.02 16.09 16.98 17.6 D3ZGL5 Prpf38a 5 123.3124621 298374 - 123.3124621 123.32416 pre-mrna-splicing factor 38a None LTLKMLQIQPEKDIIVEFIK None None 13146 15.77 13.69 15.52 15.12 15.94 16.08 14.46 14.9 15.58 15.33 15.52 16.5 16.0 15.78 16.49 14.88 15.16 15.76 15.58 16.33 17.66 15.89 15.79 16.28 16.44 14.6 16.58 14.59 16.3 16.28 17.01 Q5FVK6 Cc2d1b 5 123.3532931 313478 + 123.3532931 123.367318 coiled-coil and c2 domain-containing protein 1b None HHEDLRLSQKAEEVYAQLQK None None 70951 18.52 16.49 17.34 17.67 18.09 16.73 17.67 18.67 16.21 17.17 18.19 16.44 17.23 17.13 17.06 17.55 17.25 17.52 16.35 18.58 15.79 16.82 17.31 17.28 19.08 17.79 17.21 16.65 17.65 18.1 16.25 D3ZDC7 Zfyve9 5 123.3724911 313477 - 123.3724911 123.470528 zinc finger fyve domain-containing protein None KADAEDPQEQIHIQWVDDDK None None 3527 17.55 15.01 16.97 16.61 17.15 15.72 15.64 16.41 17.1 15.22 16.97 17.19 16.94 16.76 15.48 16.21 17.57 17.03 17.22 15.31 16.3 17.3 17.44 17.05 16.13 17.09 15.72 18.06 16.23 15.96 16.28 D4A3I4 Btf3l4 5 123.5694581 366434 - 123.5694581 123.583749 transcription factor btf3 None APKPEDIDEEDDDVPDLVENFDEASK None None 40477 19.27 17.19 19.3 19.54 18.59 17.71 17.52 17.84 19.46 18.51 20.03 20.01 19.46 19.28 18.44 18.57 19.46 19.41 19.39 18.52 19.8 19.2 19.55 19.66 18.61 17.8 19.78 18.15 19.4 19.37 19.17 Q498E0 Txndc12 5 123.5877051 298370 + 123.5877051 123.612889 thioredoxin domain-containing protein 12 None EDGKKEAAASGLPLMVIIHK None 609448 6347 18.28 16.92 18.87 17.38 17.98 16.72 17.34 17.97 17.8 17.47 17.59 17.8 17.85 18.34 18.75 17.76 17.05 18.76 17.54 18.56 19.31 17.93 17.34 18.44 18.99 17.56 17.92 18.59 18.13 19.32 18.68 Q5I0L7 Kti12 5 123.601061 685656 + 123.601061 123.602581 protein kti12 homolog None WDRPLFTVVGLEEPLPLAEIR None None 6347 15.14 15.48 14.53 15.78 15.39 13.78 15.14 16.02 14.87 13.35 15.02 16.52 15.25 14.15 13.6 15.45 14.49 15.65 15.62 15.57 14.38 15.41 15.46 15.66 14.79 16.1 14.47 15.95 13.95 14.46 14.65 Q63941 Rab3b 5 123.6304171 81755 + 123.6304171 123.697428 ras-related protein rab-3b None QIWDTAGQERYRTITTAYYR None 179510 2149 20.12 18.98 20.27 20.53 19.18 18.38 20.06 20.11 20.08 19.44 19.8 19.67 20.33 18.96 19.71 20.0 20.08 20.47 20.56 18.25 19.93 20.65 20.31 19.95 19.32 21.0 19.85 20.58 18.37 19.48 20.28 D3ZQ59 Nrdc 5 123.7557861 25499 + 123.7557861 123.818759 nardilysin Nrd1 None None None None 18.49 19.04 18.42 18.43 16.96 17.6 17.01 17.46 18.34 18.4 18.65 18.1 17.9 18.75 16.98 17.6 17.68 18.95 18.86 18.22 19.59 18.71 17.78 18.3 18.08 17.86 18.22 18.92 17.86 17.47 18.69 P47245 Nrdc 5 123.7557861 25499 + 123.7557861 123.818759 nardilysin None MVFMGSLKYPDENGFDAFLK None 602651 68260 18.49 19.04 18.42 18.43 16.96 17.6 17.01 17.46 18.34 18.4 18.65 18.1 17.9 18.75 16.98 17.6 17.68 18.95 18.86 18.22 19.59 18.71 17.78 18.3 18.08 17.86 18.22 18.92 17.86 17.47 18.69 F1LRE5 Osbpl9 5 123.8195031 298369 - 123.8195031 123.962177 oxysterol-binding protein None PFYGGKKHRITAEIFSPNDK None 606737 69380 18.57 15.92 17.93 18.56 17.07 16.75 17.4 17.08 18.25 17.49 19.24 16.78 17.83 17.49 17.86 17.62 18.24 17.66 18.09 16.23 16.83 18.83 18.14 18.43 16.07 17.47 17.88 18.21 16.03 17.72 18.08 E9PSY8 Eps15 5 124.0460521 313474 + 124.0460521 124.143871 epidermal growth factor receptor pathway substrate 15 None DPFKDDPFGKIDPFGGDPFK None 600051 128359 19.84 17.42 18.92 18.12 19.42 18.65 17.6 19.41 18.22 17.33 20.17 18.67 18.52 18.29 17.61 19.25 18.46 18.78 19.01 19.18 18.0 17.69 18.72 18.93 19.14 17.84 18.73 18.8 18.46 19.54 18.78 A0A0G2JZP9 Rnf11l1 5 124.2136781 100364162 - 124.2136781 124.234908 ring finger protein 11-like 1 None HPTPSQTRLATQLTEEEQIR None None None 15.38 16.66 16.93 15.86 15.37 15.94 16.0 14.09 16.06 15.42 16.1 14.35 14.98 16.25 14.22 16.5 16.15 16.6 15.88 15.96 16.14 16.03 16.28 15.72 16.52 16.16 14.96 15.47 16.97 15.13 14.99 F1LSQ0 Faf1 5 124.50421 140657 + 124.50421 124.789843 fas-associated factor 1 None None None None 18.02 15.99 18.35 18.56 18.09 16.74 18.5 17.93 17.15 16.62 18.56 17.65 18.34 16.89 16.51 17.91 18.28 18.04 17.34 18.87 16.76 17.56 18.1 17.08 17.89 17.96 17.39 18.15 16.81 18.33 18.17 Q924K2 Faf1 5 124.50421 140657 + 124.50421 124.789843 fas-associated factor 1 None EFKLLSTFPRRDVTQLDPNK None None 5120 18.02 15.99 18.35 18.56 18.09 16.74 18.57 17.93 17.15 16.62 18.56 17.65 18.34 16.89 16.51 17.91 18.28 18.04 17.34 18.87 16.76 17.56 18.1 16.96 17.89 17.96 17.38 18.13 16.91 18.33 18.17 O09032 Elavl4 5 125.0568341 432358 - 125.0568341 125.139166 elav-like protein 4 None NPSQKSSQALLSQLYQSPNR None 168360 40729 19.22 20.14 19.43 19.92 20.21 17.77 17.95 20.47 19.86 19.72 18.44 19.35 19.09 19.02 20.37 19.11 20.1 18.85 19.33 18.76 18.91 18.17 18.58 20.09 19.71 18.91 20.2 18.46 19.86 19.33 20.26 Q4KM73 Cmpk1 5 128.4803151 298410 - 128.4803151 128.50783 ump-cmp kinase None ITISLLKREMDQTMAANAQK None 191710 32308 20.86 19.02 20.63 20.1 21.87 19.49 20.81 19.58 19.65 18.16 20.53 20.1 20.9 19.52 19.12 20.28 19.75 21.13 20.73 19.43 19.51 19.2 20.36 20.04 20.64 20.36 20.21 20.79 18.23 20.14 20.51 D3ZTM7 Efcab14 5 129.2182171 298425 + 129.2182171 129.258721 ef-hand calcium-binding domain 14 None KPISLPGISSIKDLQDLFHK None None None 15.28 13.38 15.47 14.68 14.4 16.05 15.29 15.69 13.85 14.72 16.3 15.09 15.39 15.62 14.64 15.29 14.89 14.33 14.74 16.11 14.82 15.29 15.67 14.17 16.18 14.22 15.13 14.35 16.64 15.73 15.64 D3ZY50 Atpaf1 5 129.2663951 313510 + 129.2663951 129.293561 atp synthase mitochondrial f1 complex assembly factor 1 None FKYMSVIAELEQSGLGAELK None None 41492 19.3 18.41 16.83 18.72 18.9 16.39 17.13 18.29 17.59 18.9 18.76 17.39 17.74 17.87 16.31 18.35 18.36 18.39 18.36 18.25 16.82 17.15 18.02 17.5 18.71 18.14 19.07 18.19 17.37 17.48 17.56 Q4G050 Mknk1 5 129.3181861 500526 + 129.3181861 129.357647 map kinase-interacting serine/threonine-protein kinase 1 None LEASRVVRDVATALDFLHTK None 606724 37838 16.53 15.48 16.39 16.44 16.5 15.47 15.87 14.96 15.5 14.6 16.8 16.15 15.63 15.11 14.64 16.28 15.22 16.12 16.67 14.86 15.71 14.52 16.47 15.49 15.8 14.86 15.13 17.24 14.39 15.04 15.66 P97612 Faah 5 129.4798011 100911581 - 129.4798011 129.498701 fatty-acid amide hydrolase 1 None MRPRSAEKLWKLQHEIEMYR None None None 17.42 16.62 17.08 17.67 17.79 18.19 17.79 17.98 18.19 17.98 17.44 19.42 19.09 18.43 17.75 18.6 17.58 18.32 18.13 18.52 18.93 17.65 18.81 16.87 17.62 18.54 18.21 18.02 19.26 18.0 18.18 Q5M9I5 Uqcrh 5 129.5459831 366448 - 129.5459831 129.554173 cytochrome b-c1 complex subunit 6 None CEQLEKCVKARERLESCDRR None None 103848 20.38 21.23 21.01 20.34 20.64 19.94 21.38 19.48 21.47 21.87 21.65 20.87 20.7 20.79 20.95 21.39 21.99 20.14 20.55 20.68 21.93 21.79 21.07 20.3 20.21 19.83 19.89 21.3 21.24 20.59 20.11 D4A8G3 Lurap1 5 129.6189271 500527 - 129.6189271 129.628651 leucine rich adaptor protein 1 None AKVIPSEDRARTEVDMTSTK None None None 15.37 16.71 16.24 15.02 16.4 15.55 16.11 15.07 16.53 14.28 15.61 16.73 14.85 16.87 15.2 15.65 16.82 15.19 16.97 15.31 16.0 16.63 16.42 14.86 16.18 15.7 15.0 16.47 16.9 16.65 15.26 Q63789 Pik3r3 5 129.7012011 60664 + 129.7012011 129.769446 phosphatidylinositol 3-kinase regulatory subunit gamma None TSQEIQMKRTAIEAFNETIK None 606076 2690 16.53 13.83 14.93 16.0 15.29 17.52 16.62 15.18 16.27 16.75 15.72 16.85 16.61 16.04 17.27 16.16 15.9 16.6 16.38 14.64 17.01 16.5 16.35 15.81 15.09 15.5 15.64 16.99 15.64 16.55 16.61 A0A0G2K212 Mast2 5 129.7762661 313819 - 129.7762661 129.915183 non-specific serine/threonine protein kinase None None None None 13.96 14.73 14.95 14.45 14.73 15.62 15.6 14.53 15.62 15.79 15.41 16.47 16.32 15.58 16.28 15.69 15.69 15.82 15.17 14.09 16.14 16.4 16.22 14.91 13.96 16.28 14.63 16.45 15.98 15.32 15.15 Q66HD3 Nasp 5 130.0578451 298441 - 130.0578451 130.082998 nuclear autoantigenic sperm protein None KMESLDVDSEAKKLLGLGQK None None 133894 17.54 16.63 18.7 18.07 18.13 17.63 17.33 16.51 18.1 15.92 17.9 17.76 17.88 17.62 16.25 17.55 18.08 18.88 18.31 17.62 19.25 17.37 18.74 18.68 18.91 17.85 17.0 18.48 17.3 17.38 18.82 P51635 Akr1a1 5 130.0929471 78959 - 130.0929471 130.109704 aldo-keto reductase family 1 member a1 None DNPFPKNADGTVKYDSTHYK None 103830 74565 22.08 21.27 20.8 21.36 20.61 21.41 22.24 21.75 20.45 20.64 20.38 20.44 21.04 20.38 19.78 21.07 20.72 21.49 20.92 22.41 20.12 21.39 20.11 20.02 21.64 22.28 21.31 21.02 20.49 21.71 21.21 Q63716 Prdx1 5 130.1472771 117254 + 130.1472771 130.162854 peroxiredoxin-1 None IGHPAPSFKATAVMPDGQFK None None 99789 23.16 24.73 23.23 22.4 23.35 23.17 23.44 24.15 21.78 23.47 22.95 21.36 22.25 22.1 22.27 23.01 22.29 22.73 22.14 24.31 21.72 22.53 21.85 22.68 23.09 23.39 23.29 21.53 23.15 22.61 22.73 F1LVZ9 Hectd3 5 130.4699441 313525 + 130.4699441 130.477762 hect domain e3 ubiquitin protein ligase 3 None SRQRELGLNADLFQPASLVR None None None 17.81 15.25 16.28 17.43 17.47 16.61 17.73 18.41 16.03 16.4 16.4 17.36 17.51 16.53 17.5 17.83 17.05 16.34 18.17 16.04 15.37 16.69 17.0 16.59 18.0 18.45 17.4 17.16 16.57 17.23 17.93 P70541 Eif2b3 5 130.4922351 171145 + 130.4922351 130.559234 translation initiation factor eif-2b subunit gamma None IKKDNTLTLAPYDACWNAFR None 606273 7005 15.98 17.16 17.21 16.41 17.07 18.09 16.85 16.28 17.05 16.37 18.41 17.43 18.13 17.71 18.41 17.43 16.41 17.6 17.68 16.47 17.73 18.66 17.64 17.23 17.82 16.87 18.5 18.12 16.22 16.83 17.1 D4AA66 Rnf220 5 130.7391421 500532 - 130.7391421 130.776382 ring finger protein 220 None NSDIEKITEDSAVTTFEALK None None None 15.35 15.72 14.78 16.44 16.55 15.85 16.46 15.82 16.35 16.04 16.34 16.83 16.53 15.69 16.06 16.25 15.1 15.88 16.05 16.37 15.31 15.61 16.49 15.78 15.75 16.21 16.05 14.94 16.79 16.3 16.8 M0R8C5 Eri3 5 131.0161861 313535 + 131.0161861 131.143328 eri1 exoribonuclease family member 3 None KVMLPGQCHYLGLPVADYFK None None None 17.4 18.11 17.44 18.59 17.01 18.82 17.7 18.56 17.96 18.28 18.58 19.11 19.56 19.36 18.88 19.23 18.56 18.59 19.8 18.82 19.3 19.36 19.54 19.89 19.65 20.3 19.32 18.0 19.46 18.42 18.35 Q568Y6 Dmap1 5 131.1437321 298447 - 131.1437321 131.151742 dna methyltransferase 1-associated protein 1 None YYHICAKLANVRAVPGTDLK None None 41311 16.1 14.41 17.13 16.24 15.96 14.84 15.96 15.85 16.59 15.88 15.93 16.07 16.41 16.48 16.52 15.6 17.35 15.25 16.7 15.05 17.84 16.08 16.66 15.78 16.95 16.77 16.19 15.61 17.37 16.58 17.14 P28572 Slc6a9 5 131.3747031 116509 + 131.3747031 131.408728 sodium- and chloride-dependent glycine transporter 1 None IPLYALFQLCRTDGDTLLQR None 601019 5050 19.93 17.73 19.17 19.12 19.84 18.59 19.61 19.6 18.39 19.15 19.59 18.13 18.77 18.33 19.59 19.43 18.8 18.86 18.75 19.47 18.2 18.64 18.54 18.5 20.06 18.78 18.95 19.2 18.77 20.18 19.47 Q568Y2 Dph2 5 131.4284431 298452 - 131.4284431 131.431394 2-(3-amino-3-carboxypropyl)histidine synthase subunit 2 None VAQHLEALAHLRKLTEAAGK None 603456 1060 16.0 13.99 15.23 15.67 15.71 14.41 14.58 14.53 15.75 14.62 15.01 16.07 15.46 15.96 14.63 16.14 14.64 15.96 16.41 15.56 15.71 15.31 15.42 17.01 16.77 16.24 16.05 14.73 15.97 15.63 16.37 Q496Z3 Ipo13 5 131.4337771 116458 - 131.4337771 131.454016 importin-13 None FPSARLSPEQKDTFSQQILR None None 40968 16.49 15.5 16.45 15.99 15.59 15.44 15.99 15.63 15.48 15.51 16.37 15.23 14.84 14.59 15.46 17.34 15.86 16.86 16.37 14.47 16.49 15.75 15.61 15.39 17.05 15.48 15.72 16.09 16.24 15.6 15.74 Q9JM04 Ipo13 5 131.4337771 116458 - 131.4337771 131.454016 importin-13 None VADMVRLFQAEDSPVDSQGR None None 40968 16.06 16.35 16.19 15.74 15.34 15.19 15.7 15.37 15.23 15.26 16.11 14.98 14.64 14.34 15.03 17.08 15.62 16.57 16.21 14.41 16.24 15.5 15.13 15.0 16.8 15.23 15.53 15.96 15.89 15.15 15.21 A0A0G2JT62 Ptprf 5 131.7419591 360406 - 131.7419591 131.817489 protein-tyrosine-phosphatase None EQGVPKTGEGFIDFIGQVHK None 179590 20623 18.45 16.07 18.63 18.15 16.6 18.18 19.0 17.41 16.82 18.92 18.63 16.86 18.28 18.6 17.85 17.27 19.39 17.07 17.51 17.41 18.11 19.19 18.46 17.11 18.12 17.92 18.45 18.33 16.56 18.33 18.01 Q64604 Ptprf 5 131.7419591 360406 - 131.7419591 131.817489 receptor-type tyrosine-protein phosphatase f None LAGSKARASRFISANLPCNK None 179590 20623 18.5 16.06 18.4 18.1 16.56 18.39 18.72 17.44 16.8 18.82 18.55 16.93 18.25 18.59 17.86 17.41 19.37 17.04 17.54 17.41 18.05 19.24 18.52 17.6 18.04 18.14 18.64 18.24 16.31 18.29 17.94 F1LZJ4 Hyi 5 131.8946041 500536 + 131.8946041 131.89737 putative hydroxypyruvate isomerase None NIREFLPIVGHVQVAQVPDR None None None 17.66 15.5 18.3 17.47 16.98 17.16 17.82 17.79 16.47 17.73 16.85 15.98 16.98 17.3 17.74 15.79 16.17 16.74 16.53 18.6 16.66 17.88 17.16 17.32 17.93 16.59 15.15 17.54 17.62 18.32 17.72 Q5M920 Ebna1bp2 5 132.1481231 108348080 + 132.1481231 132.152802 ebna1 binding protein 2 None KKKGSKWNTRESYDDVSSFR None None None 15.6 15.35 16.49 14.09 15.9 13.93 14.91 15.1 16.02 15.38 16.16 15.49 15.0 16.27 15.21 15.36 16.67 15.03 15.22 16.29 16.47 16.67 14.96 16.04 15.93 15.57 15.58 16.41 15.17 16.58 16.24 P11167 Slc2a1 5 132.7171931 24778 + 132.7171931 132.745416 solute carrier family 2, facilitated glucose transporter member 1 None KLRGTADVTRDLQEMKEEGR None 138140 68520 20.76 18.48 20.29 20.19 20.38 19.92 19.65 19.31 19.51 20.51 20.92 19.26 19.97 19.48 18.39 19.3 20.63 19.6 20.15 19.25 19.43 20.39 20.59 20.7 18.88 19.77 18.57 19.87 19.89 19.62 19.43 D4A7G9 Rgd1564804 5 132.8372841 313551 - 132.8372841 132.841661 similar to chromosome 1 open reading frame 50 None HTHRVGDPLDLVALAEQVQK None None 11461 17.03 15.07 16.65 16.42 17.01 14.81 14.75 16.54 15.57 14.77 17.55 15.98 16.26 15.58 14.93 16.59 17.2 15.96 16.39 15.77 15.31 14.75 16.95 16.72 15.74 16.17 16.35 15.44 15.84 16.01 15.44 P62961 Ybx1 5 132.8821461 500538 - 132.8821461 132.898862 y-box-binding protein 1 None NEEDKENQGDETQGQQPPQR None None 88707 17.03 15.47 17.23 17.09 16.55 16.54 15.54 16.61 16.9 15.94 17.86 16.84 16.76 16.9 16.52 16.22 15.56 17.63 17.67 17.27 18.16 17.02 16.82 17.58 17.75 15.9 17.64 16.1 17.01 17.62 17.84 D4A5R0 Ppih 5 132.9154681 366461 - 132.9154681 132.924256 peptidyl-prolyl cis-trans isomerase None ADVVPKTAENFRQFCTGEFR None None None 17.62 18.98 18.46 17.74 18.06 18.24 19.09 18.55 17.7 17.38 17.5 17.7 17.53 18.54 19.55 16.67 16.77 18.21 17.99 18.13 19.64 17.72 16.69 17.08 19.91 17.89 19.1 18.13 17.91 17.92 19.21 D4A6X7 Ppcs 5 133.0231031 298490 - 133.0231031 133.02689 phosphopantothenoylcysteine synthetase None EEKIVDDLRSRHTAFICDRN None 609853 6173 16.78 17.88 17.74 16.47 16.42 16.22 17.3 16.92 16.4 16.72 17.54 16.23 16.26 16.01 17.38 17.15 15.85 16.95 16.5 17.41 16.55 16.38 16.14 16.74 17.45 16.41 17.59 15.87 16.46 16.5 16.83 B1WC02 Ctps1 5 134.1250231 313560 - 134.1250231 134.154155 ctp synthase None RHRFEVNPVLKKCLEEQGLK None 123860 20446 17.79 15.93 16.12 17.7 17.81 17.56 17.93 17.75 16.66 16.37 16.73 17.65 18.26 16.53 17.43 18.77 17.88 17.79 16.69 17.29 15.81 17.08 17.19 17.3 18.35 18.54 18.43 17.06 16.27 17.19 18.58 A0A0G2K666 Kcnq4 5 134.2769351 298496 - 134.2769351 134.326659 potassium voltage-gated channel subfamily kqt member 4 None None None None 16.03 17.41 15.77 15.99 14.88 17.08 16.63 15.43 16.14 15.12 16.43 15.4 15.36 16.89 15.57 16.51 17.27 15.29 16.14 15.41 15.08 16.14 15.26 15.7 15.72 17.02 16.57 15.77 15.05 15.54 15.66 Q62725 Nfyc 5 134.3368091 25337 - 134.3368091 134.394668 nuclear transcription factor y subunit gamma None TEDNKRRTLQRNDIAMAITK None 605344 7440 16.36 17.25 16.59 16.56 16.67 16.72 17.54 16.27 17.77 16.04 16.24 17.61 16.42 17.0 16.67 16.25 15.54 17.57 17.83 16.38 18.3 16.87 16.3 15.3 16.56 16.87 16.45 17.17 17.74 16.7 18.33 G3V7H4 Rims3 5 134.4293861 65025 + 134.4293861 134.464075 regulating synaptic membrane exocytosis 3, isoform cra_a None GRQTLATPPMGDVHIAIMDR None 611600 8837 16.09 16.68 16.49 17.06 16.34 16.4 16.9 16.21 17.22 17.99 15.91 17.48 16.69 17.54 16.31 15.37 16.14 16.41 16.47 18.07 17.96 16.55 16.69 15.62 16.03 15.68 16.32 16.92 17.9 17.31 17.44 Q9JIR3 Rims3 5 134.4293861 65025 + 134.4293861 134.464075 regulating synaptic membrane exocytosis protein 3 None VHIAIMDRSGQLEVEVIEAR None 611600 8837 15.51 17.21 16.15 16.81 16.09 16.58 16.46 15.96 16.94 17.45 15.88 17.44 16.37 17.29 16.23 15.12 15.7 16.29 16.14 17.82 17.71 16.3 16.23 15.71 15.5 15.46 16.07 16.56 17.64 17.19 16.79 B1WBX6 Smap2 5 134.5305481 298500 - 134.5305481 134.576938 small arfgap2 None AVGSMPTAGSAGSVPENLNLFPEPGSK None 607223 41489 19.64 17.84 18.57 18.55 19.07 18.77 18.53 19.16 19.24 18.2 19.31 19.0 18.93 19.83 17.41 17.76 19.65 19.94 18.85 18.64 19.27 18.62 19.38 18.53 18.23 19.49 18.92 20.25 18.25 19.08 18.7 F1LYQ7 Rpl10a-ps2 5 134.5785661 - 134.5785661 134.579341 ribosomal protein L10A, pseudogene 2 None HCDEVKAVDIPHMDIEALKK None None None 19.87 18.49 20.51 19.7 20.02 19.76 18.59 18.77 19.13 20.63 20.36 20.0 19.61 21.17 19.62 20.05 20.21 20.96 19.84 19.4 20.79 19.6 20.21 20.72 21.2 19.37 20.11 19.18 21.22 21.03 20.03 D4A5K6 Zmpste24 5 134.6284951 313564 - 134.6284951 134.66036 caax prenyl protease None VMAKSIDFPLTKVYVVEGSK None 606480 4277 17.3 19.76 17.85 17.87 18.78 16.64 18.1 18.56 16.85 17.23 18.2 16.97 17.39 17.34 18.74 18.19 17.72 17.4 17.8 17.88 17.43 17.26 16.93 17.3 19.63 18.35 17.2 17.98 18.41 18.04 17.87 P45479 Ppt1 5 135.1211771 29411 + 135.1211771 135.141075 palmitoyl-protein thioesterase 1 None DKAGKLVFLAKEGDHLQISK None 600722 4550 19.71 19.9 20.23 19.54 20.11 18.63 19.04 19.34 18.1 19.66 20.74 19.76 20.6 19.65 18.37 18.86 19.21 19.56 20.19 20.98 19.38 20.58 19.38 20.77 19.92 19.13 20.4 18.81 19.05 19.79 18.28 Q08163 Cap1 5 135.142121 64185 - 135.142121 135.16832 adenylyl cyclase-associated protein 1 None SPSPKPATKKEPALLELEGK None None 55956 22.87 22.2 21.7 21.41 22.07 23.7 22.94 22.18 22.72 22.8 21.88 22.75 22.21 22.26 20.57 23.09 22.61 22.56 22.09 22.82 21.74 22.4 22.79 21.21 20.78 21.98 21.69 23.18 21.44 22.28 21.56 B0BMU0 Ppie 5 135.4061771 298508 - 135.4061771 135.419226 peptidyl-prolyl cis-trans isomerase e None KFSGKTLEENKEEEGPEPPK None None 38142 18.1 16.67 18.37 17.84 18.41 18.31 17.3 17.91 18.92 17.96 18.86 17.63 18.55 18.69 18.79 17.45 17.22 18.06 18.01 19.86 20.34 18.27 18.62 18.36 19.94 17.98 19.45 17.59 19.35 19.06 19.66 P35332 Hpcal4 5 135.4543861 50872 + 135.4543861 135.466419 hippocalcin-like protein 4 None LAPEELEDLVQNTEFSEQELK None None 9441 20.93 19.09 20.67 20.54 18.97 21.72 20.88 20.39 20.92 21.68 20.6 21.04 21.24 21.65 20.64 20.69 21.06 20.96 20.9 20.07 21.67 21.15 21.33 19.58 19.66 20.47 20.07 21.03 22.07 20.85 20.86 D3ZVD3 Nt5c1a 5 135.4732191 313574 + 135.4732191 135.488452 5'-nucleotidase, cytosolic ia None TLRSWGLETDEALFLAGAPK None None None 16.56 16.7 16.61 16.76 17.17 16.83 17.67 17.21 17.67 15.93 16.36 16.81 16.88 17.94 18.16 16.52 17.27 16.2 17.97 15.99 17.6 16.66 16.25 16.59 17.99 18.03 18.27 17.29 16.13 18.05 18.1 G3V9N0 Pabpc4 5 135.5636881 298510 + 135.5636881 135.578985 polyadenylate-binding protein None IDDEKLRKEFSPFGSITSAK None 603407 37855 19.77 20.15 19.34 19.78 19.57 18.3 17.76 20.07 19.07 19.93 18.1 17.98 18.83 18.76 19.68 19.55 20.23 18.81 18.18 19.7 18.38 18.14 18.28 20.06 19.75 19.9 20.04 18.17 19.67 18.67 19.45 A0A0G2JWA8 Macf1 5 135.6237431 362587 - 135.6237431 135.945905 microtubule-actin cross-linking factor 1 None GMGAIGRDTDSLQSQIEDIR None 608271 136191 20.25 18.53 20.75 19.18 19.53 19.88 19.55 18.99 20.17 19.79 19.57 19.5 20.45 21.1 21.41 19.94 20.45 19.28 19.86 18.91 21.34 20.21 20.29 20.67 20.95 19.73 20.57 20.04 19.22 20.35 20.8 A0A0G2K9T4 Macf1 5 135.6237431 362587 - 135.6237431 135.945905 microtubule-actin cross-linking factor 1 None LKVDEQIPKEKHKELPGDER None 608271 136191 20.25 18.53 20.76 19.17 19.55 19.82 19.55 19.01 20.14 19.7 19.55 19.48 20.44 21.13 21.41 19.93 20.48 19.3 19.85 18.91 21.34 20.2 20.29 20.67 21.04 19.78 20.58 20.04 19.22 20.35 20.81 D3ZHV2 Macf1 5 135.6237431 362587 - 135.6237431 135.945905 microtubule-actin cross-linking factor 1 None VGRSKTIVQLKPRNPDHVLK None 608271 136191 20.14 18.45 20.62 19.06 19.46 19.78 19.48 18.96 20.13 19.64 19.35 19.39 20.36 21.04 21.36 19.84 20.32 19.22 19.78 18.83 21.28 20.1 20.19 20.51 20.9 19.82 20.51 19.94 19.21 20.29 20.75 B5DEL8 Ndufs5 5 135.9740341 100363268 - 135.9740341 135.979603 complex i-15 kda None QREKLMKEGKYTPPPHHLGK None None None 17.72 19.92 18.48 18.81 19.09 19.12 19.6 19.12 19.32 20.5 18.21 19.78 19.79 19.53 18.81 20.01 19.29 18.81 20.37 19.44 20.52 19.09 19.91 19.58 19.0 20.26 19.08 19.82 18.78 18.82 18.98 D4A7F2 Mycbp 5 136.1359561 100361133 + 136.1359561 136.143163 myc-binding protein None AATPENPEIELLRLELAEMK None None None 17.57 15.71 18.01 17.97 17.01 16.65 17.27 16.97 17.18 16.25 17.91 16.58 16.87 16.71 16.58 16.72 16.68 17.22 16.61 18.74 17.74 17.49 16.91 16.4 18.01 16.86 18.22 16.69 16.92 17.85 17.16 Q0D2L6 Rragc 5 136.1483011 298514 + 136.1483011 136.16777 ras-related gtp-binding protein None KVVFHKMSPNETLFLESTNK None 608267 39141 18.4 16.84 17.6 17.96 17.16 18.7 18.03 16.99 17.63 18.87 18.54 17.36 18.08 18.06 18.11 17.43 17.8 18.62 18.37 16.3 18.34 18.88 18.08 17.63 16.84 17.46 17.53 17.2 18.7 18.09 17.83 Q4KLI7 Sf3a3 5 136.9676781 313583 + 136.9676781 136.987336 splicing factor 3a, subunit 3 None RKHPNEICVPMSVEFEELLK None None 4949 18.2 17.35 18.58 17.75 17.7 16.92 16.8 17.7 18.83 17.11 17.88 18.5 17.9 18.32 18.31 17.57 17.95 17.68 17.83 19.09 19.58 18.05 17.62 18.77 18.06 17.19 19.13 16.9 18.35 18.23 19.64 D4A2N2 Inpp5b 5 136.9967671 362590 + 136.9967671 137.061315 phosphoinositide 5-phosphatase None IVRSLDKMENANIPSVTLSK None 147264 69021 16.94 15.68 17.92 17.88 16.37 17.2 16.5 17.67 16.96 17.81 15.96 15.88 16.98 17.33 17.77 15.69 16.3 16.55 17.88 16.45 17.27 17.45 17.16 16.75 18.31 16.78 18.75 16.67 16.49 17.93 17.73 Q499R4 Yrdc 5 137.1101291 319113 + 137.1101291 137.115126 yrdc domain-containing protein None ERSEELNKDLNPFTPLVGIR None 612276 11635 16.9 15.51 15.76 15.33 15.73 17.01 15.79 16.24 15.33 17.09 15.56 14.8 16.14 16.48 16.61 16.33 15.95 15.33 16.24 16.25 14.71 16.76 15.97 14.89 17.35 16.76 16.8 15.78 17.58 16.02 16.69 F1LX55 Epha10 5 137.1407481 298528 + 137.1407481 137.173495 eph receptor a10 None RKIDTIAADESFTQGDLGER None None None 14.69 16.57 13.9 14.13 13.87 15.52 14.3 14.46 14.68 13.72 14.71 14.58 13.98 14.36 13.38 15.43 14.87 15.32 14.69 14.38 15.31 14.54 14.13 14.68 16.26 15.64 14.16 15.14 15.22 14.01 14.03 B0BNB4 Meaf6 5 137.3447581 362594 + 137.3447581 137.368436 chromatin modification-related protein meaf6 None LAELVKRKQELAETLANLER None None None 16.86 14.71 16.67 16.15 17.23 17.95 16.45 16.17 17.39 16.9 17.03 16.58 16.62 16.37 17.26 15.8 16.38 16.19 16.39 16.64 18.31 15.87 16.36 17.14 15.57 16.12 17.47 16.18 16.77 17.4 17.9 G3V9I2 Grik3 5 137.7678661 298521 + 137.7678661 137.984307 glutamate receptor None FGGRFMNFIKEAQWEGLTGR None 138243 73901 16.85 16.46 17.26 17.24 16.46 15.87 16.51 16.23 17.2 15.78 16.46 17.29 16.08 17.99 17.98 16.0 16.12 16.72 17.52 16.42 18.16 17.28 17.38 16.79 17.6 17.39 16.22 17.47 17.41 16.4 16.81 P42264 Grik3 5 137.7678661 298521 + 137.7678661 137.984307 glutamate receptor ionotropic, kainate 3 None GFSYEIRLVEDGKYGAQDDK None 138243 73901 16.71 16.08 17.24 17.26 16.46 15.88 16.71 16.36 17.16 15.77 16.48 17.28 16.24 18.09 17.98 15.92 16.12 16.72 17.52 16.42 18.15 17.23 17.52 16.83 17.64 17.43 16.21 17.28 17.38 16.33 16.94 Q5XI37 Mrps15 5 138.3216111 298517 + 138.3216111 138.332205 28s ribosomal protein s15 None DQRKKFLRLLRQTNYDVFEK None 611979 32636 16.17 14.82 14.6 17.1 17.44 15.65 17.2 15.31 15.92 15.86 15.1 16.54 17.1 15.47 15.61 17.15 16.87 15.54 15.13 16.93 15.67 15.19 15.81 14.91 17.0 17.55 15.88 15.38 17.19 16.65 16.8 Q4QQS3 Oscp1 5 138.3345771 362595 + 138.3345771 138.365354 protein oscp1 None FRQLTEIYGSLSAGEFQLIR None None 71010 17.71 18.15 19.49 15.87 17.9 18.13 18.03 18.13 18.47 18.6 18.17 17.33 17.29 18.49 17.66 17.75 17.47 18.51 17.42 19.48 18.83 19.15 18.06 18.12 17.37 17.61 18.91 17.88 17.42 17.98 18.09 Q5M7V8 Thrap3 5 138.446061 313591 - 138.446061 138.487455 thyroid hormone receptor-associated protein 3 None RMDSFDEDLARPSGLLAQER None None 31289 18.71 17.51 19.5 18.66 18.86 18.59 17.55 18.33 19.7 17.73 17.94 19.24 19.16 19.21 19.61 18.2 19.53 19.04 18.23 18.47 20.58 19.31 19.16 19.29 19.73 18.94 19.96 18.52 19.49 19.54 20.07 D4A644 Map7d1 5 138.5279481 681287 - 138.5279481 138.552499 map7 domain-containing 1 None RREEQEAREKAQAEQEEQER None None 17009 19.51 18.71 17.58 18.19 18.94 19.05 17.54 18.38 18.98 18.23 18.62 17.82 17.64 18.5 17.37 17.35 18.61 18.43 19.45 17.48 18.63 18.54 18.0 19.39 18.11 19.66 18.32 17.56 19.01 18.13 18.35 Q5U1Z2 Trappc3 5 138.5591331 362599 + 138.5591331 138.57285 trafficking protein particle complex subunit 3 None LLCGVLRGALEMVQMAVEAK None 610955 6399 19.49 17.37 20.4 18.1 18.13 20.39 18.91 18.33 19.24 18.26 19.4 19.12 19.61 19.92 19.56 18.09 17.45 18.93 20.04 19.42 19.78 20.14 19.56 17.92 18.42 18.39 19.09 18.41 20.65 19.34 19.52 B0K017 Adprhl2 5 138.6140231 362600 - 138.6140231 138.619296 adp-ribosylhydrolase like 2 None AMVQSLLAKEAFDEVDMAHR None 610624 9863 17.83 17.02 18.61 17.89 18.11 17.33 18.82 17.76 18.15 16.88 17.48 17.61 17.8 18.07 17.42 16.9 16.92 18.53 17.91 19.47 19.68 17.97 17.77 17.41 19.34 18.27 18.28 17.5 18.42 18.41 18.91 F1LUS2 Ago3 5 138.6419881 313593 - 138.6419881 138.71423 protein argonaute-3 None DKCPRRVNREVVDSMVQHFK None 607355 49799 16.66 17.25 16.61 16.72 16.64 17.48 15.84 17.27 17.4 17.82 16.27 17.34 16.19 16.35 16.94 16.54 16.46 16.81 16.26 18.55 17.98 16.47 16.36 17.25 15.48 16.43 17.48 15.57 17.89 17.23 17.33 D4AC38 Ago1 5 138.7265141 313594 - 138.7265141 138.757028 argonaute risc component 1 None GEGSHISGQSNGRDPQALAK None 606228 81826 17.3 15.98 18.26 17.34 17.05 17.38 16.31 17.59 17.58 17.74 16.41 17.18 17.45 17.17 17.96 17.08 16.74 17.3 16.86 18.75 18.92 17.23 17.71 17.83 19.06 16.75 18.38 16.33 18.46 18.27 18.4 P40307 Psmb2 5 138.970511 29675 + 138.970511 139.002752 proteasome subunit beta type-2 None LYKMRNGYELSPTAAANFTR None 602175 2088 18.26 19.65 20.74 20.59 19.92 18.68 19.66 20.47 20.1 19.78 18.94 18.51 20.33 19.08 19.72 19.12 18.81 20.09 19.15 21.19 19.55 19.38 19.98 19.89 20.49 20.18 19.77 18.89 20.48 19.3 19.98 O35095 Ncdn 5 139.0378081 89791 - 139.0378081 139.047569 neurochondrin None KEAEPDLLAVLRGLSEDFQR None 608458 8064 20.66 22.24 21.34 21.94 21.51 22.81 22.92 20.95 22.74 22.54 21.78 22.31 22.56 20.75 20.85 23.07 22.28 22.35 22.9 21.23 22.9 22.27 23.01 22.15 20.21 22.11 21.8 21.95 21.02 20.6 21.55 F1M4J1 Dcdc2 5 139.0480391 100294508 + 139.0480391 139.140709 dyslexia susceptibility 2-like None EELKGPLREEKISEDTAILK None None None 16.85 15.4 16.6 16.39 15.43 16.53 15.31 15.89 16.24 17.13 17.75 15.37 16.75 17.68 17.82 15.92 16.67 16.05 15.57 16.08 17.09 17.24 16.84 16.51 17.78 15.92 16.38 17.22 17.85 17.65 15.69 D4A069 Zmym4 5 139.1466661 313598 - 139.1466661 139.264398 zinc finger mym-type-containing 4 None MCQKNAVIRHEVNYQNVVHK None None 35470 15.51 14.88 16.53 16.53 16.71 16.92 15.49 16.26 16.89 15.18 16.65 15.8 16.18 16.8 16.18 16.18 17.86 16.35 16.27 15.21 16.09 16.34 16.47 16.22 16.83 16.83 16.51 15.89 17.96 17.3 17.7 D3ZNA3 Rpl7a 5 139.1959151 + 139.1959151 139.196714 60s ribosomal protein l7a None MPKGKKAKGKKVAPAPAVVK None None None 20.14 18.92 19.96 19.84 19.3 19.47 18.01 18.31 19.85 20.27 20.31 19.66 19.4 18.53 20.65 20.85 20.39 18.6 18.88 18.69 19.23 20.03 19.76 20.53 18.74 18.42 19.99 18.48 20.05 19.08 19.21 A0A0G2K8K0 Sfpq 5 139.3380761 252855 + 139.3380761 139.34676 splicing factor proline and glutamine-rich None KGKGFGFIKLESRALAEIAK None 605199 3714 19.84 20.6 20.71 20.49 20.56 19.62 19.67 20.58 21.03 20.12 19.25 21.48 20.5 21.03 21.92 19.64 19.95 19.98 21.14 20.43 21.97 20.6 20.26 21.4 20.93 21.02 21.8 20.22 19.97 20.66 22.22 G3V7T8 Dlgap3 5 139.5158251 286923 + 139.5158251 139.562625 disks large-associated protein 3 None HPQGKGATRLPPTLLDQFEK None None 18276 18.71 18.97 16.95 18.24 18.08 18.4 17.75 17.77 18.7 19.28 17.69 18.46 18.85 18.83 16.96 18.82 19.23 18.41 19.1 17.69 18.39 18.43 18.81 19.31 17.98 19.04 18.09 18.54 18.11 17.4 17.29 P97838 Dlgap3 5 139.5158251 286923 + 139.5158251 139.562625 disks large-associated protein 3 None LLQLSIEDVTLKFLELQQLK None None 18276 18.68 18.87 17.03 18.18 18.04 18.53 17.7 17.73 18.82 19.48 17.88 18.41 18.79 18.81 16.94 18.78 19.32 18.42 18.94 17.63 18.41 18.43 18.81 19.29 17.73 18.62 18.09 18.53 18.1 17.38 17.23 D4ACP2 Smim12 5 139.5694651 685634 + 139.5694651 139.573274 small integral membrane protein 12 None EEKSILERREDRKLDEMLGK None None None 16.71 15.78 16.39 17.86 17.64 15.77 17.38 17.37 16.12 15.79 16.34 16.59 17.76 15.75 15.93 17.47 18.16 16.52 17.56 16.35 15.59 16.12 16.61 18.09 17.89 18.07 16.24 16.03 16.47 16.58 18.44 A0A0G2K6F2 Csmd2 5 140.5549791 313040 + 140.5549791 140.908401 cub and sushi multiple domains 2 None ITSSGHVARLEFQTDHSTGK None None None 16.06 15.28 16.58 17.3 15.56 16.66 16.22 16.32 16.4 17.32 16.61 17.36 17.86 17.06 16.36 17.58 17.1 17.23 16.97 15.84 17.55 16.23 17.54 17.49 16.13 16.97 15.71 17.38 16.94 16.32 15.89 D4A0M3 Phc2 5 141.0508431 313038 + 141.0508431 141.099268 polyhomeotic homolog 2 None MHMRDLVGMGHHFLPSEPTK None None 75090 14.99 14.09 14.73 15.66 15.89 14.9 14.56 16.44 15.85 14.95 14.7 15.77 15.47 14.11 15.05 16.05 15.53 14.87 15.7 14.25 13.93 14.58 14.98 14.46 14.9 14.81 16.07 14.84 15.77 15.39 16.55 P29410 Ak2 5 141.346121 24184 + 141.346121 141.364633 adenylate kinase 2 None LDGFPRTVKQAEMLDDLMDK None 103020 1227 18.21 17.52 19.21 18.47 19.15 17.35 18.13 19.19 18.44 17.9 18.54 18.05 18.22 18.61 18.51 17.38 17.96 18.39 17.0 19.94 18.27 17.89 18.15 18.35 19.31 17.24 18.93 18.39 18.08 18.73 19.22 P84076 Hpca 5 141.4553131 29177 - 141.4553131 141.463838 neuron-specific calcium-binding protein hippocalcin None IYKMVSSVMKMPEDESTPEK None 142622 55634 21.1 19.2 20.42 19.84 21.04 22.22 20.72 19.49 21.43 20.28 20.18 21.68 21.21 21.07 20.38 21.69 20.54 20.4 21.77 20.53 21.27 20.94 21.77 20.24 20.63 20.43 19.77 21.08 22.2 21.07 21.18 A0A0H2UHG0 Yars1 5 141.5358161 313047 + 141.5358161 141.564022 tyrosine--trna ligase None GNVENNGVLSFVKHVLFPLK None 603623 2730 20.23 21.79 20.03 19.75 20.23 19.02 20.1 21.29 19.53 19.55 20.06 19.39 19.62 19.3 21.1 20.01 19.71 19.74 18.76 21.04 19.16 19.81 19.16 20.71 20.61 20.78 20.37 20.59 18.11 19.48 20.28 B5DFB2 Rbbp4 5 141.6275241 313048 - 141.6275241 141.673874 rb-binding protein 4, chromatin-remodeling factor None SVSGKIEIEIKINHEGEVNR None None None 18.47 17.76 18.92 18.42 18.7 18.47 17.38 18.07 18.66 18.25 17.28 19.18 18.5 18.87 19.34 18.15 17.98 18.54 18.56 19.05 20.32 18.39 18.96 18.7 19.81 18.34 19.18 18.22 19.7 19.24 19.87 M0R5Y9 Zbtb8os 5 141.6754431 297885 + 141.6754431 141.686961 protein archease None DEYFIPREVKVLNIDQKNFK None None 12083 18.61 18.3 18.26 17.48 17.06 17.29 17.55 17.45 17.34 17.98 18.23 17.7 16.7 16.82 16.31 16.86 17.76 17.94 17.64 18.58 18.41 18.51 16.89 17.68 17.13 17.15 18.26 17.27 17.21 16.75 17.45 D4A3M7 Bsdc1 5 141.7989821 297890 + 141.7989821 141.827084 bsd domain-containing 1 None ADQSISEEPGWEEEEEELER None None 32386 18.86 16.06 18.86 17.42 17.05 17.24 18.41 17.21 18.93 17.28 17.2 17.87 17.97 17.55 16.84 18.61 18.52 17.81 17.47 18.85 18.83 17.93 17.87 17.76 17.38 17.31 17.2 16.6 19.1 17.19 18.45 Q9EPH2 Marcksl1 5 141.8514921 81520 + 141.8514921 141.853813 marcks-related protein None EGGGDSSASSPTEEEQEQGEISACSDEGTAQEGK None 602940 40748 19.09 20.08 20.58 20.25 18.36 19.32 20.48 19.98 19.69 19.45 19.47 19.2 19.99 19.55 18.67 19.43 20.53 20.04 18.77 19.66 19.91 20.07 18.82 20.22 19.39 19.9 19.09 19.35 18.69 18.48 19.72 Q4QQW4 Hdac1 5 141.8539931 297893 - 141.8539931 141.881057 histone deacetylase 1 None LNKQQTDIAVNWAGGLHHAK None 601241 68187 16.12 18.09 16.91 16.05 16.42 16.98 16.09 16.4 17.76 16.2 15.6 17.28 16.08 16.71 18.1 16.29 16.54 16.84 16.79 16.58 18.77 17.17 15.99 17.06 16.28 17.5 18.43 16.55 16.31 16.54 17.92 B0BNA7 Eif3i 5 141.9352181 682390 - 141.9352181 141.942587 eukaryotic translation initiation factor 3 subunit i None RQINDIQLSRDMTMFVTASK None 603911 2786 19.05 17.38 17.05 18.17 18.65 17.01 17.58 19.09 17.55 18.07 17.79 18.28 18.27 17.94 19.46 18.65 18.58 18.04 17.93 16.96 17.9 17.82 18.06 19.2 19.26 19.36 19.25 18.14 16.95 18.2 19.18 M0RCH0 Eif3i 5 141.9352181 - 141.9352181 141.942587 eukaryotic translation initiation factor 3 subunit i None RIGKFEARFFHLAFEEEFGR None None None 18.9 18.36 17.12 18.16 18.54 17.09 17.76 19.11 17.46 17.96 17.48 18.1 17.88 17.78 19.31 18.63 18.34 17.94 18.08 16.74 17.81 17.85 17.65 19.3 19.15 19.44 19.02 18.12 16.61 17.8 19.11 B4F770 Ccdc28b 5 141.9622771 682445 - 141.9622771 141.967278 ccdc28b protein None SGRLQAFGKECSFEQLEHVR None None 11509 15.24 13.16 14.5 15.77 14.23 15.22 13.62 15.28 15.79 14.57 14.02 13.95 15.6 15.34 15.97 15.19 14.29 14.63 15.64 13.97 15.12 13.76 15.08 15.3 15.67 15.34 14.96 15.35 16.06 15.58 14.93 B2GV14 Txlna 5 141.9712991 682457 - 141.9712991 141.984923 taxilin alpha None PEEKLAALCKKYAELLEEHR None None 14062 18.22 15.88 17.45 15.68 17.03 17.35 16.97 16.68 16.65 16.16 18.85 16.88 17.81 17.91 17.34 16.19 17.41 17.89 16.1 17.41 18.45 17.65 17.14 16.64 16.94 17.39 16.93 16.76 18.48 17.08 17.62 F1LT58 Kpna6 5 141.9891041 362607 - 141.9891041 142.02101 importin subunit alpha None SKEPSPPIDEVINTPGVVDR None None 22472 19.29 16.48 19.83 17.88 17.8 18.35 18.41 18.09 18.64 18.14 17.94 17.39 18.66 18.35 17.99 17.78 18.56 18.81 17.26 19.76 18.88 19.51 18.44 18.77 19.28 17.87 19.15 18.0 17.23 18.54 19.37 Q91V33 Khdrbs1 5 142.0635671 117268 - 142.0635671 142.089106 kh domain-containing, rna-binding, signal transduction-associated protein 1 None ISVLGKGSMRDKAKEEELRK None None 4781 20.5 18.68 21.22 20.52 20.22 19.11 19.4 19.65 21.1 19.51 19.95 19.84 20.82 20.54 20.83 19.95 21.07 19.63 19.48 21.27 22.07 20.71 20.81 20.76 21.81 20.29 21.08 19.07 21.39 20.9 21.24 Q6P9X4 Ptp4a2 5 142.1812881 85237 + 142.1812881 142.190501 protein tyrosine phosphatase type iva 2 None FIRQKRRGAFNSKQLLYLEK None 601584 20744 16.47 18.43 17.65 17.36 17.44 16.99 16.48 18.27 17.35 17.79 15.66 15.95 16.99 16.6 16.76 17.06 16.18 17.62 17.83 16.53 17.26 16.07 16.63 17.35 17.62 17.92 16.9 18.61 16.55 16.57 17.56 D3ZN99 Adgrb2 5 142.3246541 313058 + 142.3246541 142.36254 adhesion g protein-coupled receptor b2 None ISIQREPISAVSSDITFPMR None 602683 1288 17.24 16.04 16.43 16.63 16.14 17.52 16.12 15.77 16.99 17.07 16.64 16.86 16.73 17.08 16.41 17.92 17.35 17.33 17.03 15.54 17.49 16.76 17.55 17.66 16.65 17.66 16.83 17.2 16.7 16.01 16.8 Q641Z8 Pef1 5 142.451621 297900 + 142.451621 142.475071 peflin None QLDCFIKVCTQLQVLTEAFR None 610033 3623 16.72 17.34 17.6 17.9 18.36 17.45 18.16 18.7 17.94 17.83 17.29 17.29 18.66 18.09 17.33 17.45 16.72 17.92 19.02 18.7 17.81 17.82 18.79 17.15 19.08 19.34 17.2 17.49 19.6 17.55 17.49 P07483 Fabp3 5 142.6518341 79131 + 142.6518341 142.658673 fatty acid-binding protein, heart None VDSKNFDDYMKSLGVGFATR None 134651 68379 20.92 18.96 19.97 20.32 20.29 20.28 21.31 21.44 21.7 20.11 20.71 20.6 20.79 21.4 19.57 19.1 19.64 21.66 20.39 20.67 21.06 19.83 21.01 20.83 19.95 20.5 19.97 20.14 19.61 20.57 20.85 D3ZCQ7 Zcchc17 5 142.6586281 500555 - 142.6586281 142.700426 similar to ps1d protein None THMSSCRVDKPSEIVDVGDK None None 32319 15.6 17.18 16.54 15.69 16.06 15.47 14.77 15.62 16.39 15.61 15.04 16.51 15.78 15.9 16.06 15.77 16.66 16.55 15.32 17.23 17.67 16.71 15.74 16.36 16.76 16.6 17.44 15.89 16.39 16.6 16.89 D4A944 Snrnp40 5 142.7004671 313056 + 142.7004671 142.733757 small nuclear ribonucleoprotein u5 subunit 40 None HELLLGAAGSGPGAGQQQATPGALLQTGPPR None 607797 3538 17.32 15.8 17.79 17.29 17.53 16.64 15.96 17.4 17.44 16.21 16.84 17.54 16.82 17.36 17.93 16.24 17.34 17.2 16.85 17.64 18.94 17.25 17.18 18.12 18.4 16.94 18.09 16.23 18.04 18.12 18.55 D3Z8L5 Pum1 5 142.8370831 362609 + 142.8370831 142.954358 pumilio rna-binding family member 1 None QVRSMDELNHDFQALALEGR None 607204 22830 17.1 15.33 17.43 17.5 17.0 16.68 16.27 16.7 17.86 16.08 17.23 17.23 17.59 17.8 18.37 16.94 17.88 16.78 17.93 15.79 18.28 17.13 17.49 17.76 17.64 17.9 18.28 17.04 17.32 17.32 18.44 P33671 Sdc3 5 142.965661 116673 + 142.965661 142.99839 syndecan-3 None EPKQASVTYQKPDKQEEFYA None 186357 7965 16.81 15.45 17.61 16.81 16.29 15.87 16.19 15.89 16.56 16.85 15.75 16.21 17.43 16.46 17.5 17.08 16.65 16.36 16.58 17.59 17.04 18.07 16.42 17.8 17.31 17.63 17.96 15.68 16.52 18.14 17.6 F1MAG7 Ptpru 5 143.9505211 116680 - 143.9505211 144.024768 protein-tyrosine-phosphatase None MMTAVDRSFTDQSTLQEDER None 602454 4168 15.0 15.42 16.03 14.91 15.27 14.98 16.39 15.13 14.9 14.07 16.11 15.39 16.32 16.51 14.97 15.73 15.52 14.69 16.43 14.75 14.71 15.52 15.71 15.48 16.78 15.81 15.04 14.69 15.16 14.94 14.65 A0A140TAE6 Mecr 5 144.0297161 29470 + 144.0297161 144.055513 enoyl-[acyl-carrier-protein] reductase Nrbf1 None None None None 18.59 19.1 17.29 19.79 18.59 19.03 17.14 18.44 19.46 19.62 17.27 19.36 18.95 20.26 17.42 18.42 18.76 19.6 18.51 19.69 17.81 17.98 18.69 19.84 18.98 19.6 19.44 18.44 18.8 19.68 18.23 Q9Z311 Mecr 5 144.0297161 29470 + 144.0297161 144.055513 enoyl-[acyl-carrier-protein] reductase None LTDRLKDLGADYVLTEEELR None 608205 5362 18.59 19.1 17.29 19.79 18.59 19.03 17.14 18.44 19.46 19.62 17.27 19.36 18.95 20.26 17.56 18.42 18.59 19.48 18.41 19.95 17.81 17.98 18.69 19.84 18.98 19.6 19.44 18.44 18.8 19.68 18.23 G3V798 Srsf4 5 144.0614641 362612 + 144.0614641 144.089231 serine and arginine-rich-splicing factor 4 None RSKSKDHAEDKLQNNDSAGK None None None 18.69 17.23 19.08 18.5 18.78 18.38 17.48 18.5 19.54 18.08 18.0 19.49 19.16 19.21 19.73 18.06 18.08 19.19 18.51 18.98 20.53 19.04 19.0 19.33 19.37 18.48 20.08 18.34 19.16 19.47 20.05 A0A0G2K161 Epb41 5 144.1128951 313052 - 144.1128951 144.194723 band 4.1 None IVITGDADIDHDQVLVQAIK None None 44324 20.2 18.9 20.23 19.92 20.66 19.58 21.17 20.66 20.69 19.47 20.38 21.16 20.83 20.88 21.22 19.37 19.49 19.7 20.3 20.97 21.43 19.88 19.95 19.75 20.21 20.03 20.53 21.45 18.85 21.08 21.28 A0A0G2KAK2 Epb41 5 144.1128951 313052 - 144.1128951 144.194723 band 4.1 Epb4.1; RGD1564762 None None None None 20.35 18.89 20.3 19.93 20.65 19.48 21.35 20.7 20.62 19.53 20.64 21.13 20.81 20.89 21.16 19.35 19.52 19.81 20.14 21.16 21.43 19.87 19.81 19.88 20.11 19.96 20.4 21.36 18.81 21.16 21.2 E9PU11 Ythdf2 5 144.3820441 313053 - 144.3820441 144.405837 yth n(6)-methyladenosine rna-binding protein 2 None PKLKTKNGIAGSSLPPPPIK None 610640 32302 17.79 16.36 16.75 17.65 17.02 18.67 16.85 17.59 18.78 17.4 17.48 17.8 18.28 18.14 18.99 16.44 17.13 18.49 17.93 16.79 19.3 18.31 18.38 19.12 18.0 18.3 17.67 18.21 17.48 17.7 18.46 B1H227 Rcc1 5 144.5262241 682908 - 144.5262241 144.54442 loc682908 protein None SHNTEPGLVLTLGQGDVGQLGLGESVLER None None None 17.6 16.01 17.3 17.55 17.59 18.45 17.35 18.24 18.16 17.02 16.76 18.1 17.94 18.08 17.9 16.39 18.37 17.27 17.08 17.38 18.41 16.8 17.58 16.71 17.51 17.82 18.11 18.13 18.62 18.9 18.45 M0R7T1 Phactr4 5 144.5586191 682920 - 144.5586191 144.620992 phosphatase and actin regulator None SEEEAEGSLRNLTPEEDPKK None None None 18.87 16.59 18.98 17.12 17.95 16.92 18.7 16.93 17.38 16.5 18.56 16.91 16.93 17.55 16.62 16.85 16.48 18.67 18.23 18.47 18.9 18.6 18.41 16.66 18.46 17.32 17.5 17.59 17.54 17.67 17.86 Q03344 Atp5if1 5 144.738951 25392 - 144.738951 144.742702 atpase inhibitor None ESMDSGAGSIREAGGAFGKR None None 40581 21.16 22.57 21.28 21.55 21.74 21.02 20.2 21.45 21.19 21.25 21.59 21.2 20.98 21.57 20.78 21.97 21.98 20.69 20.55 21.95 20.28 21.26 20.5 22.25 21.15 21.66 21.73 21.03 21.21 20.79 21.35 Q642C0 Dnajc8 5 144.7450361 313035 + 144.7450361 144.763104 dnaj homolog subfamily c member 8 None AKEMHERKRQREEEIEAQEK None None 40935 18.64 18.98 19.79 18.13 19.05 17.41 18.88 18.58 19.03 18.27 18.41 18.18 17.94 18.44 18.91 18.24 17.44 18.75 18.94 19.63 20.62 18.83 18.12 18.52 19.34 18.75 17.61 18.81 19.88 17.97 20.47 Q4V7D9 Smpdl3b 5 144.9448391 362619 - 144.9448391 144.969641 acid sphingomyelinase-like phosphodiesterase None FEKTQDKAWFRESFNEEYLK None None 8708 17.54 18.24 16.77 17.15 16.87 18.98 17.18 17.3 18.07 17.25 16.78 18.26 18.38 18.08 17.35 18.36 17.42 17.25 18.61 17.0 17.46 16.9 17.48 16.31 16.93 18.1 17.59 18.74 18.07 17.37 16.77 B1WC70 Ppp1r8 5 145.0309181 313030 - 145.0309181 145.048759 protein phosphatase 1, regulatory (inhibitor) subunit 8 None ASTRAYTLREKPQTLPSAVK None 602636 8555 16.69 15.71 17.49 16.5 16.95 16.56 16.94 16.33 17.78 15.54 16.39 17.56 17.09 17.24 16.6 16.3 15.22 17.35 17.71 17.34 18.6 17.16 17.13 16.63 17.26 16.35 17.9 17.27 15.66 17.54 18.06 G3V7P1 Stx12 5 145.0638621 65033 - 145.0638621 145.092437 syntaxin-12 None QRISQATAQIKNLMSQLGTK None None 128192 20.34 18.61 20.76 19.89 19.2 18.82 20.9 19.45 19.63 20.29 18.75 18.86 20.17 19.44 20.11 20.3 18.83 20.35 19.03 20.86 20.72 21.2 20.34 20.24 20.6 20.61 19.43 19.48 19.16 20.39 20.31 D4A5R3 Ahdc1 5 145.2289261 362617 + 145.2289261 145.294146 at hook, dna-binding motif,-containing 1 None VVAVAATGVVGPGLTELGHPR None None 17144 16.7 15.18 16.46 17.89 17.31 17.43 17.23 15.64 17.52 16.22 17.7 17.3 17.72 17.38 16.47 17.78 17.27 17.73 18.01 15.61 17.45 17.0 17.79 17.19 17.91 17.32 16.71 15.97 18.12 17.68 17.43 A0A0G2K5T9 Wasf2 5 145.3604471 313024 + 145.3604471 145.398224 wiskott-aldrich syndrome protein family member None QREQEKRDVVGNDVATILSR None 605875 86743 18.62 15.85 18.02 18.31 17.28 17.53 17.38 18.16 17.87 18.21 18.15 17.66 18.32 18.74 17.2 16.69 16.95 19.18 17.55 18.61 17.74 18.42 18.04 18.15 18.37 17.89 18.32 18.08 17.92 18.03 18.53 B0BNM0 Tmem222 5 145.465851 313021 - 145.465851 145.477636 tmem222 protein None LDPGQVYASGPNAWDTAVHDASEEYK None None 11999 16.11 14.06 16.17 16.14 15.26 16.56 16.9 15.1 16.17 16.22 15.39 16.03 16.21 16.66 15.32 14.4 15.65 14.79 16.03 15.78 16.92 15.29 16.19 14.8 14.75 14.68 15.09 15.03 16.81 16.12 16.08 P26431 Slc9a1 5 145.5763611 24782 + 145.5763611 145.630586 sodium/hydrogen exchanger 1 None DKLNRFNKKYVKKCLIAGER None 107310 20660 19.73 16.77 18.02 18.54 18.39 17.87 17.21 18.58 17.49 19.3 18.62 16.6 17.76 17.59 16.92 17.92 18.23 18.0 17.58 18.65 16.22 17.9 17.78 17.09 18.2 17.84 19.14 18.05 18.3 18.52 17.29 Q63525 Nudc 5 145.7581 29648 - 145.7581 145.771409 nuclear migration protein nudc None RLQLEIDQKKDAENHEVQLK None None 4812 21.04 18.78 21.39 20.6 20.71 20.59 20.63 20.26 19.81 20.47 21.27 19.41 20.96 19.15 19.99 20.77 20.11 20.99 19.88 21.9 20.2 21.55 21.08 20.57 21.15 20.59 20.03 20.34 20.85 21.02 21.0 A0A0G2K0V8 Nudc 5 145.7580071 100911422 - 145.7580071 145.771387 nuclear distribution protein c homolog None KDAENHEVQLKNGSLDSPGK None None None 21.03 18.83 21.22 20.59 20.73 20.56 20.49 20.47 19.88 20.57 21.07 19.46 20.96 18.99 20.01 20.87 20.07 20.93 19.96 21.93 20.06 21.46 21.06 20.65 20.93 20.88 20.14 20.29 20.83 20.96 21.0 G3V9A3 Sfn 5 145.8271881 313017 - 145.8271881 145.827933 rcg31390 None None None None 24.74 26.79 23.83 25.54 25.65 23.55 25.03 25.91 24.37 24.83 24.03 24.71 24.66 23.81 23.69 25.64 24.26 25.81 24.81 25.19 23.61 24.23 24.12 24.9 25.78 26.49 23.79 25.55 24.67 24.19 24.94 D4A3E3 Arid1a 5 145.9081771 297867 - 145.9081771 145.980919 at-rich interaction domain 1a None TLGPNAVLSPQRLVLETLSK None None 21216 16.42 15.3 17.63 17.18 16.55 16.06 17.0 16.09 17.63 15.87 16.05 17.01 16.59 16.92 17.3 16.51 17.59 15.55 17.48 15.91 18.46 16.99 16.92 16.14 17.61 16.85 18.02 17.4 15.91 17.22 18.32 F1LXV0 Rps6ka1 5 146.0790221 81771 - 146.0790221 146.118271 ribosomal protein s6 kinase None VKVIDKSKRDPSEEIEILLR None 601684 55703 18.06 17.94 18.42 17.84 18.97 18.08 18.63 18.83 19.2 17.77 17.85 19.14 18.91 18.82 19.37 17.9 17.91 18.4 19.18 17.89 19.36 18.22 17.84 17.8 18.55 18.37 19.82 19.11 17.37 19.04 19.9 Q63531 Rps6ka1 5 146.0790221 81771 - 146.0790221 146.118271 ribosomal protein s6 kinase alpha-1 None SKPRATQAPLHSVVQQLHGK None 601684 55703 18.03 18.04 18.42 17.84 18.97 18.09 18.63 18.82 19.2 17.77 17.87 19.13 18.89 18.82 19.37 17.9 17.91 18.4 19.18 17.89 19.36 18.23 17.81 17.8 18.53 18.38 19.82 19.11 17.37 19.02 19.91 P18437 Hmgn2 5 146.1921291 100360316 - 146.1921291 146.19558 non-histone chromosomal protein hmg-17 None KGKADAGKDANNPAEDGDAK None None None 17.26 17.56 19.16 18.18 17.92 17.61 18.54 17.86 19.01 17.56 17.48 18.3 17.93 18.21 18.21 17.37 17.41 18.83 17.93 18.7 19.92 18.31 18.15 18.25 18.46 17.86 18.68 18.7 16.52 18.3 19.58 Q4KLJ0 Hmgn2 5 146.1921291 100360316 - 146.1921291 146.19558 high mobility group nucleosomal binding domain 2 None KGKADAGKDANNPAENGDAK None None None 17.47 15.1 18.41 17.55 16.8 16.9 16.91 16.79 17.65 16.62 16.57 16.79 17.49 17.11 16.27 16.89 16.73 18.15 16.67 17.85 18.2 17.39 17.69 16.94 17.37 17.24 17.67 17.44 16.43 17.51 17.7 P02793 Ftl1 5 146.3227521 100360087 + 146.3227521 146.323658 ferritin light chain 1 None SQDEWGKTLEAMEAALALEK None None None 16.08 16.76 17.13 15.84 16.07 15.08 16.9 16.36 15.82 14.94 15.88 15.5 15.0 15.65 15.3 16.97 15.07 17.36 16.25 15.19 15.04 16.11 15.81 14.87 15.93 16.56 16.0 15.73 15.64 14.93 16.3 B2RZ27 Sh3bgrl3 5 146.3541531 298544 - 146.3541531 146.355525 sh3 domain binding glutamic acid-rich protein-like 3 None RIQYQLVDISQDNALRDEMR None None 41824 20.64 18.24 19.6 19.91 19.18 20.09 19.56 20.25 19.27 20.59 20.32 19.45 20.23 20.05 19.29 20.63 19.93 20.15 18.95 20.03 18.31 18.99 20.01 19.51 19.27 19.36 19.05 20.83 19.37 19.91 19.62 B2GV37 Zfp593 5 146.4626711 298546 - 146.4626711 146.464998 zinc finger protein 593 None GGLHRCLACARYFIDSANLK None None 41070 15.4 13.46 15.72 15.15 15.96 16.32 15.92 15.08 16.29 14.9 15.86 15.66 16.11 15.18 16.17 15.78 15.47 16.24 14.76 15.56 16.42 15.64 16.06 14.91 15.73 15.03 15.38 15.65 16.41 16.23 16.08 P13668 Stmn1 5 146.6807531 29332 + 146.6807531 146.687151 stathmin None KLTHKMEANKENREAQMAAK None 151442 4063 22.2 24.52 22.15 23.42 22.37 22.53 21.88 23.79 22.65 22.5 21.84 22.46 22.23 23.19 21.25 21.76 23.56 22.5 21.72 23.55 22.0 21.48 22.31 23.4 23.34 23.34 22.64 22.61 22.29 21.99 21.87 Q5XII9 Mtfr1l 5 146.7369331 298549 - 146.7369331 146.746729 mitochondrial fission regulator 1-like None DVPPVPTLADIAWIAADEEETYAR None None 10472 18.52 16.51 17.49 18.84 17.82 17.6 17.69 16.1 18.0 17.5 17.92 17.26 18.2 18.97 17.74 17.31 17.85 17.96 19.14 16.58 18.72 18.18 18.31 18.43 19.79 17.53 17.72 18.03 17.85 18.29 18.43 D3ZAR1 Ldlrap1 5 146.9579051 500564 - 146.9579051 146.978526 low density lipoprotein receptor adapter protein 1 None PSLKTSVATGNLLDLEELAK None 605747 9219 16.8 16.25 15.08 16.28 16.84 16.28 15.87 17.08 15.26 14.74 15.55 16.28 15.99 15.89 15.54 15.99 16.48 16.05 16.26 14.99 14.19 15.47 15.02 16.23 17.51 16.48 17.22 15.39 14.94 15.94 16.41 Q4V7D3 Maco1 5 147.0128681 313618 - 147.0128681 147.075001 macoilin None AARAVAFAAASRGECTETLR None None 14449 17.71 18.22 17.89 16.75 17.61 16.21 16.05 17.49 17.46 16.49 17.07 17.11 16.71 17.58 17.12 16.89 18.12 17.85 17.05 15.91 19.06 16.28 16.56 17.74 18.6 17.9 18.01 16.91 18.29 16.84 17.51 G3V8C4 Clic4 5 147.4566281 83718 - 147.4566281 147.513478 chloride intracellular channel protein None LFMILWLKGVVFSVTTVDLK None None 987 21.17 18.75 19.84 19.84 21.01 21.38 21.4 20.23 18.89 20.08 21.12 19.82 20.23 19.98 20.07 20.39 19.64 19.86 20.73 20.95 19.62 20.18 20.78 19.49 21.51 19.87 20.92 19.72 19.26 21.15 20.33 Q9Z0W7 Clic4 5 147.4566281 83718 - 147.4566281 147.513478 chloride intracellular channel protein 4 None TRRFLDGDEMTLADCNLLPK None None 987 19.96 18.81 19.87 19.83 20.98 21.41 21.39 20.22 18.9 20.08 21.12 19.79 20.76 20.0 20.3 20.36 19.34 19.97 20.81 20.79 19.66 20.18 21.22 19.68 21.51 19.82 20.73 19.66 19.28 20.72 20.01 A0A0G2K4F6 Srrm1 5 147.5595211 313620 - 147.5595211 147.591846 serine and arginine repetitive matrix 1 None AVAVATPAPAAPAAVSAAATPSAQEEPAAAPEPR None 605975 136796 17.17 15.95 16.83 17.28 17.29 17.47 16.19 16.9 18.01 17.95 16.96 18.37 17.63 17.6 17.56 16.65 17.82 17.01 17.52 17.32 18.76 17.68 17.69 18.48 15.87 17.06 18.28 16.63 17.4 18.15 18.33 B2RYB3 Srrm1 5 147.5595211 313620 - 147.5595211 147.591846 serine and arginine repetitive matrix 1 None SVRMKDSSVQEATSTSDILK None 605975 136796 17.09 16.35 18.07 17.39 17.4 16.82 16.3 17.01 17.62 16.48 17.24 17.86 17.81 17.7 17.67 16.75 18.08 17.08 17.65 17.41 18.86 17.79 17.86 18.58 18.55 17.28 18.38 16.74 17.51 18.23 18.48 Q4KM38 Srsf10 5 148.0888161 362630 + 148.0888161 148.097215 fus interacting protein (serine-arginine rich) 1 None RYLRPPNTSLFVRNVADDTR None 605221 None 17.94 16.32 16.69 18.27 18.13 17.17 16.57 17.85 18.38 17.54 17.0 18.43 17.6 17.7 17.7 17.61 17.36 17.67 18.16 18.33 18.25 17.18 17.56 18.26 17.54 18.07 19.1 17.11 17.45 17.9 18.58 P17164 Fuca1 5 148.1525411 24375 + 148.1525411 148.169971 tissue alpha-l-fucosidase None NSKDVGPHRDLVGELGAAVR None 612280 20078 17.96 15.59 18.3 18.41 17.42 16.96 17.32 17.98 16.94 17.7 17.74 17.56 16.9 16.96 18.54 16.48 17.37 17.22 16.3 17.72 17.99 16.59 17.39 17.78 18.1 16.38 17.27 17.86 16.44 18.72 18.14 P97519 Hmgcl 5 148.1782391 79238 + 148.1782391 148.192073 hydroxymethylglutaryl-coa lyase None GVNLQKLLEAGDFICQALNR None 246450 159 18.42 19.7 18.39 18.04 18.66 17.74 19.51 18.1 17.74 17.9 18.2 17.73 17.3 17.46 17.23 18.97 17.55 18.96 18.3 19.63 19.25 19.11 17.78 17.96 20.12 18.5 18.1 17.43 18.53 17.66 19.03 P18645 Gale 5 148.1938871 114860 + 148.1938871 148.198388 udp-glucose 4-epimerase None IRGEDSMPESLRRVQELTGR None 606953 347 18.4 16.01 17.48 17.0 18.49 16.55 18.92 17.95 17.3 17.65 17.51 16.28 16.67 17.17 16.37 17.36 16.73 17.78 18.32 17.77 17.65 16.62 17.4 16.16 18.88 17.18 17.53 17.27 17.12 17.57 18.23 Q4QRB0 Gale 5 148.1938871 114860 + 148.1938871 148.198388 udp-glucose 4-epimerase None SVEFEEMDILDQAALQHLFK None 606953 347 18.4 16.01 17.28 17.0 18.49 16.57 18.92 17.95 17.33 17.76 17.12 16.21 16.67 17.17 16.37 17.36 16.73 17.78 18.32 17.77 17.65 16.62 17.4 16.25 18.92 17.55 17.64 17.21 17.02 17.57 18.23 Q9QYL8 Lypla2 5 148.1984671 83510 - 148.1984671 148.203062 acyl-protein thioesterase 2 None CHGELDPMVPVRFGALTAEK None None 100964 17.73 17.34 17.75 18.9 18.53 18.34 19.36 19.33 18.83 19.4 17.5 18.54 19.15 18.76 17.24 18.39 17.6 19.49 19.1 18.87 18.25 17.59 19.06 16.95 17.82 19.3 18.79 19.49 18.02 17.93 18.44 D4ABS5 Pithd1 5 148.2059851 298557 - 148.2059851 148.216372 pith domain-containing 1 None GADTTKIFYIGLRGEWTELR None None None 16.72 19.21 17.96 17.6 16.69 17.59 16.87 17.7 17.93 18.89 17.28 17.4 17.91 17.63 17.76 16.95 19.22 17.17 16.76 17.0 16.91 19.45 17.14 17.75 15.89 18.09 18.78 17.96 16.62 17.53 17.14 Q63187 Eloa 5 148.2308251 25562 - 148.2308251 148.246765 elongin-a None NSLKKKLSPALDVASDNHFK None 600786 10845 15.49 15.12 16.94 16.29 16.74 15.61 15.3 15.55 16.13 14.75 15.87 16.19 16.07 16.51 15.41 16.76 15.56 16.1 16.78 15.96 16.47 14.88 16.05 16.31 17.34 15.85 16.06 15.73 16.79 16.25 17.29 P62914 Rpl11 5 148.2713921 362631 - 148.2713921 148.277579 60s ribosomal protein l11 None LTRAAKVLEQLTGQTPVFSK None 604175 37376 20.0 19.25 18.6 20.39 20.26 19.0 18.27 20.43 18.8 18.44 18.9 19.93 19.6 19.32 20.36 20.11 19.52 19.09 18.7 19.79 17.94 18.96 18.69 20.57 20.79 20.62 19.97 18.52 20.53 19.19 21.17 Q566E4 Hnrnpr 5 148.5430821 319110 + 148.5430821 148.574871 heterogeneous nuclear ribonucleoprotein r None VKVLFVRNLATTVTEEILEK None 607201 4251 19.21 19.34 20.86 19.92 19.84 19.19 18.74 19.38 20.58 19.03 19.41 20.38 19.9 20.35 20.31 19.42 19.89 20.04 20.35 20.56 21.79 20.27 19.84 20.77 20.79 19.84 20.89 18.87 20.67 20.35 21.59 G3V7L9 Luzp1 5 148.742451 79428 + 148.742451 148.781607 leucine zipper protein 1 None LRFKLQSLSRRLDELEEATK None 601422 11545 18.71 16.51 17.38 17.93 18.91 17.8 17.07 18.52 19.01 17.84 18.33 17.54 17.86 18.12 18.62 17.84 18.41 16.98 17.75 18.03 17.26 16.55 18.36 18.97 18.73 17.78 17.76 18.27 17.84 18.64 18.5 Q9ESV1 Luzp1 5 148.742451 79428 + 148.742451 148.781607 leucine zipper protein 1 None PLELSIHKHDITLQLTEAER None 601422 11545 18.68 16.43 17.39 17.95 18.91 17.85 16.99 18.51 19.0 17.79 18.36 17.55 17.9 18.13 18.77 17.8 18.4 16.98 17.71 17.92 17.29 16.55 18.39 18.97 18.75 17.71 17.81 18.28 17.87 18.67 18.47 F1MA31 Kdm1a 5 148.7829771 500569 - 148.7829771 148.838319 lysine-specific histone demethylase None YKEASEVKPPRDITAEFLVK None 609132 None 16.42 15.25 17.45 16.47 16.83 15.53 15.83 16.13 17.82 16.79 17.17 15.88 16.82 16.82 17.71 16.18 16.94 17.32 16.27 16.19 18.45 17.04 16.91 16.9 17.07 16.34 16.82 16.92 17.35 17.48 18.32 A0A0G2JY48 Ephb2 5 148.8952611 313633 - 148.8952611 149.076851 receptor protein-tyrosine kinase None PGMKIYIDPFTYEDPNEAVR None 600997 37925 16.27 16.66 16.83 17.17 17.26 17.86 16.76 16.79 18.41 17.78 17.14 18.75 18.3 18.55 17.9 16.97 16.25 17.82 17.81 18.54 19.0 17.11 18.03 17.19 16.23 17.26 17.33 17.97 18.44 17.7 17.77 P31721 C1qb 5 149.1188471 29687 - 149.1188471 149.124402 complement c1q subcomponent subunit b None NQAIRFEKVITNVNDNYEPR None 120570 418 15.42 15.5 16.32 16.56 15.18 17.19 16.44 16.89 15.38 17.28 17.79 16.5 17.64 15.72 16.98 16.88 16.44 16.59 16.08 16.56 17.28 15.34 16.78 17.69 15.42 15.89 16.41 15.48 15.38 15.92 16.53 P31722 C1qc 5 149.1274051 362634 - 149.1274051 149.130773 complement c1q subcomponent subunit c None SVFTVTRQTAQYPAANGLVK None None 32020 15.96 13.56 14.1 15.4 14.24 15.54 15.69 16.22 14.16 15.85 16.0 16.01 16.21 15.32 17.15 15.37 15.0 15.09 14.75 15.79 16.6 14.56 15.94 16.63 15.79 16.4 14.27 15.7 15.12 15.66 16.06 P31720 C1qa 5 149.1336321 298566 - 149.1336321 149.136524 complement c1q subcomponent subunit a None VLAGGTVLQLQRGDEVWIEK None 120550 7249 15.48 14.86 15.86 16.06 15.1 16.64 16.12 16.35 15.04 16.95 17.36 16.42 17.25 15.61 16.84 15.98 16.04 15.97 15.33 15.9 17.42 15.24 16.14 17.65 15.24 15.91 16.09 15.15 15.19 15.19 16.47 A0A0G2JSM8 Cdc42 5 149.5561931 64465 - 149.5561931 149.593108 cell division control protein 42 homolog None TIEKLAKNKQKPITPETAEK None 116952 123986 20.39 22.05 21.53 21.5 21.26 22.26 22.67 21.73 22.58 22.76 21.51 22.7 22.69 22.44 21.25 21.66 21.2 22.71 21.38 23.07 23.41 22.37 22.72 21.8 20.57 21.73 20.72 22.22 22.22 21.5 21.42 Q8CFN2 Cdc42 5 149.5561931 64465 - 149.5561931 149.593108 cell division control protein 42 homolog None GLKNVFDEAILAALEPPEPK None 116952 123986 20.51 21.74 21.55 21.28 21.43 22.52 22.36 22.09 22.63 22.75 21.6 22.72 22.78 22.72 21.36 21.43 21.15 22.81 21.28 23.31 23.48 22.17 22.82 21.94 20.6 21.71 21.04 22.17 22.14 21.68 21.53 F1LTJ5 Aabr07073181.1 5 149.6774411 + 149.6774411 149.751129 uncharacterized protein None LVNFTRSIEYSPQLEDANAK None None None 17.02 15.43 17.8 16.54 16.91 17.27 17.3 17.44 16.52 16.45 19.01 16.74 17.45 17.87 17.45 16.46 15.78 17.7 16.28 17.85 17.51 16.58 17.8 16.72 16.33 16.38 16.19 17.55 17.19 17.44 16.35 A0A0G2JUQ8 Usp48 5 149.7995991 362636 + 149.7995991 149.867837 ubiquitinyl hydrolase 1 None WAETVRPEEVSQEHIETAYR None None 12988 14.71 16.1 16.09 14.62 15.34 15.09 16.11 15.78 15.41 13.9 14.79 15.59 14.42 15.47 15.17 14.6 14.51 16.05 16.17 14.13 16.82 15.22 15.01 14.04 16.49 15.28 14.89 16.45 14.89 15.46 16.06 Q76LT8 Usp48 5 149.7995991 362636 + 149.7995991 149.867837 ubiquitin carboxyl-terminal hydrolase 48 None WAETVRPEEVSQEHIETAYR None None 12988 15.74 14.64 16.22 16.07 15.97 15.58 16.71 15.46 16.08 14.56 15.74 16.28 15.75 17.98 16.22 15.49 15.84 15.41 16.83 15.13 15.81 15.56 16.35 14.95 16.8 16.44 15.58 16.67 14.93 16.43 16.86 F1LV89 Rap1gap 5 149.8920321 313644 + 149.8920321 149.939299 rap1 gtpase-activating protein None RRGSALGIGAVEESLIVPGK None None 2163 19.82 18.78 19.72 18.69 19.33 19.72 18.53 18.77 19.15 20.08 19.02 18.07 18.63 19.92 17.85 18.89 20.22 18.43 18.89 20.08 18.01 19.78 20.13 20.11 18.5 19.08 18.62 18.39 19.49 19.51 18.23 P08289 Alpl 5 149.9514041 25586 - 149.9514041 150.006448 alkaline phosphatase, tissue-nonspecific isozyme None HKHSHYVWNRTELLALDPSR None 171760 37314 16.86 14.42 15.97 15.6 15.79 15.47 16.69 17.07 15.69 15.41 18.22 16.69 17.22 16.91 16.62 15.44 17.0 15.85 16.36 16.09 16.58 17.55 16.99 15.23 17.44 15.66 15.79 16.48 17.68 17.03 16.98 P42893 Ece1 5 150.0776281 94204 + 150.0776281 150.178703 endothelin-converting enzyme 1 None EPVNGRHTLGENIADNGGLK None 600423 1068 15.84 16.14 16.77 15.58 16.95 15.21 16.55 16.46 15.86 16.09 15.43 15.6 15.29 15.82 15.82 15.41 16.47 16.22 14.98 16.83 15.69 15.22 15.17 15.44 15.55 16.61 15.9 15.84 15.8 16.25 16.43 A0A0G2JY73 Eif4g3 5 150.2511431 298573 + 150.2511431 150.418363 eukaryotic translation initiation factor 4 gamma, 3 None SWKDFLPEGEDVHNFLLEQK None None 2789 18.81 18.58 18.67 18.31 19.05 18.89 18.16 18.1 19.4 18.35 19.57 18.95 19.29 19.67 19.21 18.59 19.36 18.93 19.72 16.96 20.15 18.22 18.94 19.32 18.52 19.02 19.44 19.0 18.55 18.54 19.75 D4A554 Eif4g3 5 150.2511431 298573 + 150.2511431 150.418363 eukaryotic translation initiation factor 4 gamma, 3 None RRSQPGQRREPRKIITVSVK None None 2789 18.55 18.76 18.64 18.32 19.1 18.72 18.11 18.01 19.27 18.35 19.43 18.85 19.21 19.58 19.11 18.52 19.33 18.82 19.63 16.93 20.05 18.12 18.82 19.28 18.5 19.06 19.34 18.92 18.52 18.34 19.81 Q6P747 Hp1bp3 5 150.4357881 313647 + 150.4357881 150.463004 heterochromatin protein 1-binding protein 3 None TPMASSPRPKMDAILTEAIK None None 7774 18.7 20.82 20.17 19.43 19.02 18.34 17.93 19.27 20.25 19.8 18.22 19.46 18.22 19.06 20.43 18.5 19.7 19.12 19.32 17.91 21.08 19.51 18.51 19.4 18.75 19.68 20.48 19.23 19.5 18.77 20.0 Q641Y0 Ddost 5 150.5220861 313648 + 150.5220861 150.529412 dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kda subunit None TQYPHAVGRNTLLIAGLQAR None 602202 3821 18.89 21.06 19.01 19.95 17.97 17.87 18.52 20.05 17.28 19.51 19.4 18.22 18.43 18.36 19.9 19.09 18.91 18.6 19.13 17.67 18.46 18.26 18.11 19.44 19.96 18.65 19.14 18.61 18.5 18.37 18.89 D4A1H7 Mul1 5 150.6516621 298576 + 150.6516621 150.661863 ring-type e3 ubiquitin transferase None QQQLQDEFLEHEAHLLSQASPEDR None 612037 11576 16.82 15.8 16.53 15.67 16.66 15.12 16.44 15.82 15.84 15.3 17.13 15.86 15.8 16.29 17.35 16.5 16.14 15.53 16.84 15.06 16.93 16.97 15.94 15.56 17.95 16.23 16.19 15.99 16.92 16.54 16.51 Q9JI15 Camk2n1 5 150.674821 287005 + 150.674821 150.6766 calcium/calmodulin-dependent protein kinase ii inhibitor 1 None RPPKLGQIGRSKRVVIEDDR None None 10238 17.37 14.88 16.18 17.06 16.92 16.37 16.42 17.39 17.82 16.88 16.93 17.22 17.45 16.45 17.44 17.3 17.92 16.7 16.73 15.69 17.04 16.57 17.37 17.53 16.61 17.03 16.59 16.57 17.43 16.98 17.23 Q5XI32 Capzb 5 151.4356791 298584 + 151.4356791 151.535403 f-actin-capping protein subunit beta None LVEDMENKIRSTLNEIYFGK None 601572 3620 22.08 19.7 21.84 21.39 20.24 21.37 21.27 21.33 21.98 21.9 20.7 20.77 21.88 22.49 20.25 21.23 21.98 21.16 21.2 22.53 20.91 21.24 21.98 21.3 21.59 21.78 20.65 21.3 23.01 21.56 21.88 Q8CG45 Akr7a2 5 151.5523441 171445 + 151.5523441 151.560912 aflatoxin b1 aldehyde reductase member 2 None KIATKANPWDGKSLKPDSVR None None 2737 19.73 20.4 19.26 19.14 19.79 18.63 20.09 19.86 19.35 19.06 19.18 19.04 18.46 19.43 18.17 18.7 18.6 20.16 19.92 20.74 20.59 19.55 18.6 19.73 20.49 19.81 19.92 18.69 18.97 19.4 20.38 D4A994 Emc1 5 151.6085691 362643 + 151.6085691 151.633888 er membrane protein complex subunit 1 None SLPKALLDPRRPEIPTEQSR None None None 19.23 16.65 19.36 19.45 19.63 17.53 19.01 18.18 18.88 18.32 20.11 18.93 19.24 19.73 19.61 18.33 19.29 18.29 19.38 17.4 19.2 17.67 19.21 17.98 19.06 17.73 18.45 19.01 19.76 19.57 19.39 F1LQI5 Ubr4 5 151.6358691 313658 + 151.6358691 151.743925 e3 ubiquitin-protein ligase ubr4 None RALATNPALRHILVSQGLIR None 609890 None 20.58 17.54 19.09 18.79 17.83 19.39 19.02 19.52 18.67 19.21 20.22 18.37 19.17 18.73 19.75 18.77 19.37 18.68 19.3 17.47 20.3 18.84 18.7 19.08 18.38 18.64 19.25 19.36 18.03 18.87 19.13 Q2TL32 Ubr4 5 151.6358691 313658 + 151.6358691 151.743925 e3 ubiquitin-protein ligase ubr4 None ASKCSSVKYDVEIVEEYFAR None 609890 None 20.63 17.62 19.09 18.79 17.87 19.32 19.02 19.49 18.67 19.21 20.22 18.37 19.13 18.69 19.77 18.87 19.36 18.67 19.31 17.48 20.3 18.84 18.65 19.08 18.38 18.64 19.25 19.35 18.03 18.89 19.14 A0A0G2JUT5 Tas1r2 5 151.8315041 100270683 + 151.8315041 151.925345 aldehyde dehydrogenase family 4 member a1 None VQEATRMLRNAAGNFYINDK None None None 19.59 19.17 19.78 19.41 19.84 17.09 19.77 19.55 19.26 18.99 19.26 18.41 19.05 19.56 19.48 19.18 18.18 20.11 20.33 18.67 19.08 19.44 19.06 19.8 20.36 19.59 20.14 19.28 17.46 19.2 20.85 A0A0G2JVM0 Tas1r2 5 151.8315041 100270683 + 151.8315041 151.925345 multifunctional fusion protein None DVDSVVSGTLRSAFEYGGQK None None None 19.73 19.04 19.73 19.43 19.85 17.61 19.82 19.59 19.26 19.09 18.97 18.42 19.2 19.73 19.6 19.27 18.37 20.28 20.21 18.68 19.24 19.61 19.23 19.93 20.28 20.06 20.23 19.42 17.54 19.37 20.91 P0C2X9 Aldh4a1 5 151.8800031 + 151.8800031 151.905491 delta-1-pyrroline-5-carboxylate dehydrogenase None YGLTGAVFAQDKTIVQEATR None None None 19.64 19.37 19.9 19.44 19.83 17.16 19.79 19.54 19.42 19.2 19.27 18.42 19.06 19.73 19.55 19.25 18.38 20.27 20.16 18.67 19.26 19.58 19.07 19.91 20.3 19.63 20.25 19.37 17.55 19.22 20.93 M0R439 Klhdc7a 5 152.221991 298590 - 152.221991 152.22431 kelch domain-containing 7a None LGNCYEMLTLAKRQGLEALK None None None 14.78 13.29 13.94 15.16 15.37 14.63 15.95 16.07 14.37 13.65 15.42 15.54 15.83 14.27 15.73 16.04 15.09 14.61 14.56 14.79 14.32 14.12 15.17 14.36 16.22 15.86 14.7 15.71 13.68 15.6 15.24 M0RAS4 Igsf21 5 152.2879891 298591 - 152.2879891 152.328082 immunoglobulin superfamily member 21 None VKHPALSMPMQAEVTLVAPK None None 13153 17.26 18.38 17.01 16.9 16.49 16.65 17.78 16.02 17.8 19.13 16.29 16.98 17.32 18.38 16.19 17.79 16.49 17.15 18.28 17.64 18.23 18.14 17.76 16.17 17.12 17.41 16.65 17.13 18.82 16.16 17.65 M0RBM9 Arhgef10l 5 152.792771 684811 - 152.792771 152.897493 rho guanine nucleotide exchange factor 10-like None HPDRLSLQLALTELETLAEK None None None 15.7 17.89 16.69 17.43 16.12 15.5 16.37 16.96 16.06 16.79 15.26 17.42 16.74 17.32 17.75 16.27 17.21 15.87 16.59 15.2 16.21 14.99 15.1 16.81 16.04 17.28 16.61 16.33 15.69 17.12 17.18 F1LVV4 Rcc2 5 153.001891 298594 + 153.001891 153.01523 regulator of chromosome condensation 2 None GELGYGDHKPKSSTAAQEVK None None 10282 17.08 16.76 17.19 17.25 17.7 18.26 16.91 17.31 18.6 17.99 17.33 18.6 18.19 18.05 18.34 17.1 16.55 17.2 18.0 18.71 19.76 17.58 18.31 17.22 16.59 17.39 18.34 18.16 18.48 17.94 18.59 F1LPA6 Padi2 5 153.209041 29511 + 153.209041 153.251672 protein-arginine deiminase None TINKILSNESLTQENQYFQR None 607935 7214 18.63 19.72 18.01 19.22 18.59 18.17 19.17 20.13 17.43 19.25 18.71 18.88 18.66 18.09 19.12 18.23 19.15 17.44 18.25 19.31 17.53 17.97 17.32 18.49 17.86 19.27 19.13 17.17 18.71 19.43 17.63 P20717 Padi2 5 153.209041 29511 + 153.209041 153.251672 protein-arginine deiminase type-2 None LKKELALTEKDIIDLPALFK None 607935 7214 18.61 19.73 17.96 19.21 18.58 18.16 19.17 20.13 17.44 19.15 18.68 18.94 18.65 18.08 19.11 18.22 19.14 17.43 18.25 19.3 17.53 17.96 17.35 18.49 17.84 19.35 19.13 17.16 18.7 19.35 17.6 P21913 Sdhb 5 153.2648991 298596 + 153.2648991 153.285571 succinate dehydrogenase [ubiquinone] iron-sulfur subunit None KKKDESQEGKQQYLQSIEDR None 185470 2255 22.64 21.91 21.94 21.92 22.2 21.19 21.51 22.6 23.79 22.53 21.91 21.59 22.46 23.68 22.97 21.26 22.13 22.38 21.88 22.66 23.14 22.13 22.13 23.8 23.55 22.45 21.54 22.68 22.37 22.73 23.3 F1M6Q2 Crocc 5 153.3209311 313663 - 153.3209311 153.36353 ciliary rootlet coiled-coil, rootletin None LRDLRAQLEEATAAHAQQVK None None 16811 16.49 17.82 16.73 17.71 15.89 16.82 16.59 16.76 15.55 16.87 18.35 16.84 16.82 17.17 17.2 16.54 17.15 16.59 17.21 16.21 17.34 17.22 15.6 18.5 16.92 17.24 16.06 16.96 16.12 17.16 16.79 Q6P756 Necap2 5 153.3703641 298598 - 153.3703641 153.382737 adaptin ear-binding coat-associated protein 2 None TNRGYRASEWQLDQPSWSGR None 611624 9168 17.92 15.43 17.66 17.17 17.7 18.14 17.46 17.17 17.74 17.28 17.52 16.18 17.45 17.17 17.64 18.21 17.56 17.83 16.72 16.41 16.62 16.52 17.99 18.32 18.44 16.8 17.49 16.77 16.32 17.96 17.61 Q5XIA2 Szrd1 5 153.4187491 500575 - 153.4187491 153.443243 suz domain-containing protein 1 None RPALPVKSLAQREAEYAEAR None None None 16.84 16.06 17.57 16.43 17.74 18.48 16.47 15.71 16.12 16.37 17.2 16.58 16.92 16.8 15.96 17.36 16.35 17.65 16.51 18.27 16.77 16.93 17.34 17.39 18.26 16.18 17.58 16.05 16.9 16.96 18.45 D3ZBN3 Epha2 5 153.6056461 366492 + 153.6056461 153.634118 receptor protein-tyrosine kinase None VYKGTLKSSSGKKEIPVAIK None 176946 20929 15.69 16.08 16.41 16.72 16.8 17.81 16.07 16.79 17.45 17.21 17.71 17.99 17.76 17.73 16.75 17.02 17.51 16.94 17.73 15.83 17.75 15.89 17.88 18.27 15.54 16.06 16.55 17.07 17.05 16.35 16.57 F1M455 Spen 5 153.7751691 690911 - 153.7751691 153.830275 spen family transcriptional repressor None LERNKFYSFALDKTITPDTK None None 124461 16.57 15.74 17.34 17.5 16.59 16.19 15.67 17.2 17.34 16.2 17.0 17.25 17.01 16.59 17.95 16.23 17.93 16.07 16.96 16.19 17.44 17.0 16.73 17.6 17.72 16.91 16.67 17.13 17.82 17.38 18.12 D4A932 Plekhm2 5 153.940031 313667 - 153.940031 153.978448 pleckstrin homology and run domain-containing m2 None DLTDTISGPRSTASDLTSSK None None None 16.82 14.61 15.98 16.94 17.38 16.15 16.52 16.9 16.43 17.92 15.52 16.45 16.63 16.86 17.49 15.06 15.69 16.47 16.75 15.25 15.9 16.66 16.6 15.72 15.62 15.72 15.71 16.15 17.32 17.01 17.07 A0A096MJP9 Ddi2 5 153.9895941 313668 - 153.9895941 154.035283 dna damage-inducible 1 homolog 2 None DNHRSLASYGLKDGDVVILR None None 22207 17.77 16.52 17.54 17.86 18.35 17.31 17.72 18.24 17.33 16.67 18.43 18.31 18.58 18.46 16.33 16.41 17.75 18.5 17.58 19.03 18.79 16.82 18.69 17.15 19.27 17.72 17.7 18.01 17.59 18.53 17.54 Q5FVM7 Dnajc16 5 154.078311 362652 - 154.078311 154.10614 dnaj homolog subfamily c member 16 None DFDPYRVLGVSRTASQADIK None None None 17.39 15.37 17.34 18.47 17.8 15.78 17.05 17.11 18.0 17.54 16.88 16.95 17.82 16.66 18.3 16.95 17.43 17.18 17.0 15.5 17.3 15.98 17.79 17.35 17.35 16.81 16.95 16.97 17.3 17.47 17.67 Q9JHK1 Casp9 5 154.108861 58918 + 154.108861 154.126626 caspase 9, isoform cra_a None WDALLSRELFTRDMIEDIQR None 602234 31024 17.13 16.72 16.38 16.82 16.45 15.37 16.96 15.67 16.24 14.57 16.93 16.48 15.84 16.62 15.47 15.28 16.01 16.91 14.92 16.71 16.0 16.52 15.14 16.2 17.38 15.88 15.95 16.85 15.49 15.78 16.27 Q4FZY0 Efhd2 5 154.1609471 298609 - 154.1609471 154.17698 ef-hand domain-containing protein d2 None GIGEPQSPSRRVFNPYTEFK None None 32580 20.91 18.63 19.69 19.83 20.59 20.1 20.15 19.72 20.98 21.44 20.72 20.34 20.61 21.69 18.75 19.62 20.45 20.05 21.05 20.97 20.28 20.01 20.95 19.31 19.9 19.44 19.35 20.78 21.57 20.46 20.63 D4AE69 Tmem51 5 154.3258481 500578 - 154.3258481 154.375882 similar to bc003277 protein, isoform cra_a None LSISLPSYESLTGLDEATPTSTR None None 9966 16.53 15.03 16.69 16.34 15.19 15.15 15.34 15.01 16.13 17.12 16.39 15.11 16.5 15.95 15.51 15.95 17.25 15.36 15.62 15.77 16.23 17.17 16.03 16.0 15.56 15.71 15.71 16.18 16.3 16.31 16.13 Q5FWS6 Kazn 5 154.3951381 313672 - 154.3951381 154.495246 kazrin None QLDLKDNRMKELEAELAMAK None None None 17.66 17.13 18.73 18.91 16.77 16.92 16.65 17.47 16.54 17.34 16.56 17.55 17.33 17.53 17.76 16.02 17.49 16.19 17.12 17.73 17.05 18.42 16.77 16.39 18.22 17.92 17.89 17.31 18.3 18.38 17.84 A0A0G2JYD4 Vps13d 5 156.8305131 313825 - 156.8305131 157.055891 vacuolar protein sorting 13 homolog d None None None None 18.02 17.42 17.1 17.73 17.07 17.11 16.91 15.86 17.56 17.38 18.22 16.23 16.28 17.21 17.8 18.48 17.43 17.07 17.88 15.31 16.92 16.72 17.13 17.34 18.32 16.48 16.9 17.12 17.51 16.02 17.17 D3ZKC6 Vps13d 5 156.8305131 313825 - 156.8305131 157.055891 vacuolar protein sorting 13 homolog d None LRELVHDRFYKQEELAESLR None None 15583 17.87 17.71 17.1 17.73 17.07 17.11 16.96 15.86 17.56 17.38 18.22 16.23 16.24 17.21 17.83 18.48 17.47 17.0 17.83 15.34 16.92 16.72 17.05 17.26 18.32 16.48 16.84 17.14 17.61 16.1 17.12 F7FHF7 Mfn2 5 158.3059981 100911485 - 158.3059981 158.329484 mitofusin-2 None LSVLVDEYQMDFHPSPVVLK None None None 19.45 17.98 18.28 19.1 18.56 18.48 18.93 17.28 18.96 19.57 19.46 18.94 19.06 18.74 19.92 19.5 19.04 18.49 19.07 17.15 18.48 19.74 18.74 19.22 18.76 18.0 18.81 18.55 18.54 18.92 19.53 D4A3H5 Clcn6 5 158.4324541 295586 - 158.4324541 158.465224 chloride channel protein None NRGNEKEFMKGNQLISNNIK None 602726 985 17.58 15.05 17.27 17.45 16.45 16.58 17.1 16.43 16.21 18.15 17.42 16.85 17.87 17.31 17.61 17.05 18.23 16.42 16.94 16.96 17.31 17.96 17.67 17.47 18.11 16.92 17.22 16.4 17.43 17.59 17.27 P04646 Rpl35a 5 158.5437411 100359498 + 158.5437411 158.544072 60s ribosomal protein l35a None CAYVYKAKNNTVTPGGKPNK None None None 19.93 17.98 19.15 19.34 18.58 19.33 17.91 18.76 19.34 18.04 19.66 19.99 19.78 19.87 20.85 19.52 19.91 19.38 19.01 18.99 20.85 20.81 19.82 20.44 20.18 20.53 20.13 18.69 20.1 19.94 20.04 Q923V4 Fbxo6 5 158.5767241 192351 - 158.5767241 158.580294 f-box only protein 6 None YGMCLKSQMVDLKAEGYSEK None 605647 9274 18.87 16.53 19.23 18.63 17.66 18.84 18.67 17.98 18.15 18.79 18.14 18.83 18.37 18.36 18.86 18.2 18.04 18.13 18.17 19.89 19.2 20.0 18.62 18.26 17.78 19.03 18.76 17.53 19.77 19.45 19.29 D4A6R1 Fbxo44 5 158.5838771 500587 - 158.5838771 158.592346 f-box protein 44 None AGWYGPRVTNSSVIIGPPLP None 609111 9274 17.52 16.56 18.28 16.75 16.7 18.97 18.05 16.62 17.77 18.31 18.04 17.51 17.34 17.73 17.15 17.38 17.61 17.22 16.88 18.61 19.4 18.24 18.49 17.14 16.3 16.56 17.9 18.4 16.07 17.36 17.75 G3V774 Fbxo2 5 158.5929241 85273 + 158.5929241 158.598359 f-box only protein 2 None RLVCLRWKELVDGAPLWLLK None 607112 8132 20.92 17.65 19.68 19.65 20.34 19.46 19.77 20.02 18.78 19.61 21.17 18.77 19.93 19.17 19.39 20.09 19.63 19.57 18.43 21.32 18.79 19.55 20.33 19.64 20.56 19.49 19.1 19.19 20.18 20.11 19.31 P42346 Mtor 5 158.8848441 56718 + 158.8848441 158.994311 serine/threonine-protein kinase mtor None LLLPPIVKLFDAPEVPLPSR None 601231 None 19.46 16.85 18.9 19.13 17.21 17.56 18.95 18.34 18.71 18.47 18.46 18.43 19.08 19.6 19.47 18.22 19.08 18.76 19.47 17.17 20.25 19.34 19.31 18.9 19.66 20.28 18.98 18.98 18.23 19.27 19.15 D4A1X2 Exosc10 5 158.9952961 313707 + 158.9952961 159.018968 exosome component 10 None RPQLRFREKIDNSNTPFLPK None None None 16.26 14.71 16.15 17.12 16.57 15.81 15.54 15.95 16.68 14.57 16.28 16.89 15.51 15.48 16.58 16.41 17.25 15.32 16.91 15.43 16.61 16.65 16.27 16.77 17.4 16.92 16.39 16.83 16.05 17.41 17.61 Q99MI5 Srm 5 159.025921 100912604 + 159.025921 159.029071 spermidine synthase None QVEQLLHHRRSRYQDILVFR None None None 16.45 18.26 16.42 16.8 17.09 17.61 17.95 17.47 17.09 17.99 16.56 17.19 16.47 15.77 15.45 17.58 16.41 17.38 16.93 18.21 15.39 17.56 16.97 16.44 15.49 16.54 17.4 16.59 16.04 16.13 16.27 I6L9G6 Tardbp 5 159.05181 298648 - 159.05181 159.062045 tar dna-binding protein 43 None KVKRAVQKTSDLIVLGLPWK None 605078 7221 19.84 19.41 20.03 19.97 20.03 19.72 19.07 19.44 20.65 19.82 19.05 20.78 20.42 20.42 21.27 19.62 20.39 19.52 20.89 19.23 21.88 20.32 20.3 21.0 20.57 20.32 21.11 19.25 20.36 20.5 21.6 Q642G4 Pex14 5 159.3997791 64460 - 159.3997791 159.53626 peroxisomal membrane protein pex14 None PSSSPGKDGHSPEGSTATYR None 601791 34502 18.69 19.97 18.23 19.43 18.06 18.57 18.12 18.13 19.14 18.49 19.68 19.18 18.92 19.57 18.37 17.34 18.47 18.91 18.24 19.5 18.93 19.63 17.95 18.99 18.52 18.38 18.24 18.2 20.01 18.94 18.7 A0A0G2JY18 Dffa 5 159.5407311 114214 + 159.5407311 159.553638 dna fragmentation factor subunit alpha None LYLQALEKEGSILSNQNESK None 601882 3240 16.79 14.25 15.39 16.75 17.9 16.04 15.9 16.41 16.5 15.26 17.79 16.05 16.6 16.67 16.51 15.43 15.53 17.01 15.24 17.27 15.98 15.53 16.79 16.89 17.21 15.34 16.22 14.78 17.19 17.07 16.63 A0A0G2K7Q8 Kif1b 5 159.4885571 117548 - 159.4885571 159.718487 6-phosphogluconate dehydrogenase, decarboxylating None GPKMVQLEGSKQAFLEDVRK None 602784 997 19.91 20.64 21.13 20.73 20.44 19.03 20.75 21.66 19.65 19.68 19.99 19.36 20.12 19.64 19.53 20.32 20.05 20.75 20.16 21.38 19.66 19.73 19.34 20.22 21.01 20.94 20.74 20.03 19.55 19.85 21.52 O88658 Kif1b 5 159.4885571 117548 - 159.4885571 159.718487 kinesin-like protein kif1b None AEMGVAIREDGGTLGVFSPK None 602784 997 20.54 18.27 18.84 18.87 19.74 18.15 19.8 20.07 18.58 19.18 19.31 18.83 19.7 20.03 20.06 20.42 19.94 18.83 19.62 17.98 17.44 18.99 19.18 19.29 21.03 19.83 19.24 19.93 18.29 19.49 19.65 P85968 Pgd 5 159.5827471 100360180 - 159.5827471 159.598945 6-phosphogluconate dehydrogenase, decarboxylating None DSFLIEITANILKFQDTDGK None None None 19.88 20.66 21.12 20.59 20.24 19.03 20.72 21.64 19.66 19.71 19.94 19.37 20.13 19.73 19.34 20.23 19.99 20.85 20.22 21.37 19.9 19.86 19.32 20.25 20.97 20.99 20.77 20.01 19.56 19.85 21.51 F1M8V2 Ube4b 5 159.766831 298652 - 159.766831 159.870509 ubiquitination factor e4b None LLDESLESLKRIHEVQEEMK None 613565 107623 18.61 15.4 16.68 16.71 17.98 18.06 18.04 17.02 17.16 17.24 18.61 16.68 17.54 18.06 17.45 17.06 17.18 17.22 18.83 16.93 18.52 16.92 17.78 17.33 18.82 17.59 17.8 17.9 16.0 17.37 18.12 A0JPJ0 Nmnat1 5 159.9102441 298653 - 159.9102441 159.928154 nicotinamide-nucleotide adenylyltransferase None YLVPDLVQEYIEEHDLYNSESEDR None None 39074 16.61 14.23 16.77 14.77 16.31 16.86 15.3 15.83 17.07 15.16 17.03 16.63 16.02 16.83 16.72 15.71 16.1 16.13 16.06 15.49 17.71 16.54 16.8 16.96 15.52 15.91 15.96 15.09 17.49 16.93 16.87 Q5PQN7 Lzic 5 159.9283011 366507 + 159.9283011 159.94031 protein lzic None EMDRDLMVGKLERDLHTQQK None None 12301 19.55 18.14 19.47 18.11 19.01 19.42 18.95 19.23 18.3 17.34 18.91 18.12 18.18 17.28 17.36 18.47 18.59 19.51 17.77 19.85 18.51 19.34 18.76 17.68 19.81 17.96 19.04 18.21 18.68 19.05 19.32 Q4KM58 Ctnnbip1 5 159.9620461 503000 + 159.9620461 160.010939 catenin, beta-interacting protein 1 None SPEEMYIQQKVRVLLMLRKM None 607758 10641 14.99 16.94 15.14 14.61 15.1 16.85 15.11 15.73 14.13 16.78 14.5 15.64 14.76 15.33 16.63 15.29 15.06 15.37 14.51 15.4 15.5 15.87 15.47 15.72 15.39 16.37 16.11 14.55 15.71 15.36 14.53 Q6Q0N0 Clstn1 5 160.0312541 313717 + 160.0312541 160.094583 calsyntenin-1 None LYVHGCRLIFLLRQDPSEEK None None 8814 19.26 17.98 18.22 19.07 19.12 19.5 18.2 17.75 19.4 19.21 18.43 19.79 19.33 19.53 18.04 19.01 19.56 18.14 19.26 19.96 20.04 18.55 19.7 18.52 19.2 18.86 18.32 19.52 20.38 19.85 18.93 D3ZBW3 Tmem201 5 160.1659911 691426 - 160.1659911 160.188711 transmembrane protein 201 None LAAFTPREEGRYDEEIEVYR None None None 15.91 14.08 15.94 15.97 16.36 15.7 15.87 16.02 16.56 15.84 15.09 16.84 16.34 16.06 16.39 15.05 15.89 16.33 16.2 15.09 17.29 15.64 16.16 15.59 15.43 15.53 16.39 15.76 16.37 16.7 17.0 B2RZ89 Slc25a33 5 160.1950431 691431 - 160.1950431 160.219961 loc691431 protein None SLKKCLKEAPIVSSTDGTEK None None None 16.74 14.06 16.75 16.06 15.95 16.42 17.42 15.61 16.92 15.71 15.86 14.25 16.3 15.86 17.27 15.4 15.96 15.08 15.4 15.68 15.5 16.74 16.51 15.86 15.83 15.86 14.96 15.91 15.35 16.09 15.93 P04764 Eno1 5 160.7199521 24333 + 160.7199521 160.731336 alpha-enolase None VVEQEKIDQLMIEMDGTENK None 172430 74414 25.4 26.91 25.78 25.37 26.09 24.39 26.48 26.35 24.53 25.19 24.54 24.9 24.54 24.0 23.33 25.65 24.92 25.58 25.47 26.14 23.61 24.71 24.74 23.59 26.25 25.42 24.91 25.36 24.91 24.96 24.77 Q8K4S3 Slc45a1 5 161.1052471 246258 - 161.1052471 161.12932 proton-associated sugar transporter a None RGLERREGPLTLGLDGDVLR None 605763 44908 15.76 15.64 14.41 16.48 16.03 13.48 15.36 16.42 15.59 16.95 15.52 16.0 15.09 15.07 15.19 15.5 16.06 15.68 15.63 14.15 14.72 15.74 15.35 15.66 15.47 14.84 15.13 16.69 14.77 16.08 14.33 O88767 Park7 5 161.353721 117287 - 161.353721 161.376993 parkinson disease protein 7 homolog None VILAKGAEEMETVIPVDIMR None 602533 38295 23.52 23.21 22.86 21.61 24.01 23.19 22.31 22.35 23.73 22.12 22.62 21.25 21.56 23.69 22.2 23.05 21.21 23.46 22.97 23.99 22.42 21.84 22.68 22.4 24.43 22.38 23.5 21.59 23.68 22.32 23.74 P63025 Vamp3 5 161.498111 29528 - 161.498111 161.508742 vesicle-associated membrane protein 3 None RVNVDKVLERDQKLSELDDR None 603657 3511 21.97 21.26 22.11 21.67 20.54 21.75 22.19 21.23 22.62 23.05 21.41 21.28 22.11 22.4 21.58 21.77 22.6 20.85 21.55 21.72 22.36 22.46 22.26 21.06 20.15 22.09 20.25 22.4 22.76 21.73 21.84 F1M4M6 Camta1 5 161.5134491 362665 - 161.5134491 162.469761 calmodulin-binding transcription activator 1 None TDSWMAQWPREAVSSPEIPK None None None 15.51 16.14 14.67 15.47 15.32 14.5 14.84 14.38 15.09 14.92 14.66 14.92 14.41 16.82 14.57 14.46 15.88 15.93 15.14 15.42 16.48 15.36 14.77 15.84 16.52 17.04 15.53 14.41 16.95 15.58 16.27 B1WBY5 Dnajc11 5 162.4420431 362666 + 162.4420431 162.487961 dnaj (hsp40) homolog, subfamily c, member 11 None SAEELKAAYRRLCMLYHPDK None None 14558 19.82 17.96 19.15 19.44 18.19 19.29 19.34 17.56 18.31 18.55 18.93 18.44 18.76 19.2 18.47 18.84 19.11 18.26 20.02 18.84 20.69 19.07 18.86 18.41 20.17 19.52 18.75 19.41 18.88 18.92 20.2 G3V7B0 Nol9 5 162.5465651 313744 + 162.5465651 162.56359 nucleolar protein 9 None VLLQENILVRDNSEFVALNK None None 32589 15.49 15.5 15.96 15.37 15.93 14.22 15.3 15.03 15.44 15.19 15.33 14.74 15.33 15.05 15.71 14.86 16.35 15.21 15.93 13.64 16.48 15.42 15.37 15.43 16.51 15.36 14.65 16.12 15.63 15.02 15.95 Q6RFZ7 Plekhg5 5 162.5780721 310999 + 162.5780721 162.621513 pleckstrin homology domain-containing family g member 5 None EFLHLDLTAPMPGTSPEETR None 611101 10768 16.1 16.37 15.8 16.18 14.65 16.04 15.94 15.09 16.1 15.65 16.08 16.21 15.7 16.1 16.35 17.03 16.83 15.61 15.81 14.53 16.31 16.03 16.55 16.63 16.23 16.15 14.2 16.5 16.52 15.04 14.71 F8WG67 Acot7 5 162.6866121 26759 + 162.6866121 162.779313 acyl-coa thioesterase 7, isoform cra_a Bach None None None None 21.9 21.82 20.86 20.96 20.88 20.26 21.8 21.42 19.86 21.62 20.5 19.93 20.07 20.38 19.87 20.75 20.0 21.24 20.56 21.99 19.52 20.66 20.48 19.74 21.71 21.36 20.59 20.06 21.13 20.37 20.35 Q64559 Acot7 5 162.6866121 26759 + 162.6866121 162.779313 cytosolic acyl coenzyme a thioester hydrolase None GVTMKLMDEVAGIVAARHCK None 602587 15780 21.9 21.82 20.86 20.96 20.88 20.26 21.76 21.42 19.86 21.62 20.5 19.93 20.07 20.38 19.86 20.75 20.01 21.22 20.59 21.96 19.52 20.66 20.48 19.73 21.71 21.36 20.62 20.06 21.14 20.37 20.35 Q9WVM4 Icmt 5 162.8043691 170818 + 162.8043691 162.811128 protein-s-isoprenylcysteine o-methyltransferase None FGEEYLDYKKRVPTGLPFIK None 605851 5735 15.51 14.16 15.45 16.19 15.94 15.59 14.74 16.64 15.71 14.93 14.89 16.08 15.86 15.75 16.66 15.09 15.27 15.45 15.98 14.62 15.09 14.65 15.31 15.88 15.93 15.55 16.16 15.5 15.78 16.05 16.77 Q6PDV8 Rpl22 5 162.835241 100360057 + 162.835241 162.841973 60s ribosomal protein l22 None SYELRYFQINQDEEEEEDED None None None 17.65 20.0 16.93 18.28 17.29 18.92 17.07 18.0 17.35 17.66 17.78 19.25 17.74 17.43 17.52 18.96 18.94 18.66 17.16 17.32 17.05 18.33 17.22 17.69 17.77 18.59 17.88 17.2 19.17 17.01 18.1 D3ZD32 Chd5 5 162.8483951 691589 + 162.8483951 162.896291 chromodomain-helicase-dna-binding protein 5 None KMMTVLGAKWREFSANNPFK None None None 18.07 16.64 19.18 17.81 17.48 17.28 17.02 17.46 19.34 17.53 17.94 18.0 18.22 18.46 18.41 17.33 18.14 18.37 18.92 16.3 20.07 18.6 18.53 18.12 18.27 17.79 18.78 18.6 18.0 18.43 19.11 A0A0G2K670 Kcnab2 5 162.9017021 29738 - 162.9017021 162.988057 voltage-gated potassium channel subunit beta-2 None TAEVYAAGKAEVVLGNIIKK None 601142 56492 22.4 20.4 19.13 20.39 21.08 21.5 20.01 20.7 20.54 21.53 21.02 20.72 20.68 19.98 20.38 21.34 20.44 20.85 20.4 21.15 19.86 19.86 20.48 20.45 20.23 20.87 20.27 20.12 22.35 19.86 19.78 P62483 Kcnab2 5 162.9017021 29738 - 162.9017021 162.988057 voltage-gated potassium channel subunit beta-2 None GGKAETERGLSRKHIIEGLK None 601142 56492 22.41 20.21 19.12 20.41 21.09 21.51 20.01 20.66 20.52 21.48 21.04 20.76 20.75 19.95 20.4 21.37 20.46 20.75 20.46 21.13 19.86 19.86 20.55 20.35 20.3 20.86 20.45 20.06 22.32 19.92 19.79 F1LT49 Lrrc47 5 164.570541 362672 + 164.570541 164.580174 leucine-rich repeat-containing 47 None NALRRFLNSQTKLHDDLCEK None None 10795 19.88 19.17 19.76 19.55 18.1 19.02 19.25 18.49 18.18 18.83 18.22 17.45 18.02 18.18 19.28 19.39 19.44 18.36 19.41 17.57 19.52 19.66 18.05 18.92 20.09 19.21 19.91 18.64 17.7 19.41 18.12 A8WCF8 Tprg1l 5 164.7221551 687090 - 164.7221551 164.725358 tumor protein p63-regulated gene 1-like protein None QSLLICKYDFISLQCQQVVR None None None 19.04 20.35 19.47 19.11 17.76 19.34 19.31 18.88 18.23 19.58 17.93 17.08 18.63 18.21 16.95 19.04 19.67 18.92 18.83 18.81 18.04 19.18 18.12 18.84 18.51 19.43 18.86 18.67 17.49 18.19 17.78 D3ZVR7 Prxl2b 5 165.462571 362676 - 165.462571 165.465242 prostamide/prostaglandin f synthase None VGACVLKHAVTGEAVELRSL None None None 17.74 18.63 18.73 19.37 18.31 18.11 17.86 18.61 18.43 19.0 17.12 18.14 18.02 17.13 18.91 18.25 17.28 19.05 17.92 19.01 18.53 19.13 18.1 19.08 18.06 19.04 19.1 18.64 17.36 17.65 19.12 G3V7T3 Pank4 5 165.5252121 171053 + 165.5252121 165.542083 4'-phosphopantetheine phosphatase None AKAVSDVLESDPQFGFEEAK None 606162 41235 18.46 15.99 18.02 17.72 17.89 17.49 18.51 18.75 17.3 18.23 16.93 18.09 18.57 17.08 18.64 17.31 18.38 17.61 18.42 17.65 18.36 18.86 18.37 17.64 18.71 18.77 18.08 18.3 17.87 18.65 18.72 Q923S8 Pank4 5 165.5252121 171053 + 165.5252121 165.542083 4'-phosphopantetheine phosphatase None SLIVAERIAAMDPIICTALR None 606162 41235 18.42 15.84 18.11 17.53 17.76 17.75 18.64 18.62 17.1 17.97 16.96 18.14 18.48 17.04 18.62 17.21 18.3 17.53 18.35 17.6 18.44 18.84 18.31 17.3 18.64 18.6 17.85 18.42 17.9 18.57 18.66 D4AAX6 Plch2 5 165.5464131 313756 - 165.5464131 165.581898 phosphoinositide phospholipase c None WVTGLRYLMAGISDEDSLAR None 612836 85172 18.0 19.89 19.0 19.04 16.94 18.65 18.6 17.78 18.66 18.53 17.91 18.39 18.5 18.24 19.03 18.74 18.22 18.98 18.35 17.73 18.99 19.46 18.05 18.01 18.23 19.14 18.9 19.61 17.1 17.54 18.41 Q498C8 Rer1 5 165.6345691 298675 - 165.6345691 165.646643 protein rer1 None PKVDPSLMEDSDDGPSLPTK None None 5468 16.55 14.62 16.33 16.34 15.39 15.47 15.53 16.22 16.62 16.05 17.59 16.5 16.91 16.4 17.59 15.55 16.35 16.27 16.72 14.76 17.25 16.85 16.58 15.77 15.63 15.7 16.59 16.07 17.52 16.8 16.63 P09217 Prkcz 5 165.8184641 25522 - 165.8184641 165.930296 protein kinase c zeta type None IIYRDLKLDNVLLDADGHIK None 176982 55681 17.04 17.0 16.65 17.12 15.79 17.95 17.42 15.83 16.51 16.29 16.17 17.61 17.03 16.68 18.14 16.9 16.29 15.86 16.89 16.45 17.3 17.35 16.73 16.06 16.82 16.55 16.78 17.53 15.73 16.88 15.86 P18506 Gabrd 5 165.9584811 29689 - 165.9584811 165.970386 gamma-aminobutyric acid receptor subunit delta None TVENKLIRLQPDGVILYSIR None 137163 55489 16.65 17.75 16.88 16.78 17.11 16.19 16.47 17.05 18.29 17.85 16.51 17.63 17.66 17.83 18.0 16.71 16.92 16.38 17.98 16.73 17.89 17.22 16.56 17.54 16.65 16.63 17.21 17.15 17.78 16.77 18.82 P54311 Gnb1 5 166.0960891 24400 + 166.0960891 166.140805 guanine nucleotide-binding protein g(i)/g(s)/g(t) subunit beta-1 None RTLRGHLAKIYAMHWGTDSR None 139380 55532 21.41 23.11 22.67 23.12 22.41 23.06 23.4 22.93 23.66 23.84 22.56 23.72 23.85 22.63 22.01 23.46 23.28 22.81 23.13 23.38 24.15 23.23 23.87 22.32 21.59 22.76 21.54 23.56 24.31 22.57 22.61 D4A3G2 Cdk11b 5 166.2128911 252879 + 166.2128911 166.238878 cyclin-dependent kinase 11b None HDLKSLMETMKQPFLPGEVK None 176873 22416 16.31 16.55 17.83 16.94 16.63 16.62 15.78 16.84 18.17 16.44 16.28 17.41 17.05 18.0 17.73 16.31 17.05 16.46 18.16 17.26 18.81 17.43 16.8 17.98 17.61 16.7 16.66 17.87 17.89 17.67 18.69 P46892 Cdk11b 5 166.2128911 252879 + 166.2128911 166.238878 cyclin-dependent kinase 11b None EKEKEGFPLTSIREINTILK None 176873 22416 15.83 17.46 18.09 16.77 16.14 16.22 16.17 16.69 17.09 16.12 17.12 16.37 16.42 17.89 18.35 16.57 17.13 16.07 16.95 17.02 18.22 17.43 16.4 17.86 18.26 16.84 16.2 17.4 17.99 17.8 18.26 A0A140TAC8 Mib2 5 166.2437771 474147 - 166.2437771 166.25965 ring-type e3 ubiquitin transferase None None None None 15.1 16.45 14.22 14.17 14.37 15.81 14.54 14.06 14.54 16.18 15.75 15.15 14.15 14.81 14.93 14.15 16.4 13.89 15.1 14.24 16.03 15.92 14.43 15.98 13.64 14.94 14.74 14.49 14.88 14.27 14.8 Q68LP1 Mib2 5 166.2437771 474147 - 166.2437771 166.25965 e3 ubiquitin-protein ligase mib2 None VNAIQVPGPPRQLVEELQSR None None None 15.1 16.45 14.22 14.17 14.37 15.81 14.6 14.06 14.54 16.18 15.75 15.15 14.15 14.81 14.93 14.15 16.4 13.89 15.1 14.24 16.03 15.92 14.43 16.01 13.64 14.94 14.08 14.8 15.13 14.27 14.8 Q4KLK9 Ssu72 5 166.3136721 298681 + 166.3136721 166.343431 rna polymerase ii subunit a c-terminal domain phosphatase ssu72 None LILTCEERVYDQVVEDLNSR None None 6754 15.41 13.34 14.63 15.61 15.26 14.77 15.76 15.19 16.07 15.49 14.66 15.97 15.15 15.56 14.88 14.42 15.35 14.88 15.36 16.28 15.53 15.53 14.53 15.23 13.78 15.11 15.48 15.72 14.82 15.67 16.47 Q3KRE0 Atad3a 5 166.3503051 298682 - 166.3503051 166.370482 atpase family aaa domain-containing protein 3 None LTLLAVGVYSAKNATSVAGR None 612316 10059 19.3 19.57 17.97 18.42 20.13 19.4 18.19 17.71 20.61 17.82 18.95 18.31 18.33 19.73 20.03 19.95 18.35 19.43 19.28 17.46 18.0 18.44 18.75 19.67 19.94 18.4 19.43 17.87 19.68 17.77 20.42 D4AAB3 Tmem88b 5 166.3910811 680723 - 166.3910811 166.393904 rcg31229 None RTPDPRRLPRGSEDLADEEK None None None 16.89 15.37 15.33 15.92 16.28 18.08 17.03 17.21 16.63 16.19 16.39 15.56 16.13 15.72 15.77 16.04 16.85 15.71 15.29 16.98 15.25 16.31 16.47 15.69 15.77 16.1 15.02 15.37 17.45 17.59 15.1 B2GV62 Mrpl20 5 166.4089631 680747 + 166.4089631 166.413492 mitochondrial ribosomal protein l20 None AALAKRRQQEGFAAALGDGK None 611833 9941 16.22 14.04 15.9 16.31 15.71 15.7 14.72 15.44 15.38 15.8 15.76 14.87 16.61 15.32 14.92 16.3 15.88 16.22 16.54 16.11 15.15 15.95 16.23 16.81 17.72 16.98 16.98 15.92 15.51 16.45 16.77 A0A0G2KB26 Mxra8 5 166.4491671 313770 + 166.4491671 166.453648 matrix remodeling-associated protein 8 None AVATRDQAPYRTEDIQLDYK None None 11500 14.14 13.48 15.95 15.48 14.89 13.38 15.41 15.13 14.26 14.64 14.47 14.35 15.07 13.98 14.47 13.14 15.49 14.44 14.18 13.14 14.32 14.61 13.81 13.6 13.74 14.43 13.76 15.66 13.73 15.66 14.2 Q9WVB9 Dvl1 5 166.456991 83721 + 166.456991 166.468664 segment polarity protein dishevelled homolog dvl-1 None MAETKIIYHMDEEETPYLVK None 601225 20926 15.98 17.48 16.54 15.77 15.02 16.45 16.49 15.77 16.92 16.44 16.25 16.27 15.54 17.96 16.05 15.3 16.51 15.39 16.48 15.27 15.63 16.14 15.25 15.53 14.64 14.55 16.82 15.57 15.71 15.73 15.94 A0A0G2K5N8 Acap3 5 166.5007821 313772 + 166.5007821 166.515476 arfgap with coiled-coil, ankyrin repeat and ph domains 3 None QLVYQKKLKDALTVVVDDLR None None 23708 17.12 14.57 16.55 16.48 15.74 17.49 16.71 15.6 16.97 16.82 15.72 17.38 17.17 17.22 16.75 17.03 17.4 16.6 17.63 15.03 18.24 16.93 17.48 16.34 16.73 16.6 16.16 17.44 16.97 16.94 16.7 D3ZQC1 B3galt6 5 166.5842031 298690 - 166.5842031 166.586338 hexosyltransferase None PKDVWARFAVGTSGLGAEER None None 14549 16.42 13.23 14.43 15.22 14.11 15.13 15.11 14.7 14.9 15.28 15.44 14.79 15.33 16.16 15.41 15.66 15.81 16.02 14.86 14.7 14.86 16.05 15.62 16.25 16.0 16.21 14.97 15.29 14.38 15.46 15.62 Q91ZS3 Sdf4 5 166.5866351 155173 + 166.5866351 166.603745 45 kda calcium-binding protein None GMLKFMVKEIVRDLDQDGDK None None 32121 16.24 15.64 17.71 16.43 16.55 14.94 17.66 17.24 15.9 17.27 16.25 16.44 16.7 16.25 17.16 15.62 17.64 16.29 17.06 15.55 17.77 17.23 15.75 16.09 16.97 16.9 16.11 17.76 16.03 17.72 16.98 D4A2F1 Agrn 5 166.7492161 25592 - 166.7492161 166.782041 agrin None GCIRMLDINNQQLELSDWQR None 103320 27907 16.55 16.38 17.0 18.02 18.18 17.33 16.92 17.15 18.05 18.37 17.31 18.41 18.5 17.67 16.26 17.39 16.8 17.86 18.43 18.69 18.69 16.8 18.37 18.34 16.22 17.49 16.77 18.0 17.87 17.65 17.64 P25304 Agrn 5 166.7492161 25592 - 166.7492161 166.782041 agrin None NSTKVCGSDGVTYGNECQLK None 103320 27907 16.48 16.48 17.15 18.01 18.22 17.35 16.92 17.18 18.23 18.32 17.26 18.34 18.51 17.65 16.26 17.4 16.8 17.86 18.43 18.69 18.69 16.8 18.39 18.34 16.19 17.41 16.77 18.0 17.87 17.6 17.59 P97578 Fez2 6 16.6546141 94269 - 16.6546141 16.694624 fasciculation and elongation protein zeta-2 Zrp None None None None 16.62 14.52 15.72 17.65 16.9 17.06 17.13 16.36 17.47 16.1 17.09 17.43 17.27 16.76 15.63 15.64 17.02 17.05 16.04 16.51 16.5 16.55 16.99 16.42 16.2 15.43 15.5 17.16 17.15 17.52 16.91 G3V6L8 Strn 6 16.3353311 29149 - 16.3353311 16.417122 rcg61894, isoform cra_a None ISITAHEDRHIKFYDNNTGK None None 2380 20.44 18.52 19.07 19.18 19.59 19.92 18.51 18.88 19.8 19.36 19.58 19.12 19.45 20.25 18.03 19.01 20.19 18.93 19.41 19.54 18.91 19.89 20.13 19.8 19.39 18.72 18.55 19.09 20.75 19.69 18.48 P70483 Strn 6 16.3353311 29149 - 16.3353311 16.417122 striatin None QDSVINGTEAEVKETAMIGK None None 2380 20.47 19.05 19.06 19.2 19.62 19.92 18.73 18.86 19.83 19.36 19.56 19.12 19.34 20.24 18.22 18.99 20.31 18.77 19.34 19.41 18.89 19.9 20.13 19.94 19.39 18.71 18.47 18.85 20.67 19.65 18.2 F1LST0 Heatr5b 6 16.2434611 362683 - 16.2434611 16.323434 heat repeat-containing 5b None DVLAASSDMSAATLLSSGKDEESEK None None 25536 17.85 15.44 17.68 17.72 16.15 16.77 17.65 16.6 17.75 16.34 17.81 16.2 17.63 18.21 18.16 16.24 17.46 16.74 17.91 15.88 18.5 17.71 17.4 16.84 17.9 18.02 17.98 18.13 16.07 17.61 17.75 F1LV52 Gpatch11 6 16.2307681 362685 + 16.2307681 16.243292 coiled-coil domain-containing protein 75 None GQALGKTGDGIVEPIPLNVK None None 44687 15.45 15.0 16.09 15.04 14.97 15.69 16.21 16.08 17.06 14.53 15.76 15.79 15.09 16.53 16.16 15.2 16.44 15.21 16.44 14.48 16.95 16.73 16.4 16.24 16.9 14.81 15.06 15.88 15.3 15.95 16.61 Q63184 Eif2ak2 6 16.1889981 54287 - 16.1889981 16.224982 interferon-induced, double-stranded rna-activated protein kinase None IHKVKIIYKEISVTGPPHDR None None 48134 17.05 15.89 17.45 16.09 16.45 16.93 17.07 16.47 16.32 16.11 18.2 15.97 16.62 16.17 17.34 16.25 16.89 16.57 17.89 15.52 18.46 16.96 15.78 17.65 17.4 16.23 17.23 16.98 15.21 16.62 18.03 Q5XI79 Ndufaf7 6 16.1086341 298748 + 16.1086341 16.119809 protein arginine methyltransferase ndufaf7 None RHLMYKIKSTGPITVAEYMK None None None 17.94 18.32 17.09 15.76 16.7 16.05 17.22 16.74 18.55 17.27 17.44 16.48 16.37 18.94 15.71 17.13 16.86 16.75 18.63 17.32 16.84 18.07 16.75 18.07 17.86 15.95 17.14 17.53 16.58 16.06 16.98 F1LQ09 Atl2 6 15.1390471 298757 + 15.1390471 15.180426 atlastin gtpase 2 None FLEKRLQVKQNQHEELQNVR None None None 19.06 17.33 19.21 18.62 19.13 18.76 19.0 18.52 19.88 18.35 18.22 19.52 19.31 20.05 19.81 18.06 18.73 18.99 19.89 17.58 19.88 19.07 19.2 18.6 19.21 18.55 19.44 19.6 18.56 19.86 19.99 D4A3E1 Hnrnpll 6 14.9702851 313842 - 14.9702851 14.999595 heterogeneous nuclear ribonucleoprotein l-like None STSKRITRPGNTDDPSGGNK None None 26701 18.47 17.11 18.57 18.18 18.31 17.88 17.47 17.62 18.63 17.03 17.49 18.8 18.48 18.74 19.44 17.74 18.25 18.17 19.06 17.16 19.84 18.45 18.5 18.83 19.6 18.39 19.88 18.03 17.52 18.62 19.83 Q66HG4 Galm 6 14.8375381 313843 + 14.8375381 14.889429 galactose mutarotase None RIAKGRFTVDGKEYHLPINR None None 71795 18.85 17.28 20.58 18.62 18.49 19.25 19.58 19.77 18.67 19.02 20.2 17.91 19.03 19.0 18.82 19.1 18.19 19.65 18.8 20.41 20.17 18.34 20.26 17.7 18.04 18.72 19.86 19.31 18.69 19.7 19.42 D4A720 Srsf7 6 14.8118151 362687 - 14.8118151 14.817761 rcg61762, isoform cra_d None GTGAGKGELERAFSYYGPLR None 600572 None 19.74 17.77 20.4 19.65 19.66 19.24 18.22 19.29 19.88 18.54 19.0 19.75 20.12 20.32 20.62 18.95 19.34 19.42 20.29 19.29 21.16 19.07 20.06 20.34 20.38 19.24 20.75 19.07 19.97 20.17 20.45 A0A0G2JZH9 Dhx57 6 14.735941 366532 - 14.735941 14.776361 dexh-box helicase 57 None KRSYRRCDRPAKSLFAENSK None None 56267 16.35 14.62 17.05 16.52 15.63 15.99 17.15 15.57 15.77 16.34 16.76 15.62 16.44 15.84 15.85 17.16 17.29 15.67 17.0 15.31 16.92 17.03 15.92 15.99 16.51 17.46 15.83 16.78 15.88 16.13 17.6 D3Z8W6 Arhgef33 6 14.5514951 500608 + 14.5514951 14.725292 rho guanine nucleotide exchange factor 33 None GSLRYLIQQHLDLLHALQER None None None 17.33 16.87 17.43 17.2 17.76 17.27 17.36 17.58 18.38 17.11 17.03 18.52 18.28 18.33 17.13 17.08 16.87 18.75 18.11 17.8 18.77 17.57 17.5 17.06 17.66 17.55 17.93 18.82 17.68 17.76 19.04 D4A3T0 Sos1 6 14.5338511 313845 - 14.5338511 14.611688 sos ras/rac guanine nucleotide exchange factor 1 None KECMKQAITALLNVQSGMEK None 182530 4117 18.76 18.43 18.19 18.07 17.98 17.58 18.32 18.65 16.79 18.76 18.07 16.52 17.47 16.96 18.42 18.22 18.29 17.82 18.04 16.76 16.78 17.82 17.03 17.76 17.9 18.65 18.28 18.06 16.67 17.69 17.32 Q924I2 Map4k3 6 14.2771211 170920 - 14.2771211 14.44632 mitogen-activated protein kinase kinase kinase kinase 3 None GLFDYARQMQKLPVAIPAHK None None 2683 17.71 16.41 16.52 17.34 16.31 17.8 17.08 15.83 17.24 16.5 16.01 17.61 17.53 17.95 17.37 18.19 17.39 17.54 17.5 15.79 17.48 17.28 18.12 17.6 17.73 18.42 16.27 18.22 17.25 17.73 16.67 Q68FV0 Tmem178a 6 14.004631 362691 + 14.004631 14.063548 transmembrane protein 178a None LWRKCYFLGIDRDIDTLILK None None 12226 15.9 16.17 16.0 16.36 16.32 16.92 16.87 16.16 17.83 17.96 17.02 18.08 17.59 18.19 16.92 16.82 17.78 16.67 16.91 16.48 17.81 17.32 17.71 17.36 15.56 16.3 16.97 17.68 16.62 16.47 17.89 Q01728 Slc8a1 6 13.2712551 29715 - 13.2712551 13.532336 sodium/calcium exchanger 1 None GGGEDFEDTCGELEFQNDEIVK None 182305 69090 20.23 18.41 20.72 19.83 18.89 20.06 20.52 19.37 19.92 21.24 19.28 19.42 20.63 20.45 19.98 20.37 20.49 20.36 20.12 19.47 20.13 21.02 20.65 19.27 19.84 20.55 19.3 21.03 20.53 20.42 20.73 A0A0G2K2Z0 Eml4 6 11.2195411 313861 + 11.2195411 11.275022 emap-like 4 None VWDSVSLSTLHVIGLGTFER None 607442 56841 18.22 18.89 18.3 18.47 16.84 18.45 16.66 17.17 17.69 18.04 17.79 16.26 17.01 16.81 18.22 18.25 17.83 18.56 16.38 17.68 17.95 17.64 17.27 17.41 18.15 17.52 17.58 18.08 18.6 16.56 17.12 D3ZYX8 Cox7a2l 6 11.1843111 298762 - 11.1843111 11.198266 cytochrome c oxidase subunit 7a2-like None KADGVPIHLKRGLPDQMLYR None 605771 3463 19.76 20.71 19.36 20.54 19.03 17.16 19.62 18.09 19.91 19.45 18.99 19.52 19.18 19.43 19.08 19.78 18.96 19.16 20.46 18.72 18.29 20.26 18.68 18.22 19.8 18.44 18.83 18.69 20.85 18.36 18.82 A0A0G2JTK6 Mta3 6 10.8670111 100362346 + 10.8670111 10.986883 metastasis-associated 1 family, member 3 None AGTVNGAVGTPFQPQSALLGR None None None 17.03 18.46 17.17 17.2 16.75 17.03 15.46 15.69 16.46 15.19 17.43 17.25 16.63 16.98 18.34 16.34 17.3 16.46 16.74 15.74 18.77 17.02 16.22 17.81 18.37 17.45 17.98 16.58 17.04 16.4 17.8 Q6AY43 Dync2li1 6 9.9925381 298767 + 9.9925381 10.025381 cytoplasmic dynein 2 light intermediate chain 1 None AHYYGASLMFTSKSEALLLK None None 9336 14.43 16.86 16.56 14.83 15.47 15.34 16.67 15.81 15.5 15.79 15.45 14.8 16.28 15.94 16.3 15.76 15.24 15.77 16.34 15.78 16.63 15.34 15.15 15.08 16.34 16.36 16.45 15.46 14.71 15.43 16.0 F1LM33 Lrpprc 6 9.8598731 313867 - 9.8598731 9.942317 leucine-rich ppr motif-containing protein Lrp157 None None None None 20.24 19.99 19.49 20.7 20.73 19.22 20.71 20.87 19.86 19.53 19.26 20.15 20.95 19.83 21.25 20.01 20.17 20.03 20.8 19.01 19.82 19.43 19.06 20.31 20.98 21.14 20.46 19.61 20.07 19.65 22.01 Q5SGE0 Lrpprc 6 9.8598731 313867 - 9.8598731 9.942317 leucine-rich ppr motif-containing protein None ETLKAALDLEQVPSELAVTR None 607544 32695 20.24 19.99 19.47 20.7 20.73 19.23 20.71 20.87 19.87 19.54 19.27 20.16 20.95 19.83 21.25 20.01 20.17 20.03 20.8 19.01 19.82 19.43 19.06 20.31 20.94 21.13 20.46 19.61 20.07 19.65 22.01 P35815 Ppm1b 6 9.6466951 24667 + 9.6466951 9.708159 protein phosphatase 1b None EEIMQKSGEEGMPDLAHVMR None 603770 2027 18.0 17.39 19.76 18.25 18.2 18.35 18.63 17.64 19.43 18.06 17.42 17.56 18.42 19.33 17.65 17.88 18.49 18.67 18.1 20.29 20.01 18.96 18.85 18.87 18.62 18.82 19.4 17.42 18.26 19.36 19.88 Q99ND8 Ppm1b 6 9.6466951 24667 + 9.6466951 9.708159 protein-serine/threonine phosphatase None GKGPTEQLVSPEPEVYEILR None 603770 2027 18.31 17.21 19.64 18.36 18.24 18.17 18.53 17.44 19.49 17.94 17.56 17.83 18.64 19.22 17.63 18.02 18.39 18.86 18.01 20.23 20.03 19.05 18.96 18.95 18.49 18.87 19.34 17.71 17.95 19.28 19.66 A0A0G2JX67 Prepl 6 9.5805461 298771 - 9.5805461 9.607838 prolyl endopeptidase-like None SKDEEADSDNYEVLFNLEELK None 609557 15481 20.04 18.97 20.4 20.3 19.67 19.97 20.49 19.53 18.82 20.35 20.75 18.51 20.61 19.85 19.21 19.47 19.98 20.29 18.97 21.36 19.73 20.3 19.9 19.05 20.4 20.45 20.49 18.97 20.26 21.02 19.38 Q5HZA6 Prepl 6 9.5805461 298771 - 9.5805461 9.607838 prolyl endopeptidase-like None YKFAEGKLFEETGHEDPITK None 609557 15481 20.05 18.91 20.4 20.3 19.67 19.97 20.49 19.53 18.82 20.35 20.75 18.51 20.62 19.85 19.21 19.47 19.98 20.29 18.97 21.36 19.73 20.3 19.86 19.05 20.4 20.45 20.49 18.97 20.26 21.03 19.45 B0K012 Camkmt 6 9.1989471 299521 + 9.1989471 9.259334 calmodulin-lysine n-methyltransferase None RHVSVRRFESFNLFSVTEAK None None None 16.3 14.06 15.52 15.27 15.14 16.22 16.65 15.92 14.79 15.13 14.49 16.99 15.94 14.74 14.74 16.5 15.09 15.92 17.15 15.48 15.72 16.59 15.88 16.32 15.93 16.13 14.97 16.53 14.32 15.76 16.68 F1LMV8 Prkce 6 7.9650481 29340 + 7.9650481 8.146713 protein kinase c None KSAPTSPCDQELKELENNIR None 176975 48343 20.18 18.09 19.15 18.99 18.82 20.93 19.77 19.0 19.56 18.98 18.98 20.39 20.28 19.47 20.42 21.04 19.95 19.83 19.42 18.28 20.01 19.71 20.0 20.18 19.27 20.79 19.64 20.74 18.13 19.64 19.94 P09216 Prkce 6 7.9650481 29340 + 7.9650481 8.146713 protein kinase c epsilon type None NGHKFMATYLRQPTYCSHCR None 176975 48343 20.06 17.99 19.18 19.05 18.88 20.67 19.64 18.91 19.33 18.92 19.01 20.08 20.21 19.41 20.25 21.06 19.92 19.72 19.34 18.16 19.7 19.59 19.97 20.08 19.42 20.63 19.61 20.65 18.04 19.49 19.75 Q6P9U8 Eif3h 6 83.09131 108348062 + 83.09131 83.174277 eukaryotic translation initiation factor 3 subunit h None GGSGDSAVKQVQIDGLVVLK None None None 18.97 16.6 18.04 19.08 18.41 17.73 17.62 18.02 17.86 17.36 19.28 18.33 18.99 19.18 18.57 17.86 18.48 19.11 18.27 18.68 19.66 18.43 19.07 19.56 20.18 19.51 19.37 17.5 18.92 19.22 19.18 Q9JJL4 Rhoq 6 7.6149921 85428 + 7.6149921 7.65091 rho-related gtp-binding protein rhoq None SVVNPASFQNVKEEWVPELK None None 22704 17.74 19.28 18.61 18.55 18.61 20.07 19.64 19.24 19.74 19.82 18.74 19.95 19.71 19.31 19.71 18.83 18.52 19.4 18.69 18.86 20.47 19.4 19.76 19.61 17.85 19.06 17.95 19.07 19.75 18.72 18.54 Q8K5B3 Mcfd2 6 7.2744851 246117 - 7.2744851 7.285855 multiple coagulation factor deficiency protein 2 homolog None VLRDDDKNNDGYIDYAEFAK None 607788 44552 16.6 14.63 16.54 16.11 14.87 15.91 16.36 16.14 15.97 15.4 17.52 16.62 16.81 17.11 16.87 15.32 15.84 16.0 15.91 16.1 16.96 17.16 16.72 15.69 16.23 15.5 17.36 15.56 15.79 16.75 16.58 B1WBQ7 Msh2 6 6.8139411 81709 - 6.8139411 6.87288 dna mismatch repair protein None None None None 16.16 16.02 16.18 16.03 16.51 15.7 16.03 16.28 16.5 15.02 15.79 16.95 16.34 16.58 17.63 16.0 16.19 15.94 16.24 15.8 17.71 16.36 15.74 16.25 17.39 16.77 16.86 15.94 17.02 16.45 18.05 P54275 Msh2 6 6.8139411 81709 - 6.8139411 6.87288 dna mismatch repair protein msh2 None ALELEEFQSIGTSQGHDETQPAAK None 609309 210 16.16 16.02 16.18 16.03 16.51 15.7 16.03 16.28 16.5 15.02 15.79 16.95 16.34 16.58 17.63 16.0 16.19 15.94 16.24 15.8 17.71 16.36 15.74 16.25 17.39 16.77 16.86 15.94 17.02 16.45 18.05 D4A0U9 Msh6 6 6.5625211 100360342 + 6.5625211 6.579972 dna mismatch repair protein None DQALADIRENEQSLLEYLDK None None None 15.7 14.5 14.93 16.19 16.17 14.87 16.12 15.86 15.58 15.13 15.08 16.08 16.1 15.59 16.48 15.53 16.01 15.32 16.78 14.68 16.34 15.24 15.85 15.47 17.1 17.52 15.57 15.9 16.53 16.63 17.08 F1LYZ8 Ppp1r21 6 5.9015181 362697 + 5.9015181 5.970683 coiled-coil domain-containing protein 128 None LHIQFFEADEHHKLVEAELR None None None 18.62 16.51 17.68 17.65 16.81 18.11 17.15 18.66 18.48 16.68 17.88 19.49 18.59 18.19 17.3 18.37 17.96 18.62 18.39 18.36 18.95 18.25 18.57 18.46 18.63 18.29 17.58 19.02 18.77 18.38 18.66 A0A0U1RRR4 Nrxn1 6 3.181291 60391 - 3.181291 4.391363 neurexin-1-beta Nrxn1b None None None None 17.35 18.58 17.97 18.69 17.71 18.53 18.71 17.9 18.79 19.63 17.36 18.84 19.19 18.38 18.77 18.07 18.84 18.3 17.83 19.15 19.48 18.61 19.04 17.57 17.24 19.05 18.13 18.82 18.98 17.63 18.42 Q63372 Nrxn1 6 3.181291 60391 - 3.181291 4.391363 neurexin-1 None CENVATLDPITFETPESFISLPK None 600565 21005 19.47 18.01 19.22 19.94 19.09 19.69 19.16 18.61 20.16 20.4 18.61 20.34 20.3 20.16 18.79 19.12 20.39 19.54 19.41 20.04 20.62 19.76 20.25 19.97 18.06 20.12 18.64 20.59 19.98 20.0 20.11 Q63373 Nrxn1 6 3.181291 60391 - 3.181291 4.391363 neurexin-1-beta None KVLNMAAENDANIAIVGNVR None 600565 21005 19.0 17.07 19.01 18.95 18.67 19.44 18.09 17.65 18.98 18.68 18.04 19.75 19.44 19.91 18.04 18.51 19.47 18.81 19.0 18.93 19.77 18.92 19.55 19.64 18.45 19.08 18.9 19.19 18.48 19.51 19.4 Q6AXQ4 Mtm1 6 0.4892471 288762 + 0.4892471 0.506821 myotubularin None RFALKQEGHSRRDIFDVLTR None 300415 6040 16.27 14.38 17.24 16.42 15.92 16.6 16.19 15.41 17.46 16.46 16.42 15.69 17.04 16.45 15.43 16.12 16.22 16.77 16.79 15.8 16.79 16.55 16.81 15.09 15.22 15.85 16.43 16.94 17.03 16.72 16.95 Q5FWT1 Fam98a 6 19.8740831 313873 + 19.8740831 19.888742 protein fam98a None AHWEKIEAINQAIANEYEVR None None 41042 16.77 15.27 17.53 16.49 16.91 16.75 16.85 16.0 17.3 15.23 17.08 16.67 17.11 16.51 16.45 16.71 16.35 17.44 17.83 16.21 17.3 17.36 16.8 16.14 16.44 16.32 16.19 16.38 18.5 16.91 18.35 D3ZTG2 Ttc27 6 20.5587581 298782 - 20.5587581 20.702126 rcg61872, isoform cra_c None QEYLTKNLELNDDTVLNEIK None None 41191 16.23 14.98 16.23 16.82 16.52 15.21 16.17 16.28 14.76 16.31 17.2 15.6 16.58 15.64 15.39 16.0 15.75 17.07 15.54 16.43 16.0 15.89 15.91 14.69 16.48 15.68 16.74 15.54 16.41 17.02 16.29 A0A0G2JZ53 Birc6 6 20.7726921 313876 - 20.7726921 20.916258 baculoviral iap repeat-containing 6 None AVSRQLQDRLTPLEALLQTR None None None 17.98 15.21 16.72 17.78 16.79 17.64 17.34 16.77 18.64 16.26 18.26 17.9 17.69 17.79 17.84 16.79 17.63 17.35 18.17 15.71 18.96 16.96 18.22 17.12 17.95 16.9 17.17 19.08 16.72 17.85 17.58 A0A0G2K590 Spast 6 21.055351 362700 - 21.055351 21.106312 spastin Spg4 None None None None 18.35 16.31 18.09 17.98 17.45 18.42 18.08 18.2 16.89 18.03 18.44 16.93 18.27 17.84 18.49 17.54 17.98 17.92 18.08 16.65 16.53 18.99 17.97 18.11 18.74 18.33 18.76 18.19 16.27 18.43 17.97 B2RYN7 Spast 6 21.055351 362700 - 21.055351 21.106312 spastin None QALQEIVILPSLRPELFTGLR None 604277 8970 18.35 16.31 18.09 17.98 17.45 18.42 18.33 18.2 16.89 18.03 18.44 16.93 18.27 17.84 18.64 17.54 17.97 17.86 18.01 16.78 16.53 18.99 17.97 17.95 18.74 18.33 18.56 18.2 16.36 18.43 17.97 G3V946 Dpy30 6 21.1209481 286897 + 21.1209481 21.14172 aip1, isoform cra_a None VLAKERPPNPIEFLASYLLK None 612032 32582 16.54 18.42 16.2 17.2 17.2 15.43 16.97 17.31 16.12 16.78 16.1 16.86 16.11 17.28 16.19 16.39 15.22 16.93 16.8 17.94 16.52 16.19 16.13 15.48 16.84 17.67 17.36 16.39 17.01 16.29 16.5 Q8K3E7 Dpy30 6 21.1209481 286897 + 21.1209481 21.14172 protein dpy-30 homolog None KINAEKSSKQKVDLQSLPTR None 612032 32582 16.76 18.95 17.04 17.64 17.27 15.95 15.98 18.57 16.84 17.41 15.67 16.27 16.47 16.15 17.14 17.33 15.51 17.24 16.88 18.13 16.32 16.17 16.4 16.6 17.72 18.24 17.29 17.33 17.45 16.53 16.81 Q4QQR9 Memo1 6 21.1872881 298787 + 21.1872881 21.234359 protein memo1 None TICGRHPIGVLLNAITELQK None 601201 6272 17.62 15.33 17.16 16.62 17.58 16.23 16.56 16.88 16.12 16.17 17.32 16.51 16.6 15.58 17.04 18.05 15.96 17.35 16.07 17.54 16.36 16.13 16.88 17.06 17.31 16.56 17.42 15.66 16.45 16.97 17.16 P62142 Ppp1cb 6 23.9611 25594 - 23.9611 23.992735 serine/threonine-protein phosphatase pp1-beta catalytic subunit None IMRPTDVPDTGLLCDLLWSDPDK None 600590 37659 18.84 18.99 19.34 19.72 18.93 20.71 20.4 19.5 20.48 20.71 19.62 20.61 20.83 20.77 18.66 19.47 19.21 19.91 20.44 21.06 20.85 20.55 20.98 19.39 18.48 19.68 19.08 20.63 19.83 19.72 19.63 Q5EBB0 Sfn 6 22.9651631 298795 + 22.9651631 22.966435 similar to 14-3-3 protein sigma None LHTLSEDSYKDSTLIMQLLR None None None 24.74 26.79 23.83 25.54 25.65 23.55 25.03 25.91 24.37 24.83 24.03 24.71 24.66 23.81 23.69 25.64 24.26 25.81 24.81 25.19 23.61 24.23 24.12 24.9 25.78 26.49 23.79 25.55 24.67 24.19 24.94 D4A4Q3 Ypel5 6 22.6562851 298792 + 22.6562851 22.671691 protein yippee-like None ERALVRESEGFEEHVPSDNS None 609726 41097 14.78 12.91 14.11 15.42 14.1 14.08 14.38 13.74 14.29 14.9 14.12 15.87 15.41 14.8 14.57 15.95 14.0 14.85 15.6 15.06 15.53 15.49 15.21 15.17 14.69 15.02 14.51 14.5 15.01 15.14 15.27 A0A0G2KAD4 Lbh 6 22.5711851 683626 + 22.5711851 22.592832 protein lbh None DRLPSIVVEPTEGEVESGELR None None None 16.2 13.48 15.58 15.85 15.56 15.14 15.41 15.09 14.7 15.22 15.44 14.53 15.09 14.98 15.04 15.31 16.08 14.2 14.95 14.88 14.07 15.01 15.97 15.33 15.68 15.8 15.97 14.06 15.03 15.73 14.98 D3ZFF4 Lclat1 6 22.2307251 362702 + 22.2307251 22.373232 lysocardiolipin acyltransferase 1 None PEGTDLTENNKARSNDFAEK None None None 17.52 18.45 18.06 18.89 16.69 17.29 16.59 17.58 18.03 18.1 16.85 16.63 16.91 16.78 17.93 16.69 17.65 17.0 17.8 16.07 17.82 17.44 16.66 17.16 17.0 16.81 18.04 18.39 17.04 16.65 16.86 Q8R491 Ehd3 6 21.6407671 192249 + 21.6407671 21.666792 eh domain-containing protein 3 None PLLIPDNRKLFEAEEQDLFK None 605891 5607 21.09 19.36 21.33 19.76 19.21 20.9 20.7 20.37 20.78 20.81 21.11 19.45 20.66 20.89 21.1 20.09 20.46 20.24 21.06 18.94 20.8 20.91 21.25 20.55 20.0 20.23 20.54 20.88 19.28 20.13 19.99 P22985 Xdh 6 21.5302421 497811 - 21.5302421 21.592506 xanthine dehydrogenase/oxidase None QHGDNAKQLFQLDSPATPEK None 607633 324 16.97 14.29 15.26 15.86 16.49 15.88 16.17 15.57 15.0 15.88 17.4 15.23 16.28 15.02 15.6 14.09 16.13 16.31 15.62 15.82 16.86 16.35 14.81 15.17 16.78 15.86 14.94 15.23 17.31 16.32 16.08 Q6P7Q1 Babam2 6 24.3690231 362704 - 24.3690231 24.747345 brisc and brca1-a complex member 2 None CLLLVVKELVQQYHQFQCGR None None 3604 17.88 15.55 15.55 16.85 15.64 16.74 16.35 16.58 16.91 17.59 16.78 16.5 16.21 16.41 16.3 16.02 16.6 17.02 17.31 16.04 16.74 17.26 15.58 16.55 14.99 16.1 15.31 16.89 17.57 16.33 16.85 D3ZVU4 Rbks 6 24.7475131 362706 + 24.7475131 24.824434 ribokinase None CVTLSQAEPVPKHIPTEAVK None 611132 5482 17.15 14.91 16.89 17.1 17.69 16.12 16.79 17.91 16.41 16.48 16.03 15.83 17.17 16.0 15.64 17.28 16.1 16.75 17.09 18.35 15.44 16.26 17.26 16.82 18.06 17.75 17.67 16.22 16.26 17.42 17.22 D3ZTF1 Slc4a1ap 6 24.9061941 298805 - 24.9061941 24.933606 solute carrier family 4 member 1 adaptor protein None LPVDDSTGKQLVAEAIHSGK None 602655 7543 16.11 15.81 16.61 15.47 15.16 16.33 15.73 16.46 16.76 14.52 15.94 16.06 15.89 16.89 15.67 17.28 15.08 16.48 16.58 17.35 16.49 15.69 16.19 15.97 17.81 16.11 16.24 16.3 17.07 16.1 17.67 B1WBZ7 Gpn1 6 24.9351951 688393 - 24.9351951 24.965078 gpn-loop gtpase None GCPPYVINLDPAVHEVPFPANIDIR None None None 15.35 13.4 14.6 16.2 14.61 15.17 15.57 15.16 14.83 14.13 14.09 15.32 15.7 15.33 14.82 14.64 15.07 16.34 15.65 14.01 15.25 14.82 15.59 15.82 15.65 16.85 14.49 13.96 15.72 15.62 15.51 D3ZIF0 Zfp512 6 24.9769031 313906 - 24.9769031 25.007911 zinc finger protein 512 None IMGYLYHVRKCGKEASELEK None None 13026 16.69 16.61 18.74 17.06 16.9 17.46 16.63 17.1 18.8 17.21 17.21 17.63 17.37 17.75 18.55 16.96 17.18 17.49 18.16 16.39 19.64 18.14 17.67 17.81 16.97 17.49 18.29 17.12 18.15 17.97 18.64 Q9JKU3 Ift172 6 25.5585991 116475 + 25.5585991 25.614793 intraflagellar transport protein 172 homolog None EREATKKGGRGVEGLVEQAR None 607386 15202 16.76 14.62 16.73 16.93 16.69 14.34 16.91 17.25 15.48 15.99 16.1 15.4 16.4 15.41 16.4 16.67 15.79 17.5 15.9 15.6 14.62 15.69 15.91 15.1 17.11 16.66 15.71 16.84 15.83 16.16 17.03 Q3SWT7 Nrbp1 6 25.1226421 619579 - 25.1226421 25.13314 nuclear receptor binding protein None FISEADQSRLTSLLEETLNK None 606010 None 18.0 15.21 16.85 18.1 18.47 17.86 17.95 17.33 16.47 17.05 18.48 17.82 18.02 16.54 16.21 18.4 17.4 17.48 16.99 18.88 17.59 16.43 18.02 16.31 18.06 17.81 16.6 17.63 18.48 17.82 17.69 F1LNI5 Ppm1g 6 25.1535571 259229 + 25.1535571 25.173761 protein phosphatase 1g None ALQDAFLAIDAKLTTDEVIK None None 31106 17.73 16.49 18.55 18.07 17.85 17.47 17.22 17.14 19.09 16.98 17.3 18.58 18.29 18.35 17.0 17.15 17.36 18.11 19.12 18.92 19.82 18.16 18.03 18.52 18.64 17.89 18.75 18.47 17.22 18.44 19.33 Q6AYS6 Snx17 6 25.177531 298836 - 25.177531 25.182896 sorting nexin-17 None MLRRRVGGNLRRSDSQQAVK None 605963 8838 16.97 15.49 16.11 17.3 16.64 16.41 17.79 17.63 15.78 15.43 15.69 17.16 16.91 16.05 15.77 16.24 15.92 16.87 17.69 16.61 15.35 16.95 15.66 15.2 17.84 17.59 16.41 17.44 16.61 16.44 18.52 Q63186 Eif2b4 6 25.1832761 117019 + 25.1832761 25.188788 translation initiation factor eif-2b subunit delta None RKEEKGADQEIGSAVSAAQR None 606687 5976 17.15 15.85 17.63 17.2 16.35 17.07 16.53 17.0 18.94 16.23 17.35 16.87 17.71 17.54 17.71 16.46 17.83 18.04 17.46 15.48 18.21 18.25 17.87 17.39 16.7 16.94 18.38 18.2 16.88 17.91 17.89 Q6QIX3 Slc30a3 6 25.27741 366568 + 25.27741 25.284719 zinc transporter 3 None GSTAPTLRDVLLVLMEGAPR None 602878 74470 19.45 17.25 18.37 18.97 18.33 19.26 18.31 18.87 19.18 18.24 19.49 19.47 19.58 19.27 18.76 19.24 19.16 18.95 19.62 17.95 19.41 18.47 19.47 19.49 18.45 18.94 18.02 19.7 19.22 18.79 18.92 D4A8A0 Cad 6 25.2924071 24240 - 25.2924071 25.314903 aspartate carbamoyltransferase None QYYIIEVNARLSRSSALASK None 114010 1412 17.07 17.02 18.57 17.31 18.03 16.68 17.47 18.22 16.89 16.91 18.12 17.25 18.33 18.05 17.61 16.65 18.29 18.28 17.34 16.48 18.53 16.98 16.37 17.52 18.24 17.89 17.51 16.59 19.36 18.64 18.83 O70247 Slc5a6 6 25.3206531 170551 + 25.3206531 25.331719 sodium-dependent multivitamin transporter None LCWRSHNQDIPVVTNLFPEK None None 23277 15.75 13.93 15.59 15.39 13.64 15.0 15.76 15.64 14.99 14.13 16.79 14.43 15.59 15.54 14.85 14.37 15.5 14.74 15.98 14.44 15.02 16.93 15.99 15.21 15.83 15.64 14.63 14.7 15.98 16.1 14.95 Q5RK23 Abhd1 6 25.4187761 313917 - 25.4187761 25.427527 protein abhd1 None YRAVVFNNRGCRGEELLTHR None 612195 128916 15.3 16.0 16.1 15.83 16.28 15.53 15.75 15.43 14.67 15.98 16.95 15.63 15.59 14.37 15.97 16.2 16.67 16.27 14.87 14.52 14.96 15.49 15.77 15.75 16.05 15.69 15.05 16.78 14.5 15.26 15.86 G3V6W2 Preb 6 25.4188061 58842 + 25.4188061 25.422593 prolactin regulatory element-binding protein None LRIDPKTGLLIAAGGGGAAK None 606395 40877 18.17 15.59 18.57 17.19 16.71 18.07 17.53 18.26 16.86 17.82 18.94 17.01 17.73 17.3 18.76 17.38 17.54 17.37 17.63 16.44 17.85 18.32 17.73 17.24 17.69 16.66 17.25 18.3 17.67 18.26 17.5 Q9WTV0 Preb 6 25.4188061 58842 + 25.4188061 25.422593 prolactin regulatory element-binding protein None LEFKAHEGEIGDLALGPDGK None 606395 40877 18.45 15.74 18.57 17.42 16.88 17.96 17.53 18.3 16.86 17.82 18.94 17.01 17.55 17.43 18.76 17.13 17.54 17.37 17.63 16.44 17.8 18.11 17.52 17.24 17.69 16.66 17.25 18.3 17.67 18.37 17.64 P97586 Cgref1 6 25.4318471 245918 + 25.4318471 25.44385 cell growth regulator with ef hand domain protein 1 None SETQQSLGTKEEITSQVEAK None None 4790 15.23 14.05 15.11 15.73 16.21 15.76 15.28 14.67 14.41 16.15 14.8 14.53 15.87 14.97 15.91 13.47 16.04 14.81 13.87 14.39 15.19 14.93 15.16 16.08 15.01 14.99 14.56 14.15 14.89 15.74 14.45 Q02974 Khk 6 25.4453011 25659 - 25.4453011 25.455684 ketohexokinase None LSKGNSMQEALRFGCQVAGK None 229800 38187 17.05 17.66 17.0 17.46 17.89 16.34 17.33 17.33 16.34 15.49 17.55 16.91 16.59 16.92 15.88 17.49 17.34 17.15 16.53 18.38 16.09 16.33 16.03 16.95 18.46 17.72 16.74 16.52 17.24 17.68 17.22 Q5XIT1 Mapre3 6 25.5138071 298848 - 25.5138071 25.524967 microtubule-associated protein rp/eb family member 3 None PGDQIFNKSKKLIGTAVPQR None 605788 56565 21.71 22.99 21.46 21.13 20.51 21.22 22.12 21.54 21.43 22.66 20.12 20.36 20.49 20.74 20.19 21.57 20.94 21.64 21.07 21.71 20.89 21.75 20.45 21.53 20.54 22.03 21.08 21.58 19.54 20.52 21.1 Q9JHU0 Dpysl5 6 25.5751051 65208 - 25.5751051 25.659422 dihydropyrimidinase-related protein 5 None AMGKEDFTKIPHGVSGVQDR None 608383 41347 21.26 23.64 23.16 22.12 21.39 22.38 22.59 22.07 21.26 23.37 21.46 20.82 21.62 22.41 21.05 21.77 22.29 22.35 21.4 23.68 21.6 23.4 22.45 21.99 22.17 22.5 22.0 21.37 22.23 21.66 21.17 A0A0G2K867 Otof 6 25.9280561 84573 + 25.9280561 26.024631 otoferlin None None None None 15.7 15.05 14.67 15.49 15.36 13.93 15.65 13.69 14.46 14.41 15.98 13.51 14.55 14.86 14.27 15.22 15.64 14.75 13.39 15.37 14.27 14.06 13.55 13.34 14.92 15.3 14.32 15.75 14.3 15.1 13.86 Q9ERC5 Otof 6 25.9280561 84573 + 25.9280561 26.024631 otoferlin None PRMNTSLMANVKKAFIGENK None None None 15.7 15.05 14.67 15.49 15.36 13.93 15.65 13.69 14.46 14.41 15.98 13.51 14.55 14.86 14.27 15.22 15.64 14.75 13.39 15.37 14.27 14.06 13.55 13.34 14.92 15.3 14.32 15.75 14.3 15.1 13.86 Q60587 Hadhb 6 26.1535771 171155 - 26.1535771 26.181124 trifunctional enzyme subunit beta None YKDLMPHDLARAALSGLLYR None 143450 153 19.7 19.57 19.12 20.46 20.38 18.83 19.85 20.19 18.61 18.6 18.74 19.59 19.81 19.06 20.67 20.29 19.44 18.7 20.04 19.11 18.22 18.95 18.42 19.98 20.98 20.73 20.9 18.55 18.81 19.39 21.0 Q64428 Hadha 6 26.1877871 170670 + 26.1877871 26.227859 trifunctional enzyme subunit alpha None AVKTGLEQGNDAGYLAESEK None 600890 152 21.75 20.22 20.44 21.68 21.72 20.36 21.39 21.49 19.89 20.1 20.71 20.93 21.0 20.21 21.45 21.5 20.5 20.43 20.77 21.19 19.55 21.03 19.9 21.03 22.21 21.94 21.85 20.05 20.46 21.66 21.93 P35281 Rab10 6 26.2670981 50993 - 26.2670981 26.319739 ras-related protein rab-10 None KEPNSENVDISSGGGVTGWK None 612672 41111 22.35 24.23 22.08 21.57 21.6 23.2 21.81 22.13 22.64 23.89 21.9 21.82 21.64 21.74 23.14 22.75 21.67 21.98 21.33 22.43 22.18 23.04 21.52 22.73 20.65 22.51 20.78 22.42 23.24 21.23 22.04 Q5RKJ9 Rab10 6 26.2670981 50993 - 26.2670981 26.319739 rab10, member ras oncogene family None QIWDTAGQERFHTITTSYYR None 612672 41111 22.49 24.35 21.89 21.59 21.8 22.71 21.83 22.52 22.56 23.9 21.54 22.06 21.73 21.39 23.41 23.4 22.25 21.69 20.96 22.58 21.83 22.85 21.59 22.7 20.88 23.15 21.02 22.54 23.32 21.32 22.15 O55165 Kif3c 6 26.3670931 85248 + 26.3670931 26.406033 kinesin-like protein kif3c None EETMELRGTYSSLQQEVEVK None 602845 5883 18.75 16.13 18.58 18.72 16.84 19.14 18.37 19.2 18.13 16.81 18.54 18.09 19.22 17.85 19.27 17.69 18.97 17.97 18.28 16.73 17.95 18.68 18.38 18.78 19.07 18.9 18.16 17.96 17.91 18.73 18.44 A0A0G2JVM6 Dtnb 6 26.5664941 362715 + 26.5664941 26.763445 dystrobrevin None None None None 19.32 17.06 17.43 16.87 18.71 18.28 18.38 18.63 18.19 18.08 17.96 18.94 18.83 19.45 19.24 18.09 18.46 17.92 19.51 17.16 18.93 18.46 18.58 19.29 19.18 19.56 18.91 18.91 17.43 18.86 19.5 P84060 Dtnb 6 26.5664941 362715 + 26.5664941 26.763445 dystrobrevin beta None MSALQESRRELMVQLEGLMK None 602415 74875 19.32 17.06 17.43 16.87 18.71 18.28 18.38 18.63 18.19 18.08 17.96 18.94 18.83 19.45 19.24 18.09 18.46 17.92 19.51 17.16 18.93 18.46 18.58 19.29 19.18 19.56 18.91 18.91 17.43 18.86 19.5 F1LTW9 Efr3b 6 26.9499151 313928 - 26.9499151 27.020738 efr3 homolog b None PSNFLDRLLSTALMEDAEIR None None None 18.76 17.07 18.88 17.66 18.14 19.16 18.15 17.14 19.73 17.91 17.61 18.14 18.46 19.11 19.42 18.28 18.2 18.05 19.16 16.94 19.46 18.55 19.2 18.29 18.0 18.44 18.55 19.44 17.63 18.21 19.24 Q6IML7 Dnajc27 6 27.0686871 298859 + 27.0686871 27.098481 dnaj homolog subfamily c member 27 None KRPTANSSASYTKEQADTIR None None None 14.9 14.33 16.27 16.45 15.24 14.44 15.9 15.15 15.37 15.61 16.24 14.59 15.7 15.24 16.02 14.86 15.37 15.78 15.85 14.87 16.76 16.66 16.15 15.76 16.66 15.65 16.24 16.14 14.18 16.1 16.69 P21932 Adcy3 6 27.1250471 64508 + 27.1250471 27.204986 adenylate cyclase type 3 None VVDASEDEHELNQLLNEALLER None 103070 2978 16.8 18.33 18.05 18.83 16.89 16.25 17.23 17.26 16.38 17.74 16.35 15.66 16.59 16.42 16.56 17.3 17.01 16.35 17.63 16.56 15.88 17.15 16.38 17.94 17.75 17.35 16.43 17.84 15.8 16.75 16.26 D3ZBG6 Ptrhd1 6 27.2184181 298861 + 27.2184181 27.221805 aminoacyl-trna hydrolase None IATCIALRPYPKEEVSQYLK None None None 18.17 16.3 18.26 17.48 18.47 17.47 18.69 15.98 17.28 17.07 18.04 17.25 18.52 17.75 16.94 18.94 18.1 17.87 17.36 19.6 18.3 18.1 18.2 16.69 19.35 17.47 17.73 18.63 17.8 18.44 18.25 A0A0G2JZG4 Ncoa1 6 27.2325871 313929 - 27.2325871 27.475664 nuclear receptor coactivator SRC-1 None None None None 15.38 14.61 15.67 16.11 15.71 15.68 14.5 15.36 15.96 14.15 16.34 15.84 16.0 15.99 14.88 15.26 16.09 15.23 16.87 15.7 16.95 15.28 15.88 15.77 16.45 16.46 16.12 16.71 16.52 15.58 17.24 D4A3Q3 Ncoa1 6 27.2325871 313929 - 27.2325871 27.475664 nuclear receptor coactivator None RALGIDKLVQGGGLDVLSER None 602691 7859 15.38 14.61 15.67 16.11 15.71 15.68 14.5 15.36 15.96 14.15 16.34 15.84 16.0 15.99 14.88 15.26 16.09 15.23 16.87 15.7 16.95 15.28 15.88 15.77 16.45 16.46 16.12 16.71 16.52 15.58 17.24 P97534 Fkbp1b 6 27.8388671 58950 + 27.8388671 27.848638 peptidyl-prolyl cis-trans isomerase fkbp1b None KQEVIKGFEEGAAQMSLGQR None 600620 68380 16.31 15.04 15.59 16.1 17.09 16.06 15.36 16.69 15.34 15.73 16.1 15.49 16.45 14.9 14.99 16.43 16.7 15.97 15.71 15.5 14.75 14.65 16.04 15.14 15.88 15.57 15.58 16.6 16.16 15.66 15.97 M0R7A6 Itsn2 6 27.6381781 313934 - 27.6381781 27.72737 intersectin 2 None VRLNSKKKSLHLELEAVNGK None 604464 22627 19.8 16.68 18.03 18.91 18.34 18.95 17.63 18.07 18.53 18.68 18.89 19.0 19.03 19.55 19.04 18.95 19.17 19.16 18.69 17.31 18.88 18.28 19.32 19.4 18.93 19.25 19.25 18.92 18.56 18.83 18.4 Q7TMA5 Apob 6 30.8443391 54225 + 30.8443391 30.892493 apolipoprotein b-100 None KLSVPRLDFSSKASLNNEIK None 107730 328 18.14 17.06 17.92 18.88 18.88 17.33 18.31 18.52 17.71 17.14 20.09 17.36 17.54 17.37 19.18 18.44 17.18 17.8 17.18 17.98 16.22 17.12 17.51 18.33 18.06 17.96 18.65 17.59 16.53 17.92 17.96 Q5HZX7 Ldah 6 31.082061 313949 + 31.082061 31.166624 lipid droplet-associated hydrolase None AYLGGQEMIHVVKRDDGIIK None None 41453 16.76 13.71 15.55 15.88 15.49 16.4 16.9 16.95 16.49 16.67 15.82 16.66 16.32 16.09 16.89 15.48 15.82 16.6 16.23 15.01 16.87 15.9 16.53 16.09 14.55 15.58 15.35 16.74 14.8 16.28 16.4 D4A6D9 Hs1bp3 6 31.1925851 313950 + 31.1925851 31.22285 hcls1-binding protein 3 None EASLPPLPRKVLFVGESDIR None 609359 10980 17.12 18.33 17.24 17.14 17.32 17.97 17.83 17.26 16.3 17.49 17.51 16.37 16.16 16.34 16.54 17.65 16.4 17.91 16.27 18.22 16.12 16.65 16.7 15.95 17.3 16.53 17.22 17.11 16.16 16.71 16.13 P62747 Rhob 6 31.3637531 64373 - 31.3637531 31.365926 rho-related gtp-binding protein rhob None LRPLSYPDTDVILMCFSVDSPDSLENIPEK None None 68377 19.14 20.19 21.44 19.97 19.77 21.77 22.02 20.02 20.35 21.05 21.31 20.19 21.38 21.04 19.94 21.52 21.18 20.45 19.6 21.76 20.94 21.35 21.56 20.37 19.99 19.97 19.55 19.92 21.11 20.3 20.0 D3ZQL8 Pum2 6 31.4628911 298874 + 31.4628911 31.54297 pumilio 2 (drosophila) None GPEKGDQKGKASPFEEDQNR None 607205 69183 16.91 15.8 16.69 17.37 17.11 16.23 16.68 16.93 16.86 16.64 16.09 16.8 17.62 17.24 18.09 17.18 17.54 16.98 17.9 15.51 17.5 16.76 17.39 17.66 17.88 18.72 17.68 16.62 17.24 16.92 18.43 P26260 Sdc1 6 31.5627191 25216 + 31.5627191 31.585245 syndecan-1 None FMLYRMKKKDEGSYSLEEPK None 186355 2252 13.92 13.19 14.21 14.44 14.72 14.1 13.84 14.41 15.25 13.77 13.91 15.39 14.94 15.06 14.48 13.68 13.72 15.22 14.43 14.88 15.45 14.34 14.79 13.55 14.56 14.42 14.47 15.06 15.99 14.92 15.8 A6N6J5 Wdr35 6 31.7713611 503018 + 31.7713611 31.831029 wd repeat-containing protein 35 None KDVNIVQFYTPFGEHLGTLK None None None 16.26 16.3 18.04 17.08 17.18 15.65 16.93 16.15 16.6 16.61 17.1 15.91 16.03 16.92 17.01 16.24 16.28 16.73 15.83 17.1 16.59 16.83 16.65 16.9 16.99 15.57 17.26 16.5 15.38 16.73 16.27 D3ZUY0 Rdh14 6 33.1567911 500629 + 33.1567911 33.161707 retinol dehydrogenase 14 None RVIMGCRDRARAEEAAGQLR None None 75139 18.65 16.74 19.38 18.52 18.51 16.88 17.96 17.18 19.0 18.86 17.79 18.47 18.62 18.8 19.62 18.58 18.69 17.85 18.21 16.85 18.7 19.13 18.4 19.16 17.67 17.77 19.09 18.39 16.94 18.27 19.09 D4AB26 Smc6 6 33.9787671 313961 + 33.9787671 34.032419 smc6 structural maintenance of chromosomes 6-like 1 (yeast) None MKATQLEQMKEDYSYIMETK None 609387 None 16.78 14.32 15.49 16.8 16.45 15.32 14.81 16.75 16.17 16.09 15.85 15.45 16.72 14.89 17.53 17.34 16.21 15.91 15.72 15.29 15.13 15.83 16.42 16.1 16.12 17.85 17.04 15.9 16.8 16.12 17.04 P62762 Vsnl1 6 34.0386381 24877 - 34.0386381 34.159533 visinin-like protein 1 None DGDGKITRVEMLEIIEAIYK None 600817 2542 22.86 23.86 22.77 22.43 22.31 23.0 23.18 22.37 23.37 22.93 22.84 23.56 22.66 24.15 21.92 22.09 22.31 23.05 23.54 23.74 24.23 22.46 23.18 21.95 22.17 22.93 21.83 23.23 24.43 23.2 23.62 B0BN65 Fam49a 6 35.0451811 298890 + 35.0451811 35.154537 family with sequence similarity 49, member a None NNEMANRMSLFYAEATPMLK None None 12657 19.78 18.19 18.3 18.71 19.18 19.58 19.87 19.01 18.95 19.52 19.06 19.57 19.61 20.13 19.04 20.39 19.66 19.34 20.17 18.05 18.95 18.74 20.1 19.18 19.42 20.29 19.15 19.44 18.61 19.16 19.3 Q641Y8 Ddx1 6 35.9964661 84474 - 35.9964661 36.027375 atp-dependent rna helicase ddx1 None PACVLKNAELKFNFGEEEFK None 601257 3627 20.84 19.62 21.3 20.34 20.88 20.61 20.62 20.55 21.25 19.64 20.31 21.59 20.94 21.26 21.04 19.98 19.33 20.84 21.52 21.58 22.65 20.85 21.01 19.73 21.33 20.39 20.71 21.2 21.99 21.67 22.09 F1M0U5 Nbas 6 36.0483881 690073 + 36.0483881 36.353866 nbas subunit of nrz tethering complex None CGLNTKVTSSLHDMVDQLEK None None None 18.22 15.32 17.85 17.91 16.36 18.25 17.88 17.2 16.75 17.59 18.68 17.48 17.57 16.4 18.6 17.65 17.79 17.0 17.96 16.0 17.66 18.36 17.84 18.11 18.36 16.66 17.62 16.52 17.35 18.67 17.61 A0A0G2JW03 Lpin1 6 39.3127491 313977 - 39.3127491 39.380176 phosphatidate phosphatase None REVIEKKPEKFKVQCLTDIK None 605518 9266 15.8 17.09 16.31 16.46 16.68 16.03 15.8 15.05 16.37 15.38 17.75 15.32 15.95 16.95 15.71 16.05 15.91 16.78 16.75 15.91 16.63 16.89 15.99 15.98 17.28 16.16 15.75 16.96 17.69 16.3 16.12 A0A0G2K5N6 Rock2 6 39.6793721 25537 + 39.6793721 39.774031 rho-associated protein kinase None ANEGESKKEPEFPVEPVGEK None 604002 21010 20.4 18.88 19.42 19.38 20.16 20.4 19.59 20.37 20.65 19.28 19.93 21.45 21.22 21.18 19.71 20.88 20.85 20.76 20.07 20.89 20.39 20.25 20.69 20.8 20.43 21.35 20.74 21.51 19.46 20.91 20.89 Q62868 Rock2 6 39.6793721 25537 + 39.6793721 39.774031 rho-associated protein kinase 2 None HIKCHKDHMDKKEEIIAPCK None 604002 21010 20.42 18.87 19.43 19.38 20.16 20.4 19.6 20.37 20.65 19.28 19.92 21.46 21.22 21.18 19.76 20.88 20.89 20.72 20.07 20.86 20.39 20.25 20.69 20.76 20.42 21.34 20.74 21.52 19.47 20.9 20.9 Q63081 Pdia6 6 40.0629321 286906 + 40.0629321 40.080221 protein disulfide-isomerase a6 None CKNLEPEWAAAATEVKEQTK None 611099 4198 21.3 19.23 20.36 20.48 20.18 19.84 21.12 21.99 19.61 20.11 21.51 20.48 21.12 20.73 21.18 19.6 20.81 20.89 20.3 19.13 19.53 20.71 20.66 20.19 21.62 20.08 20.85 21.66 18.84 20.81 21.06 P62749 Hpcal1 6 40.4782131 50871 + 40.4782131 40.584683 hippocalcin-like protein 1 None TVDEFKKIYANFFPYGDASK None 600207 37586 20.28 19.91 20.64 19.99 21.17 21.02 20.9 20.38 21.38 20.2 19.91 21.64 21.61 21.16 21.49 20.9 19.44 20.8 21.69 20.63 21.63 20.75 20.36 20.04 20.69 20.73 20.1 21.2 22.03 21.09 22.37 A0A0G2K808 Asap2 6 40.7155041 362719 + 40.7155041 40.81609 arfgap with sh3 domain, ankyrin repeat and ph domain 2 None SSQPGTSQSKPPPLPPQPPSR None None None 18.85 17.2 18.46 17.66 18.76 18.8 18.16 17.89 19.8 17.94 19.42 20.05 19.2 20.32 17.14 18.65 19.06 18.69 19.99 19.53 20.15 18.59 19.45 18.56 18.7 18.37 18.77 20.14 19.4 19.8 19.49 G3V6W7 Cpsf3 6 40.8362051 298916 + 40.8362051 40.864128 cleavage and polyadenylation specificity factor 3, isoform cra_a None IRPLGAGQEVGRSCIILEFK None None 6499 15.38 14.15 15.81 15.76 16.19 15.43 14.63 15.95 15.94 14.97 15.4 16.64 15.38 15.47 16.97 15.0 16.02 15.18 15.87 14.97 17.3 16.0 15.88 16.38 16.56 15.3 16.56 15.11 16.67 16.63 16.83 Q711G3 Iah1 6 40.8655311 298917 + 40.8655311 40.872745 isoamyl acetate-hydrolyzing esterase 1 homolog None QHVPLDEYSANLRDMVQYLR None None 41674 19.92 18.04 18.72 19.69 18.67 20.02 20.77 19.9 19.94 19.89 18.91 20.32 19.86 19.31 18.61 18.89 18.5 19.57 19.98 20.79 20.39 19.92 19.65 18.84 18.41 19.52 19.61 19.07 19.47 20.21 20.33 Q9Z1K9 Adam17 6 40.8729461 57027 - 40.8729461 40.9207 disintegrin and metalloproteinase domain-containing protein 17 None YYNPGVKKNIYLNSGLTSTK None 603639 2395 16.26 14.65 16.87 15.84 16.66 15.71 16.09 16.21 16.88 15.26 16.56 15.92 16.42 16.28 16.12 17.17 15.49 17.51 15.77 16.57 16.87 15.68 16.46 16.46 16.85 15.95 17.44 16.12 15.4 17.33 17.37 P68255 Ywhaq 6 40.9357151 25577 - 40.9357151 40.96624 14-3-3 protein theta None NATNPESKVFYLKMKGDYFR None None 105677 24.58 22.75 23.37 23.65 23.84 24.51 25.08 24.32 24.69 24.77 23.25 24.79 25.05 24.62 22.98 23.78 23.83 25.25 24.46 25.26 25.76 24.61 24.66 23.96 23.83 25.44 23.66 24.93 24.06 24.95 25.18 Q3T1J2 Mboat2 6 41.4711621 313997 + 41.4711621 41.593485 lysophospholipid acyltransferase 2 None VKKSPRKKNTEENAQPSWAK None 611949 6971 16.34 14.28 16.99 15.68 16.35 15.34 15.4 15.54 15.75 15.95 16.86 14.82 16.47 15.51 17.07 16.11 15.82 15.13 16.46 15.57 16.82 16.23 16.08 16.25 16.06 16.26 17.08 15.54 15.71 16.8 16.45 Q9EQG6 Kidins220 6 41.6182951 116478 + 41.6182951 41.703256 kinase d-interacting substrate of 220 kda None IKKANINGRVLSQCNIDELK None None 14254 17.99 17.24 18.79 18.69 16.69 18.04 17.6 16.44 17.46 17.25 16.57 16.81 17.95 18.33 17.76 17.16 18.88 17.3 17.9 16.85 17.92 18.6 17.49 17.88 18.27 18.99 17.23 17.96 18.05 17.71 17.21 D3ZC63 Cmpk2 6 43.0736871 314004 + 43.0736871 43.085186 cytidine/uridine monophosphate kinase 2 None VDASPSRETVLQTVLQLIQR None 611787 10748 19.14 20.2 18.44 18.92 18.38 18.42 19.37 17.81 18.19 20.05 19.14 17.39 17.83 18.05 18.2 18.48 17.86 18.01 19.1 19.77 19.14 18.83 18.22 18.54 19.04 18.42 19.22 18.07 17.51 17.75 18.26 P62083 Rps7 6 45.2662011 100362830 - 45.2662011 45.271112 40s ribosomal protein s7 None IVKPNGEKPDEFESGISQALLELEMNSDLK None None None 20.18 18.85 19.64 21.0 20.67 18.68 18.78 20.82 19.56 20.04 19.23 19.56 20.72 20.05 20.24 20.55 20.76 19.58 20.27 19.49 18.86 19.89 20.21 20.6 20.96 21.43 20.76 19.1 21.21 20.33 21.24 Q562C9 Adi1 6 45.3068581 298934 + 45.3068581 45.313904 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase None LYWKLDADKYENDPELEQIR None 613400 74768 18.09 16.06 18.0 17.1 16.05 17.61 17.62 16.41 17.04 17.35 17.4 16.7 15.63 16.61 16.98 15.95 16.0 18.33 16.96 16.13 18.4 17.55 16.4 16.18 15.91 15.66 17.04 16.35 16.94 17.63 17.73 D3ZE49 Trappc12 6 45.3219851 314013 - 45.3219851 45.386951 trafficking protein particle complex 12 None TQQYGTVFIDKENLTMPGLK None None 34805 19.28 16.46 18.79 16.85 18.4 18.26 17.87 17.53 18.32 15.91 18.35 17.92 17.86 17.88 18.55 17.37 16.29 17.08 18.65 18.36 16.38 19.23 18.1 16.89 18.06 16.67 18.85 16.44 18.84 17.3 17.95 Q5PPK9 Eipr1 6 45.3884521 362721 + 45.3884521 45.502042 earp and garp complex-interacting protein 1 None KYDNQIHIIDFDDENNIINK None 608998 2481 18.86 16.6 17.29 18.91 18.89 19.24 18.17 16.59 16.88 17.69 19.27 17.78 18.79 17.89 19.66 17.74 17.21 17.75 17.55 18.31 17.23 18.81 18.33 19.16 18.68 18.46 16.78 17.25 19.11 18.81 16.8 P70475 Myt1l 6 46.1710661 116668 + 46.1710661 46.573958 myelin transcription factor 1-like protein None QMLTIKQRASNGIENDEEIK None 613084 7435 16.06 13.83 14.92 16.37 15.42 17.16 14.74 16.05 16.58 14.98 16.38 16.82 16.75 16.34 15.71 16.46 16.75 17.21 15.84 15.17 15.4 16.41 16.47 16.63 16.83 16.29 16.01 16.29 17.16 16.59 16.69 A0A0G2K394 Acp1 6 47.5063921 24161 - 47.5063921 47.522021 low molecular weight cytosolic acid phosphatase None TREDFATFDYILCMDESNLR None 171500 38274 19.34 17.36 19.55 18.37 19.79 17.7 20.24 19.51 18.0 19.73 18.13 17.88 19.13 17.68 17.26 19.18 18.52 18.61 18.78 20.23 17.57 18.38 18.87 17.51 18.69 18.78 18.3 19.14 18.03 19.06 19.21 P41498 Acp1 6 47.5063921 24161 - 47.5063921 47.522021 low molecular weight phosphotyrosine protein phosphatase None NQVKNCKAKIELLGSYDPQK None 171500 38274 19.75 17.32 20.18 18.06 18.47 19.13 20.32 20.29 17.95 20.35 18.51 18.03 18.8 17.64 18.38 18.27 19.17 19.5 17.56 19.89 19.24 19.56 19.33 18.24 18.13 18.58 18.11 18.84 18.23 19.54 19.03 D3ZQN7 Lamb1 6 47.8355321 298941 + 47.8355321 47.902555 laminin subunit beta 1 None SEAKVRADEAKQNAQDVLLK None 150240 1722 17.55 15.87 16.93 15.9 15.36 16.14 16.22 16.22 15.28 16.15 17.88 15.58 15.52 16.39 15.48 17.12 16.71 17.45 15.27 15.63 15.49 17.11 16.61 16.12 15.87 15.93 14.46 16.8 16.85 16.02 14.75 Q6P6R2 Dld 6 47.9041541 298942 - 47.9041541 47.924814 dihydrolipoyl dehydrogenase None FPFAANSRAKTNADTDGMVK None 238331 84 22.35 22.98 23.17 22.37 22.8 22.97 22.95 20.74 23.36 22.39 23.82 22.18 22.49 23.84 21.84 22.7 22.21 21.75 23.0 23.87 23.07 22.42 23.32 21.0 21.73 21.28 22.3 23.25 23.54 22.86 22.32 D3ZS02 Cbll1 6 48.0713021 314028 - 48.0713021 48.085439 ring-type e3 ubiquitin transferase None DFKINILGEKDDTPVHFCDK None 606872 11734 17.69 17.81 17.53 15.91 15.98 17.49 15.67 16.2 17.23 18.07 16.36 16.83 15.74 17.62 15.87 15.95 15.97 17.31 17.11 17.79 18.05 17.4 16.58 17.1 15.35 16.01 16.66 16.55 18.14 16.26 16.31 Q5XIU4 Bcap29 6 48.1827131 298943 - 48.1827131 48.222465 b-cell receptor-associated protein None ELKKASDALFKAQNDVMTMK None None 22411 18.11 16.46 17.56 17.85 17.8 16.7 17.68 17.17 17.48 17.1 17.78 17.15 17.91 17.91 17.47 17.27 18.07 17.35 17.7 17.3 17.21 17.1 17.71 16.69 16.75 18.58 17.48 17.46 18.01 17.51 17.73 A0A0G2K9P5 Cog5 6 48.253491 314030 + 48.253491 48.528855 conserved oligomeric golgi complex subunit 5 None HEDLLAQATGIESLEGVLQMMQTR None None 42221 16.18 13.73 15.77 16.69 15.6 15.33 16.41 14.96 15.81 14.56 17.15 15.82 16.27 14.68 16.03 15.95 15.81 15.69 16.63 14.57 16.48 16.16 16.47 14.72 16.65 15.22 16.09 16.42 15.26 16.46 16.13 P12369 Prkar2b 6 48.5636661 24679 - 48.5636661 48.653933 camp-dependent protein kinase type ii-beta regulatory subunit None GNYDNRGSFGELALMYNTPR None 176912 37666 21.65 22.13 20.05 21.14 20.51 20.28 20.24 20.51 21.02 21.64 20.49 20.35 20.12 21.23 19.28 20.44 21.74 21.05 20.27 20.23 20.45 21.14 20.8 21.46 19.9 20.89 20.29 20.93 19.95 19.75 19.93 Q80Z29 Nampt 6 49.4253171 297508 + 49.4253171 49.460343 nicotinamide phosphoribosyltransferase None VSDSYDIYNACEKIWGEDLR None 608764 4201 19.59 17.35 19.19 18.77 19.51 19.72 19.73 19.02 18.28 18.07 19.91 18.64 19.41 18.17 18.98 19.44 18.1 20.1 19.4 19.56 18.51 19.4 19.03 19.23 19.84 18.43 19.31 18.03 19.15 19.25 20.48 A0A0G2KA82 Sypl1 6 49.5651281 366595 + 49.5651281 49.584184 synaptophysin-like 1 None RMSTFQINLNPLKEPLGFIK None None 4915 16.63 15.38 16.02 17.09 17.87 17.57 17.72 17.99 16.78 17.58 17.11 17.6 17.8 16.39 16.06 17.79 16.37 16.98 17.59 18.07 16.12 15.71 17.46 16.79 16.12 17.29 16.69 16.45 17.59 17.2 16.65 E5RQ38 Hdac9 6 50.7635911 687001 - 50.7635911 51.325171 histone deacetylase None ERAVASTEVKQKLQEFLLSK None None None 16.56 15.66 18.16 17.2 17.66 16.04 16.39 17.44 17.8 15.71 17.87 16.33 17.4 16.81 16.26 17.07 16.06 17.75 17.86 17.22 17.58 16.47 17.25 18.67 17.46 16.67 17.14 16.88 16.48 17.15 17.21 A0A0G2JUH8 Snx13 6 51.759291 362731 + 51.759291 51.859322 sorting nexin 13 None ERLGQDIKQSFFKVPPLITK None 606589 41011 15.75 17.21 16.42 16.76 16.68 15.1 16.14 15.79 15.69 14.91 16.52 15.44 15.2 15.96 16.21 16.22 16.47 15.37 16.21 14.53 15.2 15.06 15.43 15.08 17.32 15.56 16.31 16.5 15.34 15.23 15.53 Q9WTT7 Bzw2 6 52.8276621 171439 - 52.8276621 52.888607 basic leucine zipper and w2 domain-containing protein 2 None QKIVVLFYKADVLSEEAILK None None 8530 17.38 17.11 17.84 17.59 16.96 18.42 18.09 17.24 18.16 17.09 19.19 17.52 18.88 18.55 18.12 16.93 17.67 17.68 19.01 16.77 19.57 17.81 18.64 17.89 18.38 17.62 18.39 17.86 17.08 17.34 17.57 A0A0G2K8N6 Ankmy2 6 52.8889641 314046 + 52.8889641 52.930335 ankyrin repeat and mynd domain-containing 2 None LADAAALGKCYKVMDLICEK None None 10662 19.62 18.19 19.97 18.18 18.27 19.04 19.96 17.5 18.94 20.13 19.6 17.65 18.65 19.18 19.84 18.55 19.33 18.75 18.88 17.57 19.4 20.6 19.21 18.39 17.68 18.62 19.2 19.08 17.86 18.92 17.9 Q5S6T3 Crppa 6 53.1213421 493574 + 53.1213421 53.397028 d-ribitol-5-phosphate cytidylyltransferase None AGAGLAFPAFPLSAAGAEPGSR None None None 16.98 14.66 16.17 17.8 17.89 16.26 16.98 15.74 16.65 15.05 17.41 16.67 17.42 17.19 15.6 15.59 15.62 16.25 17.35 17.89 16.33 15.49 16.91 15.81 17.77 16.07 17.83 16.16 15.86 17.22 16.54 F1LP01 Dgkb 6 54.6413161 54248 + 54.6413161 55.397104 diacylglycerol kinase None MTNQEKWAHLSPSEFSQLQK None 604070 37875 18.81 17.53 18.54 18.41 18.93 19.47 18.94 18.03 19.34 18.91 18.81 18.66 19.72 19.43 19.33 18.94 19.41 18.6 19.54 17.31 19.11 19.76 19.88 19.73 18.63 18.79 18.6 18.42 18.67 18.31 18.4 P49621 Dgkb 6 54.6413161 54248 + 54.6413161 55.397104 diacylglycerol kinase beta None STKKLKDVLEEFHGNGVLAK None 604070 37875 19.77 17.6 18.43 18.43 18.96 19.49 18.96 18.09 19.36 18.79 18.77 18.75 19.34 19.41 19.33 18.95 19.41 18.64 19.55 17.28 19.02 19.76 19.53 19.71 18.61 18.95 18.65 18.42 18.64 18.57 18.64 D3ZCN9 Rps10-ps6 6 56.6691041 - 56.6691041 56.6696 s10_plectin domain-containing protein None RGKADRDTYRRSAVPPGADK None None None 18.92 21.04 19.65 20.01 20.17 18.46 17.97 20.99 19.66 20.22 18.61 19.27 19.17 18.45 18.86 20.2 18.89 20.5 19.57 19.51 18.54 18.44 18.71 20.1 18.81 20.08 19.97 18.78 20.55 18.99 19.57 F1LZ81 Dock4 6 57.6901791 366608 + 57.6901791 57.900358 dedicator of cytokinesis 4 None DWGSMWKQLYVRNEGDLFHR None None None 18.2 16.39 18.07 17.36 18.46 19.25 18.14 17.28 18.99 16.72 18.13 18.68 18.83 17.98 18.8 19.53 18.08 18.14 19.04 16.61 18.53 17.27 18.72 18.36 18.16 18.17 18.71 18.24 17.67 18.37 18.47 D3ZRC4 Pnpla8 6 61.3298111 314075 + 61.3298111 61.391736 calcium-independent phospholipase a2-gamma None LCITRVEELTFHLLEFPEGK None 612123 12136 19.15 16.79 18.99 18.82 18.11 18.08 18.83 18.14 18.05 18.55 18.49 16.94 18.99 18.16 19.76 17.62 18.69 18.88 17.61 17.81 19.39 19.52 18.77 18.99 19.65 19.62 18.44 18.32 18.04 18.92 19.32 A0A0G2K329 Nrcam 6 61.3298631 497815 + 61.3298631 61.702992 neuronal cell adhesion molecule None EKEPAEGNESSEAPSPVNAMNSFV None 601581 21041 20.82 19.08 20.41 20.38 19.89 21.78 19.99 19.88 20.03 20.52 20.18 21.17 21.19 21.7 20.09 21.16 21.15 20.93 20.07 21.36 21.34 20.74 21.34 20.96 21.29 21.6 19.71 21.89 21.3 21.31 21.23 A0A0G2K3Q5 Nrcam 6 61.3298631 497815 + 61.3298631 61.702992 neuronal cell adhesion molecule None SPKDYIIDPRENIVIQCEAK None 601581 21041 20.81 19.12 20.38 20.41 19.9 21.74 20.19 19.89 20.01 20.61 20.23 21.12 21.18 21.7 20.05 21.17 21.19 20.88 20.04 21.38 21.29 20.76 21.38 20.78 21.33 21.59 19.58 21.88 21.42 21.29 21.21 P97686 Nrcam 6 61.3298631 497815 + 61.3298631 61.702992 neuronal cell adhesion molecule None SFECKVKHDHTLIPTILWLK None 601581 21041 20.85 19.11 20.43 20.41 19.9 21.77 20.11 19.87 20.06 20.51 20.21 21.18 21.2 21.7 19.97 21.17 21.13 20.92 20.13 21.39 21.31 20.75 21.33 20.79 21.33 21.55 19.64 21.94 21.35 21.28 21.23 D3ZCI5 Stxbp6 6 61.9235921 362734 - 61.9235921 62.157387 syntaxin-binding protein 6 None HTCQRYLTDRKPEFINCQSK None None None 18.77 19.43 19.46 19.14 18.67 18.96 17.92 18.56 18.53 18.79 18.71 17.8 18.01 18.26 19.6 18.46 18.54 18.95 19.56 17.5 19.54 19.08 18.64 19.75 19.71 19.05 19.64 18.59 17.74 18.0 18.57 D4AAF8 Nova1 6 63.783491 298992 - 63.783491 63.905543 rna-binding protein nova-1 None SKDVVEIAVPENLVGAILGK None None None 19.37 17.76 18.88 19.25 19.09 18.29 17.67 19.16 18.68 18.17 19.12 18.6 18.7 19.09 18.83 17.87 17.9 18.93 19.18 20.08 18.69 18.63 18.45 19.35 19.54 19.13 19.82 17.71 19.57 19.62 19.93 Q80WA4 Nova1 6 63.783491 298992 - 63.783491 63.905543 rna-binding protein nova-1 None AIMEQSGAWVQLSQKPDGINLQER None None None 19.4 17.34 18.86 19.22 19.06 18.24 17.75 19.05 18.85 18.17 19.03 18.64 18.8 19.21 18.74 17.78 17.86 18.95 19.12 20.15 18.86 18.65 18.63 19.32 19.45 19.15 19.71 17.66 19.65 19.78 19.7 P01836 Kaca 6 67.3910971 + 67.3910971 67.391413 ig kappa chain c region, a allele None IDGSEQRDGVLDSVTDQDSK None None None 21.43 19.02 20.11 21.43 21.2 21.63 21.81 21.12 20.61 21.58 21.9 21.25 21.38 20.28 20.55 20.24 21.55 19.71 20.44 21.57 21.25 19.13 20.81 20.75 19.42 19.91 19.4 20.41 21.16 20.23 21.8 Q9WTQ1 Prkd1 6 67.7255131 85421 - 67.7255131 68.038697 serine/threonine-protein kinase d1 None QEDSNRTISPSTSNNIPLMR None 605435 55680 15.56 15.41 15.18 14.82 14.49 15.4 14.7 14.51 14.0 14.32 15.3 13.7 13.5 15.73 14.36 14.4 14.45 15.37 15.41 13.73 14.34 15.09 14.5 13.54 16.04 14.71 14.81 15.78 14.45 14.94 14.38 Q62991 Scfd1 6 68.7958451 54350 + 68.7958451 68.874086 sec1 family domain-containing protein 1 None GSPFPEVAESVQQELESYRAQEDEVK None None 5650 18.49 16.55 16.98 19.62 19.24 17.35 19.19 17.18 18.44 16.96 18.65 19.24 19.01 18.23 18.95 17.83 18.27 17.1 19.39 17.48 17.97 17.79 18.2 18.31 18.7 17.83 18.94 17.9 16.85 18.69 18.9 B1H259 Coch 6 69.0311681 362735 + 69.0311681 69.045109 coagulation factor c homolog (limulus polyphemus), isoform cra_a None SPNKNFLVIVTDGQSYDDVR None 603196 20868 18.59 16.39 18.37 17.04 16.76 17.27 17.76 19.79 16.25 17.25 18.57 16.65 17.5 17.45 18.72 17.55 17.74 18.13 16.6 16.56 16.74 17.76 18.16 16.82 17.65 18.69 16.71 19.29 16.92 17.78 18.01 E9PT82 Strn3 6 69.0477471 114520 - 69.0477471 69.134084 striatin-3 None LKEFDFLVTAEDGEGAGEAR None None 82078 18.28 17.79 18.89 18.49 18.83 18.8 17.3 17.77 19.47 17.9 17.87 19.73 19.42 19.54 18.86 18.25 17.92 18.91 19.11 19.64 19.89 18.84 19.0 19.76 19.31 18.25 19.01 18.78 19.51 19.5 19.77 P58405 Strn3 6 69.0477471 114520 - 69.0477471 69.134084 striatin-3 None QLLRQYLQEVGYTDTILDVR None None 82078 18.54 17.29 18.88 18.47 18.83 18.84 17.81 17.65 19.68 17.78 17.95 19.92 19.48 19.62 18.47 18.25 17.98 18.85 19.35 19.68 19.92 18.86 19.07 19.91 18.99 18.2 19.53 18.1 19.12 19.37 19.66 D3ZLS5 Hectd1 6 69.1820271 362736 - 69.1820271 69.267914 hect-type e3 ubiquitin transferase None VSALAGPSSDDENEEESKPEK None None 9115 19.1 16.31 17.39 16.54 16.87 17.13 17.21 18.41 17.28 17.53 17.92 17.22 18.07 17.48 18.11 18.15 17.32 18.9 17.58 17.33 17.73 18.31 17.7